F461692

General Info

Members Datasets Scaffolds Average Seq Length
544 324 1088 93

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10002716|rootH2_100027163
Length 105
Sequence MSETNETPSASNPGAALDTAARPKLNKLFRMQWEPAQDAHVLLYPEGMVKLNQSAAEILKRCDGTRDVAAIVGDLERSFNAAGIAPEVEAFIAHAFARGWLEHSA

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
87 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
88 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
145 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
150 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
157 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
164 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
165 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
166 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
167 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
168 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
169 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
170 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
171 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
186 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
187 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
188 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
189 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
190 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
194 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
195 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
199 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
200 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
207 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
218 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
222 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
223 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
233 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
234 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
235 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
236 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
237 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
238 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
239 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
240 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
243 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
257 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
260 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
263 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
264 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
265 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
269 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
285 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
286 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
287 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
288 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
289 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
290 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
291 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
292 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
293 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
294 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
296 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
300 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
301 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
302 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
303 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
304 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
305 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
309 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
310 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
311 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
312 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
313 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
314 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
315 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
316 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
317 2818991450 Burkholderia sp. 604 Isolate Unclassified
318 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
319 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
320 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
321 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
322 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
323 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
324 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.96
Metatranscriptomes 1.29
Isolates 2.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.99
Nodule 1.1
Rhizoplane 5.51
Rhizosphere 75.37
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10002716 3300003320 Bacteria 1633
2 JGI24737J22298_10149278 3300001990 Bacteria 690
3 JGI24735J21928_10115118 3300002067 Bacteria 774
4 JGI25156J39149_1001373 3300002705 Bacteria 10417
5 JGI25164J39214_1021669 3300002772 Bacteria 563
6 JGI25165J46597_1002677 3300003214 Bacteria 5346
7 rootH1_10106033 3300003316 Bacteria 1031
8 rootH1_10089815 3300003323 Bacteria 1098
9 rootH1_10178965 3300003323 Bacteria 2444
10 JGI25160J50197_1000120 3300003354 Bacteria 71260
11 Ga0006556J51387_1024168 3300003479 Bacteria 4133
12 Ga0006560J51390_1032319 3300003565 Bacteria 694
13 Ga0006554J51385_1022598 3300003567 Bacteria 4366
14 Ga0055533_1000069 3300003756 Bacteria 153904
15 Ga0055533_1001661 3300003756 Bacteria 5723
16 Ga0055532_1000011 3300003758 Bacteria 385294
17 Ga0055525_1003513 3300003759 Bacteria 1400
18 Ga0055527_1000009 3300003760 Bacteria 385294
19 Ga0055535_1000008 3300003761 Bacteria 385294
20 Ga0055542_1000014 3300003762 Bacteria 385294
21 Ga0055529_1000010 3300003763 Bacteria 385294
22 Ga0065165_1000382 3300005262 Bacteria 71834
23 Ga0070658_10014510 3300005327 Bacteria 6323
24 Ga0070658_10206864 3300005327 Bacteria 1657
25 Ga0070676_10870387 3300005328 Bacteria 669
26 Ga0070683_100939690 3300005329 Bacteria 830
27 Ga0070670_100231657 3300005331 Bacteria 1608
28 Ga0070666_10015001 3300005335 Bacteria 4937
29 Ga0070682_100925819 3300005337 Bacteria 718
30 Ga0068868_100562085 3300005338 Bacteria 1007
31 Ga0070687_100233499 3300005343 Bacteria 1133
32 Ga0070661_100685849 3300005344 Bacteria 834
33 Ga0070669_101952536 3300005353 Bacteria 513
34 Ga0070673_100720794 3300005364 Bacteria 917
35 Ga0070667_100000005 3300005367 Bacteria 347268
36 Ga0070667_100212841 3300005367 Bacteria 1718
37 Ga0070667_100514913 3300005367 Bacteria 1097
38 Ga0070667_101376198 3300005367 Bacteria 662
39 Ga0070714_102109065 3300005435 Bacteria 549
40 Ga0070663_100000863 3300005455 Bacteria 16451
41 Ga0070663_100092509 3300005455 Bacteria 2242
42 Ga0070663_100345137 3300005455 Bacteria 1204
43 Ga0070663_100373258 3300005455 Bacteria 1160
44 Ga0070678_100395777 3300005456 Bacteria 1199
45 Ga0070662_100109485 3300005457 Bacteria 2102
46 Ga0070681_10731320 3300005458 Bacteria 906
47 Ga0068867_100248678 3300005459 Bacteria 1445
48 Ga0070679_100010966 3300005530 Bacteria 8612
49 Ga0070679_100426895 3300005530 Bacteria 1271
50 Ga0070684_101936040 3300005535 Unclassified 556
51 Ga0068853_100001185 3300005539 Bacteria 18561
52 Ga0068853_101638623 3300005539 Bacteria 623
53 Ga0070665_100001482 3300005548 Bacteria 27442
54 Ga0070665_101679717 3300005548 Bacteria 642
55 Ga0068855_100446042 3300005563 Bacteria 1412
56 Ga0068855_101646058 3300005563 Bacteria 656
57 Ga0070664_101615749 3300005564 Unclassified 614
58 Ga0068857_100796136 3300005577 Bacteria 902
59 Ga0068856_101910975 3300005614 Bacteria 604
60 Ga0070702_100064464 3300005615 Bacteria 2144
61 Ga0068852_100105905 3300005616 Bacteria 2548
62 Ga0068859_100350713 3300005617 Bacteria 1571
63 Ga0068861_100611089 3300005719 Bacteria 1002
64 Ga0068861_100766628 3300005719 Bacteria 902
65 Ga0068851_10094145 3300005834 Bacteria 1581
66 Ga0068863_100863041 3300005841 Bacteria 904
67 Ga0068863_101719470 3300005841 Bacteria 637
68 Ga0068858_100001325 3300005842 Bacteria 25564
69 Ga0068858_100858197 3300005842 Bacteria 887
70 Ga0068858_101460978 3300005842 Bacteria 674
71 Ga0068860_102753574 3300005843 Bacteria 510
72 Ga0068862_101075482 3300005844 Bacteria 798
73 Ga0075366_10085117 3300006195 Bacteria 1891
74 Ga0075366_10091273 3300006195 Bacteria 1824
75 Ga0075366_10114677 3300006195 Bacteria 1623
76 Ga0075430_100003144 3300006846 Bacteria 13809
77 Ga0075433_10132484 3300006852 Bacteria 2215
78 Ga0075433_10329441 3300006852 Bacteria 1350
79 Ga0075429_100036201 3300006880 Bacteria 4292
80 Ga0068865_100028776 3300006881 Bacteria 3680
81 Ga0097620_100350704 3300006931 Bacteria 1571
82 Ga0075435_100404563 3300007076 Bacteria 1174
83 Ga0105251_10000072 3300009011 Bacteria 97611
84 Ga0105251_10169162 3300009011 Bacteria 985
85 Ga0105240_10228544 3300009093 Bacteria 2164
86 Ga0105240_10291700 3300009093 Bacteria 1869
87 Ga0105240_10294198 3300009093 Bacteria 1860
88 Ga0105240_10379903 3300009093 Bacteria 1596
89 Ga0105240_10452869 3300009093 Bacteria 1436
90 Ga0105240_10525792 3300009093 Bacteria 1312
91 Ga0105240_10716029 3300009093 Bacteria 1091
92 Ga0111539_11491180 3300009094 Bacteria 784
93 Ga0105245_10767866 3300009098 Bacteria 1000
94 Ga0105247_10685678 3300009101 Bacteria 769
95 Ga0105247_11399954 3300009101 Bacteria 566
96 Ga0105243_11070924 3300009148 Bacteria 813
97 Ga0105241_10190297 3300009174 Bacteria 1708
98 Ga0105241_10381961 3300009174 Bacteria 1231
99 Ga0105242_10212509 3300009176 Bacteria 1725
100 Ga0105248_10004222 3300009177 Bacteria 15890
101 Ga0105248_10088493 3300009177 Bacteria 3485
102 Ga0105237_10225886 3300009545 Bacteria 1873
103 Ga0105237_10785164 3300009545 Bacteria 959
104 Ga0105237_10819512 3300009545 Bacteria 937
105 Ga0105237_11671222 3300009545 Bacteria 644
106 Ga0105237_11861385 3300009545 Bacteria 610
107 Ga0105238_10312821 3300009551 Bacteria 1556
108 Ga0105238_11988896 3300009551 Bacteria 615
109 Ga0105249_10004112 3300009553 Bacteria 12563
110 Ga0105249_10087483 3300009553 Bacteria 2907
111 Ga0105239_10332644 3300010375 Bacteria 1714
112 Ga0105239_10548532 3300010375 Bacteria 1316
113 Ga0105239_10839957 3300010375 Bacteria 1053
114 Ga0105239_10849399 3300010375 Bacteria 1047
115 Ga0105239_12951931 3300010375 Bacteria 555
116 Ga0105246_10074505 3300011119 Bacteria 2400
117 Ga0105246_10394128 3300011119 Bacteria 1148
118 Ga0157370_11676338 3300013104 Bacteria 571
119 Ga0157370_11977317 3300013104 Bacteria 523
120 Ga0157369_10305799 3300013105 Bacteria 1654
121 Ga0157369_10919666 3300013105 Bacteria 897
122 Ga0157374_11839256 3300013296 Bacteria 631
123 Ga0157374_12844688 3300013296 Bacteria 511
124 Ga0163162_10056212 3300013306 Bacteria 3964
125 Ga0163162_10819635 3300013306 Bacteria 1047
126 Ga0157375_11355288 3300013308 Bacteria 837
127 Ga0157375_12659550 3300013308 Bacteria 598
128 Ga0163163_11487293 3300014325 Bacteria 739
129 Ga0157380_11347436 3300014326 Bacteria 762
130 Ga0182008_10805159 3300014497 Bacteria 546
131 Ga0157376_10178088 3300014969 Bacteria 1941
132 Ga0157376_10378604 3300014969 Bacteria 1363
133 Ga0182006_1057606 3300015261 Bacteria 1476
134 Ga0182007_10001285 3300015262 Bacteria 13587
135 Ga0182007_10192955 3300015262 Bacteria 709
136 Ga0182007_10372998 3300015262 Bacteria 540
137 Ga0209674_100011 3300025226 Bacteria 997175
138 Ga0209674_100029 3300025226 Bacteria 466683
139 Ga0209672_100002 3300025228 Bacteria 1733325
140 Ga0209672_100912 3300025228 Bacteria 13431
141 Ga0209147_100003 3300025229 Bacteria 1733325
142 Ga0209563_103351 3300025230 Bacteria 3338
143 Ga0207427_100974 3300025231 Bacteria 12147
144 Ga0209258_100005 3300025242 Bacteria 1087938
145 Ga0209148_1000006 3300025254 Bacteria 1733325
146 Ga0209759_1000006 3300025256 Bacteria 492407
147 Ga0209759_1000008 3300025256 Bacteria 461395
148 Ga0209759_1016289 3300025256 Bacteria 1883
149 Ga0209233_1000018 3300025261 Bacteria 886857
150 Ga0209455_1000003 3300025272 Bacteria 1471893
151 Ga0209130_1023670 3300025284 Bacteria 1351
152 Ga0209564_1016088 3300025295 Bacteria 3000
153 Ga0207426_1000004 3300025302 Bacteria 1047900
154 Ga0207656_10015702 3300025321 Bacteria 2935
155 Ga0207713_1000651 3300025735 Bacteria 33250
156 Ga0207713_1115612 3300025735 Bacteria 906
157 Ga0207642_10137025 3300025899 Bacteria 1285
158 Ga0207647_10002915 3300025904 Bacteria 12879
159 Ga0207647_10004202 3300025904 Bacteria 10680
160 Ga0207647_10034998 3300025904 Bacteria 3203
161 Ga0207647_10214418 3300025904 Bacteria 1111
162 Ga0207705_10021485 3300025909 Bacteria 4607
163 Ga0207705_10024412 3300025909 Bacteria 4314
164 Ga0207705_10659949 3300025909 Bacteria 813
165 Ga0207705_10725519 3300025909 Bacteria 772
166 Ga0207654_10200922 3300025911 Bacteria 1312
167 Ga0207654_10301682 3300025911 Bacteria 1089
168 Ga0207707_10021490 3300025912 Bacteria 5641
169 Ga0207695_10005921 3300025913 Bacteria 16024
170 Ga0207695_10009895 3300025913 Bacteria 11716
171 Ga0207695_10224049 3300025913 Bacteria 1787
172 Ga0207695_10269743 3300025913 Bacteria 1597
173 Ga0207695_10287185 3300025913 Bacteria 1538
174 Ga0207695_10565807 3300025913 Bacteria 1018
175 Ga0207671_10021603 3300025914 Bacteria 4879
176 Ga0207671_10027492 3300025914 Bacteria 4253
177 Ga0207671_10113674 3300025914 Bacteria 2063
178 Ga0207693_10311651 3300025915 Bacteria 1232
179 Ga0207662_10025011 3300025918 Bacteria 3438
180 Ga0207657_10000106 3300025919 Bacteria 81298
181 Ga0207649_11006960 3300025920 Bacteria 656
182 Ga0207652_10019859 3300025921 Bacteria 5531
183 Ga0207694_10028661 3300025924 Bacteria 4245
184 Ga0207694_11419376 3300025924 Bacteria 586
185 Ga0207650_10035656 3300025925 Bacteria 3614
186 Ga0207700_10147037 3300025928 Bacteria 1943
187 Ga0207706_10031716 3300025933 Bacteria 4706
188 Ga0207704_10002823 3300025938 Bacteria 7836
189 Ga0207711_10002383 3300025941 Bacteria 16811
190 Ga0207711_10080810 3300025941 Bacteria 2840
191 Ga0207689_10011249 3300025942 Bacteria 7681
192 Ga0207689_10194432 3300025942 Bacteria 1674
193 Ga0207661_10922709 3300025944 Bacteria 804
194 Ga0207667_10006338 3300025949 Bacteria 14342
195 Ga0207667_10687496 3300025949 Bacteria 1026
196 Ga0207667_11878199 3300025949 Bacteria 561
197 Ga0207651_10140151 3300025960 Bacteria 1867
198 Ga0207712_10000165 3300025961 Bacteria 68118
199 Ga0207712_10000771 3300025961 Bacteria 23954
200 Ga0207658_10000006 3300025986 Bacteria 392309
201 Ga0207658_10087220 3300025986 Bacteria 2409
202 Ga0207658_10303185 3300025986 Bacteria 1377
203 Ga0207658_10400563 3300025986 Bacteria 1206
204 Ga0207658_11433148 3300025986 Bacteria 632
205 Ga0207677_10552296 3300026023 Bacteria 1004
206 Ga0207677_10851132 3300026023 Bacteria 819
207 Ga0207703_10000553 3300026035 Bacteria 38426
208 Ga0207703_10817604 3300026035 Bacteria 890
209 Ga0207703_10847464 3300026035 Bacteria 874
210 Ga0207639_10000217 3300026041 Bacteria 42907
211 Ga0207639_10001889 3300026041 Bacteria 14072
212 Ga0207678_10001340 3300026067 Bacteria 22694
213 Ga0207678_10005262 3300026067 Bacteria 11593
214 Ga0207678_10072326 3300026067 Bacteria 2955
215 Ga0207678_10396523 3300026067 Bacteria 1194
216 Ga0207702_10144942 3300026078 Bacteria 2154
217 Ga0207702_10161369 3300026078 Bacteria 2047
218 Ga0207702_10880281 3300026078 Bacteria 887
219 Ga0207641_10223325 3300026088 Bacteria 1748
220 Ga0207641_10572797 3300026088 Bacteria 1103
221 Ga0207648_10083359 3300026089 Bacteria 2789
222 Ga0207676_10439967 3300026095 Bacteria 1227
223 Ga0207674_10058202 3300026116 Bacteria 3916
224 Ga0207674_10418487 3300026116 Bacteria 1295
225 Ga0207675_100000611 3300026118 Bacteria 34846
226 Ga0207675_100694023 3300026118 Bacteria 1026
227 Ga0207683_10420751 3300026121 Bacteria 1230
228 Ga0207698_10059204 3300026142 Bacteria 2973
229 Ga0209371_1025176 3300027312 Bacteria 1371
230 Ga0268266_10000006 3300028379 Bacteria 1410021
231 Ga0268266_10434051 3300028379 Bacteria 1246
232 Ga0268266_11207760 3300028379 Bacteria 731
233 Ga0268265_11547909 3300028380 Bacteria 667
234 Ga0307517_10161543 3300028786 Bacteria 1502
235 Ga0307515_10003504 3300028794 Bacteria 32990
236 Ga0268256_1003422 3300030500 Bacteria 7151
237 Ga0307512_10232634 3300030522 Bacteria 945
238 Ga0307513_10019384 3300031456 Bacteria 8099
239 Ga0307513_10161600 3300031456 Bacteria 2132
240 Ga0307509_10052586 3300031507 Bacteria 4347
241 Ga0307509_10295109 3300031507 Bacteria 1373
242 Ga0307509_10380731 3300031507 Bacteria 1124
243 Ga0307408_100001665 3300031548 Bacteria 16373
244 Ga0307408_100042961 3300031548 Bacteria 3214
245 Ga0307508_10000053 3300031616 Bacteria 128020
246 Ga0307514_10009921 3300031649 Bacteria 7977
247 Ga0307413_10311712 3300031824 Bacteria 1198
248 Ga0307413_11052784 3300031824 Bacteria 700
249 Ga0307412_10142532 3300031911 Bacteria 1757
250 Ga0307409_100514450 3300031995 Bacteria 1168
251 Ga0307409_101775910 3300031995 Bacteria 646
252 Ga0307416_100419758 3300032002 Bacteria 1381
253 Ga0307416_103050290 3300032002 Bacteria 560
254 Ga0307411_10179311 3300032005 Bacteria 1606
255 Ga0307411_11424621 3300032005 Bacteria 635
256 Ga0307507_10080213 3300033179 Bacteria 2879
257 Ga0307507_10551831 3300033179 Bacteria 607
258 Ga0373936_0451767 3300035113 Bacteria 594
259 Ga0373925_1092202 3300037068 Bacteria 656
260 Ga0395900_0084848 3300037418 Bacteria 3255
261 Ga0395900_0473252 3300037418 Bacteria 1206
262 Ga0395898_0142771 3300037466 Bacteria 2292
263 Ga0395898_0187754 3300037466 Bacteria 1975
264 Ga0395905_0000039 3300037471 Bacteria 253197
265 Ga0395905_0091309 3300037471 Bacteria 2855
266 Ga0395905_1209064 3300037471 Bacteria 659
267 Ga0395901_0529031 3300038443 Bacteria 1197
268 Ga0451793_0076916 3300041452 Bacteria 648
269 Ga0451793_1177328 3300041452 Bacteria 914
270 Ga0451797_0887103 3300041453 Bacteria 1026
271 Ga0451795_1342154 3300041456 Bacteria 944
272 Ga0451800_0194703 3300041459 Bacteria 541
273 Ga0451853_2236014 3300041512 Bacteria 853
274 Ga0439448_0001060 3300042005 Bacteria 6899
275 Ga0439464_0094293 3300042439 Bacteria 905
276 Ga0450918_010999 3300042531 Bacteria 1578
277 Ga0466965_0100991 3300044683 Bacteria 1475
278 Ga0466966_0176120 3300044684 Bacteria 1299
279 Ga0466970_0464989 3300044765 Bacteria 726
280 Ga0466959_0548031 3300045049 Bacteria 780
281 Ga0451576_0460724 3300045051 Bacteria 1335
282 Ga0495592_0006627 3300046454 Bacteria 8634
283 Ga0495592_0641903 3300046454 Bacteria 644
284 Ga0495603_0000247 3300046455 Bacteria 28211
285 Ga0495603_0100980 3300046455 Bacteria 1684
286 Ga0495590_0001683 3300046457 Bacteria 9401
287 Ga0495629_0003745 3300046459 Bacteria 11453
288 Ga0495629_0077737 3300046459 Bacteria 2316
289 Ga0495651_0205293 3300046462 Bacteria 1376
290 Ga0495653_0003596 3300046463 Bacteria 12498
291 Ga0495653_0044728 3300046463 Bacteria 3435
292 Ga0495650_0010946 3300046471 Bacteria 5018
293 Ga0495580_0000077 3300046472 Bacteria 61724
294 Ga0495580_0132390 3300046472 Bacteria 1729
295 Ga0495580_0207064 3300046472 Bacteria 1350
296 Ga0495580_0334655 3300046472 Bacteria 1027
297 Ga0495582_0001360 3300046473 Bacteria 13761
298 Ga0495605_0020633 3300046474 Bacteria 3500
299 Ga0495664_0026303 3300046477 Bacteria 3388
300 Ga0495664_0109405 3300046477 Bacteria 1667
301 Ga0495584_0504377 3300046491 Bacteria 616
302 Ga0495596_0062364 3300046500 Bacteria 1451
303 Ga0495607_0552629 3300046501 Bacteria 505
304 Ga0495583_0001664 3300046506 Bacteria 21537
305 Ga0495606_0111729 3300046507 Bacteria 1647
306 Ga0495606_0162752 3300046507 Bacteria 1300
307 Ga0495608_0025361 3300046511 Bacteria 4047
308 Ga0495616_0047661 3300046513 Bacteria 2157
309 Ga0495616_0185493 3300046513 Bacteria 922
310 Ga0495618_0118358 3300046514 Bacteria 1696
311 Ga0495618_0557035 3300046514 Bacteria 686
312 Ga0495620_0161638 3300046515 Bacteria 870
313 Ga0495628_0025779 3300046516 Bacteria 4800
314 Ga0495630_0018183 3300046517 Bacteria 5160
315 Ga0495630_0020919 3300046517 Bacteria 4829
316 Ga0495643_0036848 3300046522 Bacteria 2685
317 Ga0495648_0023684 3300046524 Bacteria 4197
318 Ga0495666_0009511 3300046526 Bacteria 4856
319 Ga0495666_0189422 3300046526 Bacteria 948
320 Ga0495642_0018018 3300046528 Bacteria 2761
321 Ga0495642_0440985 3300046528 Bacteria 575
322 Ga0495652_0004163 3300046529 Bacteria 13951
323 Ga0495652_0056818 3300046529 Bacteria 3321
324 Ga0495665_0000850 3300046531 Bacteria 15980
325 Ga0495665_0021493 3300046531 Bacteria 3466
326 Ga0495665_0165036 3300046531 Bacteria 1154
327 Ga0495640_0008215 3300046533 Bacteria 8190
328 Ga0495586_0037653 3300046535 Bacteria 2597
329 Ga0495586_0159395 3300046535 Bacteria 1272
330 Ga0495621_0394941 3300046539 Bacteria 586
331 Ga0495621_0492156 3300046539 Bacteria 528
332 Ga0495597_0166484 3300046542 Bacteria 897
333 Ga0495645_0023969 3300046543 Bacteria 4423
334 Ga0495645_0070669 3300046543 Bacteria 2519
335 Ga0495622_0010468 3300046557 Bacteria 4284
336 Ga0495667_0111617 3300046559 Bacteria 1766
337 Ga0495634_0008158 3300046642 Bacteria 7803
338 Ga0495611_0483737 3300046648 Bacteria 563
339 Ga0495625_0253692 3300046660 Bacteria 1141
340 Ga0495635_0005087 3300046663 Bacteria 9143
341 Ga0495635_0025331 3300046663 Bacteria 4131
342 Ga0495657_0001839 3300046675 Bacteria 18127
343 Ga0495599_0187895 3300046678 Bacteria 1272
344 Ga0495623_0019217 3300046679 Bacteria 4417
345 Ga0495623_0320343 3300046679 Bacteria 851
346 Ga0495646_0017502 3300046680 Bacteria 4546
347 Ga0495646_0068778 3300046680 Bacteria 2089
348 Ga0495646_0217935 3300046680 Bacteria 1033
349 Ga0495613_0282158 3300046689 Bacteria 1153
350 Ga0495624_0001568 3300046690 Bacteria 17628
351 Ga0495624_0103661 3300046690 Bacteria 1750
352 Ga0495671_0411043 3300046692 Bacteria 647
353 Ga0495649_0036378 3300046694 Bacteria 2705
354 Ga0495649_0039492 3300046694 Bacteria 2587
355 Ga0495649_0551189 3300046694 Bacteria 571
356 Ga0495589_0080983 3300046794 Bacteria 1580
357 Ga0495589_0109597 3300046794 Bacteria 1333
358 Ga0495589_0374318 3300046794 Bacteria 655
359 Ga0495600_0001799 3300046809 Bacteria 11988
360 Ga0495600_0289063 3300046809 Bacteria 1036
361 Ga0495660_0137888 3300046810 Bacteria 1217
362 Ga0495581_0007999 3300047315 Bacteria 6126
363 Ga0495581_0158484 3300047315 Bacteria 1323
364 Ga0495604_0004577 3300047317 Bacteria 10955
365 Ga0495604_0177382 3300047317 Bacteria 1492
366 Ga0495674_0031845 3300047319 Bacteria 4785
367 Ga0495674_0620974 3300047319 Bacteria 854
368 Ga0495672_0104709 3300047320 Bacteria 1528
369 Ga0495672_0351509 3300047320 Bacteria 684
370 Ga0495676_0026141 3300047321 Bacteria 5028
371 Ga0495680_0001352 3300047322 Bacteria 26627
372 Ga0495680_0149557 3300047322 Bacteria 1703
373 Ga0495683_0017227 3300047323 Bacteria 3746
374 Ga0495683_0025842 3300047323 Bacteria 3007
375 Ga0495683_0033181 3300047323 Bacteria 2628
376 Ga0495683_0112853 3300047323 Bacteria 1296
377 Ga0495687_005610 3300047443 Bacteria 7934
378 Ga0495687_075205 3300047443 Bacteria 1340
379 Ga0495675_0051168 3300047444 Bacteria 2624
380 Ga0495677_0029282 3300047445 Bacteria 2002
381 Ga0495679_072436 3300047446 Bacteria 990
382 Ga0495673_0036353 3300047469 Bacteria 2260
383 Ga0495684_0052694 3300047471 Bacteria 3105
384 Ga0495686_0012876 3300047472 Bacteria 5832
385 Ga0495593_0017472 3300047673 Bacteria 4037
386 Ga0495593_0141927 3300047673 Bacteria 1216
387 Ga0495602_0000552 3300048088 Bacteria 34944
388 Ga0495602_0097313 3300048088 Bacteria 2424
389 Ga0495614_0004082 3300048089 Bacteria 6568
390 Ga0495614_0472528 3300048089 Bacteria 595
391 Ga0495626_0011215 3300048091 Bacteria 4747
392 Ga0496100_0000132 3300048903 Bacteria 41949
393 Ga0496101_0000208 3300048904 Bacteria 44706
394 Ga0496101_0079374 3300048904 Bacteria 2422
395 Ga0496101_0430351 3300048904 Bacteria 1040
396 Ga0496101_0615525 3300048904 Bacteria 858
397 Ga0496102_0000731 3300048905 Bacteria 32282
398 Ga0496102_0499983 3300048905 Bacteria 1138
399 Ga0496102_0517043 3300048905 Bacteria 1116
400 Ga0496102_1143031 3300048905 Bacteria 698
401 Ga0496103_0000654 3300048906 Bacteria 26241
402 Ga0496103_0428219 3300048906 Bacteria 849
403 Ga0496104_0087388 3300048907 Bacteria 2977
404 Ga0496104_0357713 3300048907 Bacteria 1372
405 Ga0496104_0469713 3300048907 Bacteria 1169
406 Ga0496105_0009985 3300048908 Bacteria 7448
407 Ga0496105_0254649 3300048908 Bacteria 1421
408 Ga0496106_0000001 3300048909 Bacteria 497458
409 Ga0496106_0547638 3300048909 Bacteria 928
410 Ga0496107_0591482 3300048910 Bacteria 820
411 Ga0496112_0006167 3300048915 Bacteria 10485
412 Ga0496113_0003166 3300048916 Bacteria 9799
413 Ga0496113_0480200 3300048916 Bacteria 998
414 Ga0496113_0483698 3300048916 Bacteria 994
415 Ga0496114_0454822 3300048917 Bacteria 1134
416 Ga0496115_0102301 3300048918 Bacteria 2350
417 Ga0496116_0028460 3300048919 Bacteria 4048
418 Ga0496116_0097203 3300048919 Bacteria 1771
419 Ga0496116_0249762 3300048919 Bacteria 884
420 Ga0496116_0438438 3300048919 Bacteria 564
421 Ga0496117_0000963 3300048920 Bacteria 44072
422 Ga0496117_0008631 3300048920 Bacteria 9646
423 Ga0496117_0033361 3300048920 Bacteria 3894
424 Ga0496117_0158977 3300048920 Bacteria 1327
425 Ga0496117_0285966 3300048920 Bacteria 880
426 Ga0496118_0000177 3300048921 Bacteria 114183
427 Ga0496118_0000574 3300048921 Bacteria 60884
428 Ga0496118_0002675 3300048921 Bacteria 23557
429 Ga0496118_0006320 3300048921 Bacteria 13092
430 Ga0496118_0033196 3300048921 Bacteria 4239
431 Ga0496119_0032112 3300048922 Bacteria 3505
432 Ga0496119_0163467 3300048922 Bacteria 1181
433 Ga0496120_0107924 3300048923 Bacteria 1459
434 Ga0496120_0217042 3300048923 Bacteria 916
435 Ga0496121_0000877 3300048924 Bacteria 54435
436 Ga0496121_0005367 3300048924 Bacteria 16474
437 Ga0496121_0015162 3300048924 Bacteria 8105
438 Ga0496121_0084863 3300048924 Bacteria 2495
439 Ga0496121_0099534 3300048924 Bacteria 2247
440 Ga0496121_0344296 3300048924 Bacteria 995
441 Ga0496122_0000487 3300048925 Bacteria 82253
442 Ga0496122_0076495 3300048925 Bacteria 2355
443 Ga0496123_0000296 3300048926 Bacteria 97428
444 Ga0496123_0186825 3300048926 Bacteria 1076
445 Ga0496124_0059950 3300048927 Bacteria 3195
446 Ga0496125_0153037 3300048928 Bacteria 1581
447 Ga0496126_0000328 3300048929 Bacteria 101511
448 Ga0496126_0001078 3300048929 Bacteria 45930
449 Ga0496126_0418476 3300048929 Bacteria 1084
450 Ga0496126_0642945 3300048929 Bacteria 831
451 Ga0496126_1015914 3300048929 Bacteria 621
452 Ga0501307_004839 3300049162 Bacteria 1396
453 Ga0495682_0015971 3300049460 Bacteria 2841
454 Ga0501031_0063686 3300049568 Bacteria 2402
455 Ga0501033_0068452 3300049570 Bacteria 2610
456 Ga0501036_0010027 3300049572 Bacteria 7804
457 Ga0501036_0753042 3300049572 Bacteria 803
458 Ga0501036_0999325 3300049572 Bacteria 685
459 Ga0501037_0038972 3300049573 Bacteria 3500
460 Ga0501037_0079010 3300049573 Bacteria 2388
461 Ga0501038_0008585 3300049574 Bacteria 9377
462 Ga0501038_0505735 3300049574 Bacteria 923
463 Ga0501038_0895159 3300049574 Bacteria 655
464 Ga0501039_0056862 3300049575 Bacteria 3030
465 Ga0501039_0313074 3300049575 Bacteria 1234
466 Ga0501039_0394949 3300049575 Bacteria 1086
467 Ga0501040_0137309 3300049576 Bacteria 1721
468 Ga0501040_0700488 3300049576 Bacteria 732
469 Ga0501041_0001524 3300049577 Bacteria 12867
470 Ga0501041_0370787 3300049577 Bacteria 905
471 Ga0501042_0052269 3300049578 Bacteria 2914
472 Ga0501042_0130011 3300049578 Bacteria 1815
473 Ga0501043_0208833 3300049579 Bacteria 1513
474 Ga0501043_0308633 3300049579 Bacteria 1208
475 Ga0501046_0014995 3300049580 Bacteria 6519
476 Ga0501046_0173570 3300049580 Bacteria 1616
477 Ga0501047_0100626 3300049581 Bacteria 2770
478 Ga0501048_0008735 3300049582 Bacteria 7635
479 Ga0501048_0082779 3300049582 Bacteria 2263
480 Ga0501068_0029347 3300049584 Bacteria 3256
481 Ga0501070_0961166 3300049586 Bacteria 664
482 Ga0501071_0008303 3300049587 Bacteria 6858
483 Ga0501072_0001004 3300049588 Bacteria 20875
484 Ga0501072_0385876 3300049588 Bacteria 1111
485 Ga0501072_0478290 3300049588 Bacteria 986
486 Ga0501073_0046485 3300049589 Bacteria 3053
487 Ga0501073_1246344 3300049589 Bacteria 510
488 Ga0501074_0018807 3300049590 Bacteria 5019
489 Ga0501074_0477760 3300049590 Bacteria 883
490 Ga0501075_0001432 3300049591 Bacteria 15508
491 Ga0501075_0238745 3300049591 Bacteria 1385
492 Ga0501076_0000057 3300049592 Bacteria 55044
493 Ga0501076_0007592 3300049592 Bacteria 7895
494 Ga0501076_0224030 3300049592 Bacteria 1537
495 Ga0501077_0005766 3300049593 Bacteria 7545
496 Ga0501077_0078424 3300049593 Bacteria 2093
497 Ga0501079_0010984 3300049741 Bacteria 6900
498 Ga0501079_0019904 3300049741 Bacteria 5126
499 Ga0501080_0018539 3300049742 Bacteria 6438
500 Ga0501080_0216937 3300049742 Bacteria 1752
501 Ga0501081_0000123 3300049743 Bacteria 33954
502 Ga0501081_0320150 3300049743 Bacteria 1140
503 Ga0501081_0605253 3300049743 Bacteria 820
504 Ga0501035_0181543 3300049822 Bacteria 1813
505 Ga0501035_0284643 3300049822 Bacteria 1396
506 Ga0501045_0006796 3300049824 Bacteria 7924
507 Ga0501045_0015748 3300049824 Bacteria 5364
508 nmdc:mga0k408_1067_c1 3300050493 Bacteria 15070
509 nmdc:mga0k408_195555_c1 3300050493 Bacteria 1207
510 nmdc:mga0k408_203386_c1 3300050493 Bacteria 1182
511 nmdc:mga0k408_5106_c1 3300050493 Bacteria 5313
512 nmdc:mga08y16_1027460_c1 3300050511 Bacteria 803
513 nmdc:mga08y16_130253_c1 3300050511 Bacteria 2617
514 nmdc:mga0n895_257658_c1 3300050512 Bacteria 1770
515 Ga0500643_014854 3300053087 Bacteria 2688
516 Ga0500641_0198911 3300053096 Bacteria 856
517 Ga0500597_000210 3300053120 Bacteria 11970
518 Ga0500621_112137 3300053126 Bacteria 1064
519 Ga0500616_0006827 3300053153 Bacteria 7384
520 Ga0501084_0012962 3300054114 Bacteria 6904
521 Ga0501084_0112076 3300054114 Bacteria 2292
522 Ga0587088_083077 3300059508 Bacteria 689
523 Ga0587072_045925 3300059643 Bacteria 862
524 Ga0587102_057244 3300059649 Bacteria 537
525 Ga0501082_0002207 3300060353 Bacteria 17025
526 Ga0501082_0058322 3300060353 Bacteria 3326
527 Ga0530510_0005396 3300061734 Bacteria 8848
528 Ga0530510_0409961 3300061734 Bacteria 1022
529 Ga0530510_0437930 3300061734 Bacteria 987
530 2509130587 2508501125 Bacteria 7208311
531 2513958612 2513237151 Bacteria 6309801
532 2514047220 2513237166 Bacteria 10373764
533 2527075901 2526164713 Bacteria 6780608
534 2563059082 2562617112 Bacteria 10918404
535 2713480639 2711768613 Bacteria 11048459
536 2809144523 2808606418 Bacteria 6724496
537 2819620582 2818991450 Bacteria 6962147
538 2904486581 2904483920 Bacteria 7545285
539 2919527912 2919527303 Bacteria 7718827
540 2921644772 2921643360 Bacteria 11448031
541 2928108819 2928108538 Bacteria 7360024
542 2928136043 2928135762 Bacteria 7259641
543 2928504177 2928503688 Bacteria 7268108
544 8055304588 8055301274 Bacteria 8587385
545 rootH2_10002716
546 JGI24737J22298_10149278
547 JGI24735J21928_10115118
548 JGI25156J39149_1001373
549 JGI25164J39214_1021669
550 JGI25165J46597_1002677
551 rootH1_10106033
552 rootH1_10089815
553 rootH1_10178965
554 JGI25160J50197_1000120
555 Ga0006556J51387_1024168
556 Ga0006560J51390_1032319
557 Ga0006554J51385_1022598
558 Ga0055533_1000069
559 Ga0055533_1001661
560 Ga0055532_1000011
561 Ga0055525_1003513
562 Ga0055527_1000009
563 Ga0055535_1000008
564 Ga0055542_1000014
565 Ga0055529_1000010
566 Ga0065165_1000382
567 Ga0070658_10014510
568 Ga0070658_10206864
569 Ga0070676_10870387
570 Ga0070683_100939690
571 Ga0070670_100231657
572 Ga0070666_10015001
573 Ga0070682_100925819
574 Ga0068868_100562085
575 Ga0070687_100233499
576 Ga0070661_100685849
577 Ga0070669_101952536
578 Ga0070673_100720794
579 Ga0070667_100000005
580 Ga0070667_100212841
581 Ga0070667_100514913
582 Ga0070667_101376198
583 Ga0070714_102109065
584 Ga0070663_100000863
585 Ga0070663_100092509
586 Ga0070663_100345137
587 Ga0070663_100373258
588 Ga0070678_100395777
589 Ga0070662_100109485
590 Ga0070681_10731320
591 Ga0068867_100248678
592 Ga0070679_100010966
593 Ga0070679_100426895
594 Ga0070684_101936040
595 Ga0068853_100001185
596 Ga0068853_101638623
597 Ga0070665_100001482
598 Ga0070665_101679717
599 Ga0068855_100446042
600 Ga0068855_101646058
601 Ga0070664_101615749
602 Ga0068857_100796136
603 Ga0068856_101910975
604 Ga0070702_100064464
605 Ga0068852_100105905
606 Ga0068859_100350713
607 Ga0068861_100611089
608 Ga0068861_100766628
609 Ga0068851_10094145
610 Ga0068863_100863041
611 Ga0068863_101719470
612 Ga0068858_100001325
613 Ga0068858_100858197
614 Ga0068858_101460978
615 Ga0068860_102753574
616 Ga0068862_101075482
617 Ga0075366_10085117
618 Ga0075366_10091273
619 Ga0075366_10114677
620 Ga0075430_100003144
621 Ga0075433_10132484
622 Ga0075433_10329441
623 Ga0075429_100036201
624 Ga0068865_100028776
625 Ga0097620_100350704
626 Ga0075435_100404563
627 Ga0105251_10000072
628 Ga0105251_10169162
629 Ga0105240_10228544
630 Ga0105240_10291700
631 Ga0105240_10294198
632 Ga0105240_10379903
633 Ga0105240_10452869
634 Ga0105240_10525792
635 Ga0105240_10716029
636 Ga0111539_11491180
637 Ga0105245_10767866
638 Ga0105247_10685678
639 Ga0105247_11399954
640 Ga0105243_11070924
641 Ga0105241_10190297
642 Ga0105241_10381961
643 Ga0105242_10212509
644 Ga0105248_10004222
645 Ga0105248_10088493
646 Ga0105237_10225886
647 Ga0105237_10785164
648 Ga0105237_10819512
649 Ga0105237_11671222
650 Ga0105237_11861385
651 Ga0105238_10312821
652 Ga0105238_11988896
653 Ga0105249_10004112
654 Ga0105249_10087483
655 Ga0105239_10332644
656 Ga0105239_10548532
657 Ga0105239_10839957
658 Ga0105239_10849399
659 Ga0105239_12951931
660 Ga0105246_10074505
661 Ga0105246_10394128
662 Ga0157370_11676338
663 Ga0157370_11977317
664 Ga0157369_10305799
665 Ga0157369_10919666
666 Ga0157374_11839256
667 Ga0157374_12844688
668 Ga0163162_10056212
669 Ga0163162_10819635
670 Ga0157375_11355288
671 Ga0157375_12659550
672 Ga0163163_11487293
673 Ga0157380_11347436
674 Ga0182008_10805159
675 Ga0157376_10178088
676 Ga0157376_10378604
677 Ga0182006_1057606
678 Ga0182007_10001285
679 Ga0182007_10192955
680 Ga0182007_10372998
681 Ga0209674_100011
682 Ga0209674_100029
683 Ga0209672_100002
684 Ga0209672_100912
685 Ga0209147_100003
686 Ga0209563_103351
687 Ga0207427_100974
688 Ga0209258_100005
689 Ga0209148_1000006
690 Ga0209759_1000006
691 Ga0209759_1000008
692 Ga0209759_1016289
693 Ga0209233_1000018
694 Ga0209455_1000003
695 Ga0209130_1023670
696 Ga0209564_1016088
697 Ga0207426_1000004
698 Ga0207656_10015702
699 Ga0207713_1000651
700 Ga0207713_1115612
701 Ga0207642_10137025
702 Ga0207647_10002915
703 Ga0207647_10004202
704 Ga0207647_10034998
705 Ga0207647_10214418
706 Ga0207705_10021485
707 Ga0207705_10024412
708 Ga0207705_10659949
709 Ga0207705_10725519
710 Ga0207654_10200922
711 Ga0207654_10301682
712 Ga0207707_10021490
713 Ga0207695_10005921
714 Ga0207695_10009895
715 Ga0207695_10224049
716 Ga0207695_10269743
717 Ga0207695_10287185
718 Ga0207695_10565807
719 Ga0207671_10021603
720 Ga0207671_10027492
721 Ga0207671_10113674
722 Ga0207693_10311651
723 Ga0207662_10025011
724 Ga0207657_10000106
725 Ga0207649_11006960
726 Ga0207652_10019859
727 Ga0207694_10028661
728 Ga0207694_11419376
729 Ga0207650_10035656
730 Ga0207700_10147037
731 Ga0207706_10031716
732 Ga0207704_10002823
733 Ga0207711_10002383
734 Ga0207711_10080810
735 Ga0207689_10011249
736 Ga0207689_10194432
737 Ga0207661_10922709
738 Ga0207667_10006338
739 Ga0207667_10687496
740 Ga0207667_11878199
741 Ga0207651_10140151
742 Ga0207712_10000165
743 Ga0207712_10000771
744 Ga0207658_10000006
745 Ga0207658_10087220
746 Ga0207658_10303185
747 Ga0207658_10400563
748 Ga0207658_11433148
749 Ga0207677_10552296
750 Ga0207677_10851132
751 Ga0207703_10000553
752 Ga0207703_10817604
753 Ga0207703_10847464
754 Ga0207639_10000217
755 Ga0207639_10001889
756 Ga0207678_10001340
757 Ga0207678_10005262
758 Ga0207678_10072326
759 Ga0207678_10396523
760 Ga0207702_10144942
761 Ga0207702_10161369
762 Ga0207702_10880281
763 Ga0207641_10223325
764 Ga0207641_10572797
765 Ga0207648_10083359
766 Ga0207676_10439967
767 Ga0207674_10058202
768 Ga0207674_10418487
769 Ga0207675_100000611
770 Ga0207675_100694023
771 Ga0207683_10420751
772 Ga0207698_10059204
773 Ga0209371_1025176
774 Ga0268266_10000006
775 Ga0268266_10434051
776 Ga0268266_11207760
777 Ga0268265_11547909
778 Ga0307517_10161543
779 Ga0307515_10003504
780 Ga0268256_1003422
781 Ga0307512_10232634
782 Ga0307513_10019384
783 Ga0307513_10161600
784 Ga0307509_10052586
785 Ga0307509_10295109
786 Ga0307509_10380731
787 Ga0307408_100001665
788 Ga0307408_100042961
789 Ga0307508_10000053
790 Ga0307514_10009921
791 Ga0307413_10311712
792 Ga0307413_11052784
793 Ga0307412_10142532
794 Ga0307409_100514450
795 Ga0307409_101775910
796 Ga0307416_100419758
797 Ga0307416_103050290
798 Ga0307411_10179311
799 Ga0307411_11424621
800 Ga0307507_10080213
801 Ga0307507_10551831
802 Ga0373936_0451767
803 Ga0373925_1092202
804 Ga0395900_0084848
805 Ga0395900_0473252
806 Ga0395898_0142771
807 Ga0395898_0187754
808 Ga0395905_0000039
809 Ga0395905_0091309
810 Ga0395905_1209064
811 Ga0395901_0529031
812 Ga0451793_0076916
813 Ga0451793_1177328
814 Ga0451797_0887103
815 Ga0451795_1342154
816 Ga0451800_0194703
817 Ga0451853_2236014
818 Ga0439448_0001060
819 Ga0439464_0094293
820 Ga0450918_010999
821 Ga0466965_0100991
822 Ga0466966_0176120
823 Ga0466970_0464989
824 Ga0466959_0548031
825 Ga0451576_0460724
826 Ga0495592_0006627
827 Ga0495592_0641903
828 Ga0495603_0000247
829 Ga0495603_0100980
830 Ga0495590_0001683
831 Ga0495629_0003745
832 Ga0495629_0077737
833 Ga0495651_0205293
834 Ga0495653_0003596
835 Ga0495653_0044728
836 Ga0495650_0010946
837 Ga0495580_0000077
838 Ga0495580_0132390
839 Ga0495580_0207064
840 Ga0495580_0334655
841 Ga0495582_0001360
842 Ga0495605_0020633
843 Ga0495664_0026303
844 Ga0495664_0109405
845 Ga0495584_0504377
846 Ga0495596_0062364
847 Ga0495607_0552629
848 Ga0495583_0001664
849 Ga0495606_0111729
850 Ga0495606_0162752
851 Ga0495608_0025361
852 Ga0495616_0047661
853 Ga0495616_0185493
854 Ga0495618_0118358
855 Ga0495618_0557035
856 Ga0495620_0161638
857 Ga0495628_0025779
858 Ga0495630_0018183
859 Ga0495630_0020919
860 Ga0495643_0036848
861 Ga0495648_0023684
862 Ga0495666_0009511
863 Ga0495666_0189422
864 Ga0495642_0018018
865 Ga0495642_0440985
866 Ga0495652_0004163
867 Ga0495652_0056818
868 Ga0495665_0000850
869 Ga0495665_0021493
870 Ga0495665_0165036
871 Ga0495640_0008215
872 Ga0495586_0037653
873 Ga0495586_0159395
874 Ga0495621_0394941
875 Ga0495621_0492156
876 Ga0495597_0166484
877 Ga0495645_0023969
878 Ga0495645_0070669
879 Ga0495622_0010468
880 Ga0495667_0111617
881 Ga0495634_0008158
882 Ga0495611_0483737
883 Ga0495625_0253692
884 Ga0495635_0005087
885 Ga0495635_0025331
886 Ga0495657_0001839
887 Ga0495599_0187895
888 Ga0495623_0019217
889 Ga0495623_0320343
890 Ga0495646_0017502
891 Ga0495646_0068778
892 Ga0495646_0217935
893 Ga0495613_0282158
894 Ga0495624_0001568
895 Ga0495624_0103661
896 Ga0495671_0411043
897 Ga0495649_0036378
898 Ga0495649_0039492
899 Ga0495649_0551189
900 Ga0495589_0080983
901 Ga0495589_0109597
902 Ga0495589_0374318
903 Ga0495600_0001799
904 Ga0495600_0289063
905 Ga0495660_0137888
906 Ga0495581_0007999
907 Ga0495581_0158484
908 Ga0495604_0004577
909 Ga0495604_0177382
910 Ga0495674_0031845
911 Ga0495674_0620974
912 Ga0495672_0104709
913 Ga0495672_0351509
914 Ga0495676_0026141
915 Ga0495680_0001352
916 Ga0495680_0149557
917 Ga0495683_0017227
918 Ga0495683_0025842
919 Ga0495683_0033181
920 Ga0495683_0112853
921 Ga0495687_005610
922 Ga0495687_075205
923 Ga0495675_0051168
924 Ga0495677_0029282
925 Ga0495679_072436
926 Ga0495673_0036353
927 Ga0495684_0052694
928 Ga0495686_0012876
929 Ga0495593_0017472
930 Ga0495593_0141927
931 Ga0495602_0000552
932 Ga0495602_0097313
933 Ga0495614_0004082
934 Ga0495614_0472528
935 Ga0495626_0011215
936 Ga0496100_0000132
937 Ga0496101_0000208
938 Ga0496101_0079374
939 Ga0496101_0430351
940 Ga0496101_0615525
941 Ga0496102_0000731
942 Ga0496102_0499983
943 Ga0496102_0517043
944 Ga0496102_1143031
945 Ga0496103_0000654
946 Ga0496103_0428219
947 Ga0496104_0087388
948 Ga0496104_0357713
949 Ga0496104_0469713
950 Ga0496105_0009985
951 Ga0496105_0254649
952 Ga0496106_0000001
953 Ga0496106_0547638
954 Ga0496107_0591482
955 Ga0496112_0006167
956 Ga0496113_0003166
957 Ga0496113_0480200
958 Ga0496113_0483698
959 Ga0496114_0454822
960 Ga0496115_0102301
961 Ga0496116_0028460
962 Ga0496116_0097203
963 Ga0496116_0249762
964 Ga0496116_0438438
965 Ga0496117_0000963
966 Ga0496117_0008631
967 Ga0496117_0033361
968 Ga0496117_0158977
969 Ga0496117_0285966
970 Ga0496118_0000177
971 Ga0496118_0000574
972 Ga0496118_0002675
973 Ga0496118_0006320
974 Ga0496118_0033196
975 Ga0496119_0032112
976 Ga0496119_0163467
977 Ga0496120_0107924
978 Ga0496120_0217042
979 Ga0496121_0000877
980 Ga0496121_0005367
981 Ga0496121_0015162
982 Ga0496121_0084863
983 Ga0496121_0099534
984 Ga0496121_0344296
985 Ga0496122_0000487
986 Ga0496122_0076495
987 Ga0496123_0000296
988 Ga0496123_0186825
989 Ga0496124_0059950
990 Ga0496125_0153037
991 Ga0496126_0000328
992 Ga0496126_0001078
993 Ga0496126_0418476
994 Ga0496126_0642945
995 Ga0496126_1015914
996 Ga0501307_004839
997 Ga0495682_0015971
998 Ga0501031_0063686
999 Ga0501033_0068452
1000 Ga0501036_0010027
1001 Ga0501036_0753042
1002 Ga0501036_0999325
1003 Ga0501037_0038972
1004 Ga0501037_0079010
1005 Ga0501038_0008585
1006 Ga0501038_0505735
1007 Ga0501038_0895159
1008 Ga0501039_0056862
1009 Ga0501039_0313074
1010 Ga0501039_0394949
1011 Ga0501040_0137309
1012 Ga0501040_0700488
1013 Ga0501041_0001524
1014 Ga0501041_0370787
1015 Ga0501042_0052269
1016 Ga0501042_0130011
1017 Ga0501043_0208833
1018 Ga0501043_0308633
1019 Ga0501046_0014995
1020 Ga0501046_0173570
1021 Ga0501047_0100626
1022 Ga0501048_0008735
1023 Ga0501048_0082779
1024 Ga0501068_0029347
1025 Ga0501070_0961166
1026 Ga0501071_0008303
1027 Ga0501072_0001004
1028 Ga0501072_0385876
1029 Ga0501072_0478290
1030 Ga0501073_0046485
1031 Ga0501073_1246344
1032 Ga0501074_0018807
1033 Ga0501074_0477760
1034 Ga0501075_0001432
1035 Ga0501075_0238745
1036 Ga0501076_0000057
1037 Ga0501076_0007592
1038 Ga0501076_0224030
1039 Ga0501077_0005766
1040 Ga0501077_0078424
1041 Ga0501079_0010984
1042 Ga0501079_0019904
1043 Ga0501080_0018539
1044 Ga0501080_0216937
1045 Ga0501081_0000123
1046 Ga0501081_0320150
1047 Ga0501081_0605253
1048 Ga0501035_0181543
1049 Ga0501035_0284643
1050 Ga0501045_0006796
1051 Ga0501045_0015748
1052 nmdc:mga0k408_1067_c1
1053 nmdc:mga0k408_195555_c1
1054 nmdc:mga0k408_203386_c1
1055 nmdc:mga0k408_5106_c1
1056 nmdc:mga08y16_1027460_c1
1057 nmdc:mga08y16_130253_c1
1058 nmdc:mga0n895_257658_c1
1059 Ga0500643_014854
1060 Ga0500641_0198911
1061 Ga0500597_000210
1062 Ga0500621_112137
1063 Ga0500616_0006827
1064 Ga0501084_0012962
1065 Ga0501084_0112076
1066 Ga0587088_083077
1067 Ga0587072_045925
1068 Ga0587102_057244
1069 Ga0501082_0002207
1070 Ga0501082_0058322
1071 Ga0530510_0005396
1072 Ga0530510_0409961
1073 Ga0530510_0437930
1074 2509130587
1075 2513958612
1076 2514047220
1077 2527075901
1078 2563059082
1079 2713480639
1080 2809144523
1081 2819620582
1082 2904486581
1083 2919527912
1084 2921644772
1085 2928108819
1086 2928136043
1087 2928504177
1088 8055304588

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05402

PqqD

Coenzyme PQQ synthesis protein D (PqqD)

39

101

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hkr-assembly1.cif.gz_A crystal structure of histone h3 lysine 79 (h3k79) methyltransferase rv2067c from mycobacterium tuberculosis 0.8891 17 95
6jx3-assembly1.cif.gz_B lasso peptide synthetase b1 complexed with the leader peptide 0.8046 16 96
8hkr-assembly1.cif.gz_B crystal structure of histone h3 lysine 79 (h3k79) methyltransferase rv2067c from mycobacterium tuberculosis 0.7961 17 95
5sxy-assembly1.cif.gz_A the solution nmr structure for the pqqd truncation of methylobacterium extorquens pqqcd representing a functional and stand-alone ribosomally synthesized and post-translational modified (ripp) recognition element (rre) 0.7774 17 96
4xvn-assembly1.cif.gz_A crystal structure of the small terminase from thermophilic phage g20c 0.7758 45 91
ID Description Score Start End Superfamily
af_Q18607_287_334_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8699 20 45 3.20.20.80
af_P9WLL9_303_407_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.837 17 96 1.10.10.10
af_Q9C0G6_1303_1448_1.20.58.1120 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Dynein motor heavy chain, linker domain, subdomain 4 0.8226 23 47 1.20.58.1120
af_K7LL22_91_175_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8178 45 96 1.10.10.10
af_A0A2R8Q9M8_463_862_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.7802 23 47 3.90.70.10
ID Description Score Start End GO Terms
AF-A0A4R8LWW2-F1-model_v4 PqqA binding protein (Coenzyme PQQ synthesis protein D) (Pyrroloquinoline quinone biosynthesis protein D) 0.9942 16 96 GO:0018189
GO:0048038
AF-A0A536WNJ5-F1-model_v4 Pyrroloquinoline quinone biosynthesis peptide chaperone PqqD 0.9907 16 96 GO:0018189
GO:0048038
AF-A0A5C7RT36-F1-model_v4 PqqA binding protein (Coenzyme PQQ synthesis protein D) (Pyrroloquinoline quinone biosynthesis protein D) 0.9891 17 96 GO:0018189
GO:0048038
AF-A0A242N2L4-F1-model_v4 Coenzyme PQQ synthesis protein D 0.989 17 96 GO:0018189
GO:0048038
AF-A0A7X7SNH3-F1-model_v4 PqqA binding protein (Coenzyme PQQ synthesis protein D) (Pyrroloquinoline quinone biosynthesis protein D) 0.9888 14 96 GO:0018189
GO:0048038

Map