F461659

General Info

Members Datasets Scaffolds Average Seq Length
543 266 1086 103

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_1125194|Ga0466967_1125194_385_756
Length 123
Sequence VAARPGERAHELTIPATEEAMTQRSAFVLRVRPDKVDEYVEAHRNVWPEMLDALRRAGIRNYTIYRHGNELFGYFESDDLEAAGAFMAAQDVNTRWQDAMAGLLEERVPDEGPAALEEVFRLD

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
163 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
164 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
169 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
194 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
216 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
220 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
229 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
257 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
263 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
264 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.79
Rhizosphere 88.03
Stem 0
Stem Tuber 0
Unclassified 10.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_1125194 3300045976 Unclassified 782
2 Ga0070683_100067926 3300005329 Bacteria 3320
3 Ga0070690_100890416 3300005330 Unclassified 695
4 Ga0070670_100152852 3300005331 Bacteria 1998
5 Ga0068869_100041542 3300005334 Bacteria 3294
6 Ga0068869_100684771 3300005334 Bacteria 873
7 Ga0070666_10101817 3300005335 Bacteria 1980
8 Ga0070680_100209137 3300005336 Bacteria 1646
9 Ga0070680_101178598 3300005336 Bacteria 662
10 Ga0070682_100033683 3300005337 Bacteria 3114
11 Ga0070682_100502377 3300005337 Bacteria 940
12 Ga0070682_100702883 3300005337 Bacteria 811
13 Ga0068868_100033256 3300005338 Bacteria 3973
14 Ga0068868_101401725 3300005338 Bacteria 652
15 Ga0070660_100305896 3300005339 Bacteria 1304
16 Ga0070660_100523218 3300005339 Bacteria 988
17 Ga0070689_100294018 3300005340 Bacteria 1350
18 Ga0070687_100476550 3300005343 Bacteria 835
19 Ga0070661_100063397 3300005344 Bacteria 2714
20 Ga0070692_10125543 3300005345 Bacteria 1436
21 Ga0070668_100039744 3300005347 Bacteria 3597
22 Ga0070668_100187340 3300005347 Bacteria 1693
23 Ga0070669_100167938 3300005353 Bacteria 1709
24 Ga0070675_100025417 3300005354 Bacteria 4748
25 Ga0070675_100288024 3300005354 Bacteria 1445
26 Ga0070675_100397447 3300005354 Bacteria 1229
27 Ga0070671_100084967 3300005355 Bacteria 2647
28 Ga0070674_100091030 3300005356 Bacteria 2202
29 Ga0070674_100238260 3300005356 Bacteria 1423
30 Ga0070673_100033011 3300005364 Bacteria 3903
31 Ga0070688_100035408 3300005365 Bacteria 3033
32 Ga0070688_100203646 3300005365 Bacteria 1386
33 Ga0070659_100101388 3300005366 Bacteria 2317
34 Ga0070667_100325448 3300005367 Bacteria 1388
35 Ga0070709_10330720 3300005434 Bacteria 1121
36 Ga0070709_10595624 3300005434 Bacteria 850
37 Ga0070714_100511728 3300005435 Bacteria 1146
38 Ga0070713_100481657 3300005436 Bacteria 1169
39 Ga0070710_10283403 3300005437 Bacteria 1076
40 Ga0070701_10007276 3300005438 Bacteria 4713
41 Ga0070711_100150196 3300005439 Bacteria 1756
42 Ga0070711_100476650 3300005439 Bacteria 1025
43 Ga0070705_100008137 3300005440 Bacteria 5186
44 Ga0070700_100036091 3300005441 Bacteria 2996
45 Ga0070700_100195927 3300005441 Bacteria 1416
46 Ga0070694_100426696 3300005444 Bacteria 1042
47 Ga0070708_100186945 3300005445 Bacteria 1937
48 Ga0070708_101922112 3300005445 Bacteria 548
49 Ga0070663_100803367 3300005455 Bacteria 807
50 Ga0070678_100020281 3300005456 Bacteria 4357
51 Ga0070678_100079385 3300005456 Bacteria 2482
52 Ga0070678_100403692 3300005456 Bacteria 1188
53 Ga0070662_100024449 3300005457 Bacteria 4161
54 Ga0070681_10051754 3300005458 Bacteria 4096
55 Ga0070681_10068265 3300005458 Bacteria 3522
56 Ga0070681_11304714 3300005458 Unclassified 649
57 Ga0068867_100052695 3300005459 Bacteria 3003
58 Ga0070685_10117884 3300005466 Bacteria 1645
59 Ga0070685_11394671 3300005466 Unclassified 537
60 Ga0070706_100017050 3300005467 Bacteria 6709
61 Ga0070706_100854435 3300005467 Bacteria 841
62 Ga0070706_101428567 3300005467 Bacteria 633
63 Ga0070707_100001665 3300005468 Bacteria 21503
64 Ga0070707_100794973 3300005468 Bacteria 910
65 Ga0070698_100009772 3300005471 Bacteria 10256
66 Ga0070698_100084819 3300005471 Bacteria 3156
67 Ga0070698_100214818 3300005471 Bacteria 1857
68 Ga0070698_100353990 3300005471 Bacteria 1400
69 Ga0070699_100506864 3300005518 Bacteria 1096
70 Ga0070699_101505668 3300005518 Bacteria 617
71 Ga0070679_100044921 3300005530 Bacteria 4402
72 Ga0070679_100136687 3300005530 Bacteria 2432
73 Ga0070684_100033485 3300005535 Bacteria 4387
74 Ga0070684_102203319 3300005535 Bacteria 520
75 Ga0070697_100912447 3300005536 Bacteria 779
76 Ga0070697_100940001 3300005536 Bacteria 767
77 Ga0070697_101059497 3300005536 Bacteria 721
78 Ga0070697_101367274 3300005536 Bacteria 632
79 Ga0068853_100060168 3300005539 Bacteria 3281
80 Ga0068853_102188067 3300005539 Bacteria 536
81 Ga0070672_100221319 3300005543 Bacteria 1588
82 Ga0070672_101162089 3300005543 Bacteria 687
83 Ga0070695_100978893 3300005545 Unclassified 687
84 Ga0070696_100015794 3300005546 Bacteria 5075
85 Ga0070696_100344761 3300005546 Bacteria 1152
86 Ga0070693_100077625 3300005547 Bacteria 1971
87 Ga0070693_100812170 3300005547 Bacteria 694
88 Ga0070665_100083154 3300005548 Bacteria 3206
89 Ga0070665_101903367 3300005548 Bacteria 601
90 Ga0070704_100671392 3300005549 Bacteria 916
91 Ga0070704_101734777 3300005549 Unclassified 577
92 Ga0068855_100613497 3300005563 Bacteria 1172
93 Ga0070664_100590398 3300005564 Bacteria 1030
94 Ga0070664_100612540 3300005564 Bacteria 1010
95 Ga0068854_100263820 3300005578 Bacteria 1380
96 Ga0068854_101815893 3300005578 Bacteria 559
97 Ga0068856_100481101 3300005614 Bacteria 1263
98 Ga0070702_100049683 3300005615 Bacteria 2393
99 Ga0070702_100709083 3300005615 Bacteria 768
100 Ga0068852_100117944 3300005616 Bacteria 2424
101 Ga0068859_100105276 3300005617 Bacteria 2880
102 Ga0068859_101193473 3300005617 Bacteria 838
103 Ga0068864_100159242 3300005618 Bacteria 2051
104 Ga0068861_100040840 3300005719 Bacteria 3472
105 Ga0068851_10203063 3300005834 Bacteria 1107
106 Ga0068851_10235870 3300005834 Bacteria 1033
107 Ga0068870_10007682 3300005840 Bacteria 4822
108 Ga0068870_10332654 3300005840 Bacteria 969
109 Ga0068863_100342471 3300005841 Bacteria 1454
110 Ga0068863_101016924 3300005841 Bacteria 832
111 Ga0068858_100060089 3300005842 Bacteria 3513
112 Ga0068860_100400677 3300005843 Bacteria 1357
113 Ga0068862_100157903 3300005844 Bacteria 2023
114 Ga0081455_10027937 3300005937 Bacteria 5161
115 Ga0081455_10072462 3300005937 Bacteria 2851
116 Ga0081539_10000181 3300005985 Bacteria 148250
117 Ga0070717_10184922 3300006028 Bacteria 1818
118 Ga0070717_10830554 3300006028 Bacteria 841
119 Ga0070717_11071904 3300006028 Bacteria 734
120 Ga0070716_100185497 3300006173 Bacteria 1370
121 Ga0070716_100649089 3300006173 Unclassified 800
122 Ga0070716_100754182 3300006173 Bacteria 749
123 Ga0070712_100013778 3300006175 Bacteria 5172
124 Ga0097621_101018203 3300006237 Bacteria 775
125 Ga0097621_101232407 3300006237 Bacteria 705
126 Ga0097621_102280711 3300006237 Unclassified 518
127 Ga0068871_100025601 3300006358 Bacteria 4593
128 Ga0075434_100268958 3300006871 Bacteria 1724
129 Ga0068865_100002396 3300006881 Bacteria 11059
130 Ga0068865_100009070 3300006881 Bacteria 6154
131 Ga0068865_100155548 3300006881 Bacteria 1739
132 Ga0075436_100815875 3300006914 Unclassified 695
133 Ga0097620_100105275 3300006931 Bacteria 2880
134 Ga0097620_101193757 3300006931 Bacteria 838
135 Ga0075435_100588306 3300007076 Unclassified 965
136 Ga0111539_10065124 3300009094 Bacteria 4308
137 Ga0111539_10264203 3300009094 Bacteria 2003
138 Ga0105245_10037915 3300009098 Bacteria 4286
139 Ga0105245_10096517 3300009098 Bacteria 2728
140 Ga0105245_10405725 3300009098 Bacteria 1363
141 Ga0105245_10674193 3300009098 Bacteria 1065
142 Ga0114129_10467488 3300009147 Bacteria 1652
143 Ga0114129_11220632 3300009147 Unclassified 936
144 Ga0105243_10012009 3300009148 Bacteria 6547
145 Ga0105243_10110418 3300009148 Bacteria 2299
146 Ga0105243_10573314 3300009148 Bacteria 1082
147 Ga0105241_10274650 3300009174 Bacteria 1437
148 Ga0105241_10502147 3300009174 Bacteria 1082
149 Ga0105242_10132662 3300009176 Bacteria 2152
150 Ga0105242_10741307 3300009176 Bacteria 966
151 Ga0105242_11084808 3300009176 Bacteria 814
152 Ga0105242_11803581 3300009176 Bacteria 650
153 Ga0105248_10066630 3300009177 Bacteria 4042
154 Ga0105237_12088797 3300009545 Bacteria 576
155 Ga0105238_10069385 3300009551 Bacteria 3525
156 Ga0105238_10971158 3300009551 Bacteria 870
157 Ga0105249_10053861 3300009553 Bacteria 3678
158 Ga0105249_10252276 3300009553 Bacteria 1750
159 Ga0105249_10703779 3300009553 Unclassified 1070
160 Ga0105249_11063517 3300009553 Bacteria 879
161 Ga0105239_10018276 3300010375 Bacteria 7751
162 Ga0105239_10572206 3300010375 Bacteria 1287
163 Ga0105246_11538896 3300011119 Bacteria 626
164 Ga0105246_11556899 3300011119 Unclassified 623
165 Ga0157320_1000978 3300012481 Bacteria 1332
166 Ga0157374_10573480 3300013296 Bacteria 1137
167 Ga0157378_10043433 3300013297 Bacteria 3991
168 Ga0157378_12689620 3300013297 Bacteria 550
169 Ga0163162_10052683 3300013306 Bacteria 4088
170 Ga0163162_10053229 3300013306 Bacteria 4068
171 Ga0163162_11696189 3300013306 Unclassified 721
172 Ga0163162_11837105 3300013306 Bacteria 693
173 Ga0157372_10057323 3300013307 Bacteria 4354
174 Ga0157372_10334126 3300013307 Bacteria 1765
175 Ga0157375_10298029 3300013308 Bacteria 1776
176 Ga0157375_10818252 3300013308 Bacteria 1079
177 Ga0163163_10327119 3300014325 Bacteria 1587
178 Ga0157380_10006752 3300014326 Bacteria 8110
179 Ga0157380_10303591 3300014326 Bacteria 1472
180 Ga0182008_10018457 3300014497 Bacteria 3612
181 Ga0182008_10299868 3300014497 Bacteria 841
182 Ga0157377_10004021 3300014745 Bacteria 6707
183 Ga0157377_10780647 3300014745 Unclassified 702
184 Ga0157379_10009744 3300014968 Bacteria 8371
185 Ga0157376_10007690 3300014969 Bacteria 7720
186 Ga0157376_10847382 3300014969 Bacteria 929
187 Ga0157376_11330270 3300014969 Bacteria 749
188 Ga0163161_10066206 3300017792 Bacteria 2638
189 Ga0163161_10313260 3300017792 Bacteria 1239
190 Ga0207656_10191766 3300025321 Bacteria 984
191 Ga0207682_10378280 3300025893 Unclassified 668
192 Ga0207642_11008709 3300025899 Unclassified 536
193 Ga0207688_10018669 3300025901 Bacteria 3771
194 Ga0207688_10160471 3300025901 Bacteria 1333
195 Ga0207680_11371393 3300025903 Unclassified 502
196 Ga0207647_10208834 3300025904 Bacteria 1128
197 Ga0207699_11293867 3300025906 Bacteria 540
198 Ga0207643_10001236 3300025908 Bacteria 15090
199 Ga0207705_10579724 3300025909 Bacteria 872
200 Ga0207684_10011898 3300025910 Bacteria 7586
201 Ga0207684_11146499 3300025910 Bacteria 646
202 Ga0207654_11124306 3300025911 Bacteria 572
203 Ga0207654_11141874 3300025911 Unclassified 568
204 Ga0207654_11197241 3300025911 Bacteria 554
205 Ga0207707_10027506 3300025912 Bacteria 4973
206 Ga0207707_10568147 3300025912 Bacteria 962
207 Ga0207693_10006171 3300025915 Bacteria 9940
208 Ga0207693_10106499 3300025915 Bacteria 2199
209 Ga0207693_10130889 3300025915 Bacteria 1972
210 Ga0207663_10053597 3300025916 Bacteria 2521
211 Ga0207663_10253230 3300025916 Bacteria 1297
212 Ga0207663_10255389 3300025916 Bacteria 1292
213 Ga0207663_10279445 3300025916 Unclassified 1240
214 Ga0207660_10176851 3300025917 Bacteria 1655
215 Ga0207660_10770676 3300025917 Bacteria 785
216 Ga0207662_10113768 3300025918 Bacteria 1690
217 Ga0207662_11075168 3300025918 Bacteria 572
218 Ga0207657_10055677 3300025919 Bacteria 3415
219 Ga0207657_10149494 3300025919 Bacteria 1903
220 Ga0207652_10366492 3300025921 Bacteria 1300
221 Ga0207646_10012253 3300025922 Bacteria 8248
222 Ga0207646_10765056 3300025922 Bacteria 861
223 Ga0207681_10373127 3300025923 Bacteria 1147
224 Ga0207681_10447298 3300025923 Bacteria 1051
225 Ga0207681_10609426 3300025923 Bacteria 903
226 Ga0207694_10122556 3300025924 Bacteria 2077
227 Ga0207694_10764801 3300025924 Unclassified 815
228 Ga0207659_10192511 3300025926 Bacteria 1624
229 Ga0207659_10563081 3300025926 Bacteria 969
230 Ga0207687_10165928 3300025927 Bacteria 1699
231 Ga0207687_10811082 3300025927 Bacteria 798
232 Ga0207700_10475549 3300025928 Bacteria 1104
233 Ga0207700_10671087 3300025928 Bacteria 924
234 Ga0207700_10897241 3300025928 Bacteria 793
235 Ga0207664_10350895 3300025929 Bacteria 1306
236 Ga0207664_10577503 3300025929 Bacteria 1009
237 Ga0207644_10282629 3300025931 Bacteria 1333
238 Ga0207644_10654532 3300025931 Bacteria 875
239 Ga0207644_11012736 3300025931 Bacteria 697
240 Ga0207644_11592928 3300025931 Unclassified 548
241 Ga0207690_11126897 3300025932 Bacteria 654
242 Ga0207706_10053017 3300025933 Bacteria 3581
243 Ga0207706_10113451 3300025933 Bacteria 2384
244 Ga0207686_10210166 3300025934 Bacteria 1398
245 Ga0207686_10763223 3300025934 Bacteria 773
246 Ga0207709_10018083 3300025935 Bacteria 3943
247 Ga0207709_10141833 3300025935 Bacteria 1653
248 Ga0207709_11043197 3300025935 Bacteria 670
249 Ga0207709_11174752 3300025935 Bacteria 632
250 Ga0207669_10079573 3300025937 Bacteria 2093
251 Ga0207669_11731883 3300025937 Unclassified 534
252 Ga0207704_10040600 3300025938 Bacteria 2721
253 Ga0207704_10278874 3300025938 Bacteria 1269
254 Ga0207665_10102141 3300025939 Bacteria 2003
255 Ga0207665_10927182 3300025939 Bacteria 691
256 Ga0207691_10013449 3300025940 Bacteria 7832
257 Ga0207691_10014290 3300025940 Bacteria 7572
258 Ga0207711_10115743 3300025941 Unclassified 2389
259 Ga0207689_10113884 3300025942 Bacteria 2223
260 Ga0207661_10514474 3300025944 Bacteria 1094
261 Ga0207679_10561628 3300025945 Bacteria 1025
262 Ga0207679_11456430 3300025945 Unclassified 628
263 Ga0207712_10403005 3300025961 Bacteria 1150
264 Ga0207668_10118438 3300025972 Bacteria 2001
265 Ga0207668_10442984 3300025972 Bacteria 1107
266 Ga0207668_10580930 3300025972 Bacteria 974
267 Ga0207668_11162329 3300025972 Unclassified 693
268 Ga0207640_10192152 3300025981 Bacteria 1539
269 Ga0207658_11429536 3300025986 Bacteria 633
270 Ga0207677_10022058 3300026023 Bacteria 3905
271 Ga0207677_10239923 3300026023 Bacteria 1466
272 Ga0207703_10071058 3300026035 Bacteria 2874
273 Ga0207639_10963468 3300026041 Bacteria 798
274 Ga0207678_10099804 3300026067 Bacteria 2480
275 Ga0207678_10203047 3300026067 Bacteria 1695
276 Ga0207708_10052313 3300026075 Bacteria 3111
277 Ga0207708_10056220 3300026075 Bacteria 3002
278 Ga0207702_10464537 3300026078 Bacteria 1230
279 Ga0207702_11486349 3300026078 Bacteria 671
280 Ga0207641_10385760 3300026088 Bacteria 1343
281 Ga0207648_10522622 3300026089 Bacteria 1088
282 Ga0207675_100001890 3300026118 Bacteria 20932
283 Ga0207675_101567231 3300026118 Unclassified 679
284 Ga0207683_10124106 3300026121 Bacteria 2320
285 Ga0207683_10124798 3300026121 Bacteria 2313
286 Ga0207428_10171116 3300027907 Bacteria 1645
287 Ga0268266_10119850 3300028379 Bacteria 2341
288 Ga0268266_10134706 3300028379 Bacteria 2212
289 Ga0268265_10231030 3300028380 Bacteria 1626
290 Ga0268265_11319277 3300028380 Bacteria 722
291 Ga0268265_11852402 3300028380 Bacteria 610
292 Ga0268264_10362833 3300028381 Bacteria 1382
293 Ga0265320_10139799 3300031240 Bacteria 1097
294 Ga0373940_0156667 3300035088 Bacteria 729
295 Ga0373923_0643465 3300035111 Bacteria 524
296 Ga0373953_0044961 3300035117 Bacteria 1768
297 Ga0373943_0068203 3300035170 Bacteria 1795
298 Ga0373943_0508004 3300035170 Unclassified 705
299 Ga0373946_0109649 3300035171 Bacteria 1248
300 Ga0373962_0006685 3300035242 Bacteria 2798
301 Ga0373924_0053736 3300035410 Bacteria 1674
302 Ga0373931_0036029 3300035691 Bacteria 2577
303 Ga0373927_0406815 3300035695 Bacteria 898
304 Ga0373933_0083316 3300035724 Bacteria 1964
305 Ga0373947_0035324 3300035725 Bacteria 2959
306 Ga0373937_0171558 3300036401 Bacteria 2035
307 Ga0373925_1716672 3300037068 Unclassified 513
308 Ga0395899_0125006 3300037312 Bacteria 1840
309 Ga0395899_0235271 3300037312 Bacteria 1263
310 Ga0395900_0146926 3300037418 Bacteria 2410
311 Ga0395900_0224219 3300037418 Bacteria 1893
312 Ga0395900_0272942 3300037418 Bacteria 1685
313 Ga0395900_0386562 3300037418 Bacteria 1366
314 Ga0395898_0019069 3300037466 Bacteria 6983
315 Ga0395898_0293765 3300037466 Bacteria 1550
316 Ga0395898_0493957 3300037466 Bacteria 1164
317 Ga0395898_0602923 3300037466 Bacteria 1041
318 Ga0395898_0641384 3300037466 Bacteria 1004
319 Ga0395898_0748614 3300037466 Bacteria 918
320 Ga0395898_1052920 3300037466 Bacteria 748
321 Ga0395898_1595827 3300037466 Bacteria 577
322 Ga0395905_0011284 3300037471 Bacteria 8636
323 Ga0395905_0434059 3300037471 Bacteria 1210
324 Ga0395905_0465039 3300037471 Bacteria 1163
325 Ga0395905_1604892 3300037471 Bacteria 555
326 Ga0395901_0232921 3300038443 Bacteria 1922
327 Ga0395901_0284013 3300038443 Bacteria 1719
328 Ga0395901_0300154 3300038443 Bacteria 1665
329 Ga0395901_0478545 3300038443 Bacteria 1270
330 Ga0395901_0867627 3300038443 Bacteria 886
331 Ga0395901_1004469 3300038443 Bacteria 810
332 Ga0395901_1443757 3300038443 Unclassified 645
333 Ga0436365_1551408 3300039437 Bacteria 1565
334 Ga0466965_0502871 3300044683 Bacteria 680
335 Ga0466966_0425637 3300044684 Bacteria 798
336 Ga0466961_0211009 3300044693 Bacteria 1199
337 Ga0466961_0452774 3300044693 Bacteria 777
338 Ga0466963_0001434 3300044694 Bacteria 12838
339 Ga0466963_0004803 3300044694 Bacteria 7880
340 Ga0466963_0009131 3300044694 Bacteria 5962
341 Ga0466963_0417035 3300044694 Bacteria 947
342 Ga0466963_0568580 3300044694 Bacteria 801
343 Ga0466964_0020462 3300044706 Bacteria 2549
344 Ga0466964_0317249 3300044706 Bacteria 791
345 Ga0466971_0115425 3300044719 Bacteria 1241
346 Ga0466968_0010569 3300044735 Bacteria 3582
347 Ga0466968_0119088 3300044735 Bacteria 1193
348 Ga0466957_0058159 3300044842 Bacteria 2368
349 Ga0466960_0664575 3300044901 Bacteria 623
350 Ga0466959_0020702 3300045049 Bacteria 4847
351 Ga0466959_0202382 3300045049 Bacteria 1382
352 Ga0451576_1777161 3300045051 Bacteria 638
353 Ga0466958_0001543 3300045836 Bacteria 11034
354 Ga0466958_0072457 3300045836 Bacteria 2110
355 Ga0466958_0105598 3300045836 Bacteria 1755
356 Ga0466958_0143555 3300045836 Bacteria 1504
357 Ga0466958_0276809 3300045836 Bacteria 1075
358 Ga0466967_0002088 3300045976 Bacteria 12233
359 Ga0466967_0037546 3300045976 Bacteria 4147
360 Ga0466967_0211638 3300045976 Bacteria 1839
361 Ga0466967_0215504 3300045976 Bacteria 1822
362 Ga0466967_0309133 3300045976 Bacteria 1522
363 Ga0466967_0373592 3300045976 Bacteria 1383
364 Ga0466967_0685843 3300045976 Bacteria 1014
365 Ga0466967_1286983 3300045976 Bacteria 728
366 Ga0466967_1732834 3300045976 Unclassified 622
367 Ga0466967_1807086 3300045976 Unclassified 608
368 Ga0466967_1808455 3300045976 Bacteria 608
369 Ga0495592_0028783 3300046454 Bacteria 4205
370 Ga0495592_0140405 3300046454 Bacteria 1681
371 Ga0495592_0295186 3300046454 Unclassified 1055
372 Ga0495603_0083624 3300046455 Bacteria 1869
373 Ga0495629_0179501 3300046459 Bacteria 1468
374 Ga0495629_1074487 3300046459 Unclassified 521
375 Ga0495641_0043834 3300046461 Unclassified 2067
376 Ga0495651_0016309 3300046462 Bacteria 5752
377 Ga0495651_0019505 3300046462 Bacteria 5258
378 Ga0495653_0003414 3300046463 Bacteria 12774
379 Ga0495653_0025979 3300046463 Bacteria 4699
380 Ga0495653_0186610 3300046463 Unclassified 1418
381 Ga0495653_0257841 3300046463 Bacteria 1154
382 Ga0495582_0343931 3300046473 Unclassified 859
383 Ga0495639_0564257 3300046475 Unclassified 584
384 Ga0495664_0112474 3300046477 Bacteria 1644
385 Ga0495664_0184466 3300046477 Bacteria 1265
386 Ga0495664_0485452 3300046477 Unclassified 738
387 Ga0495664_0663222 3300046477 Unclassified 618
388 Ga0495594_0602322 3300046499 Bacteria 623
389 Ga0495596_0054048 3300046500 Bacteria 1571
390 Ga0495608_0006946 3300046511 Bacteria 8017
391 Ga0495608_0013918 3300046511 Bacteria 5582
392 Ga0495608_0394354 3300046511 Bacteria 847
393 Ga0495618_0084816 3300046514 Bacteria 2024
394 Ga0495628_0029772 3300046516 Bacteria 4425
395 Ga0495628_0247549 3300046516 Bacteria 1332
396 Ga0495628_0253503 3300046516 Bacteria 1313
397 Ga0495630_0001521 3300046517 Bacteria 16061
398 Ga0495630_0242428 3300046517 Bacteria 1377
399 Ga0495630_0290560 3300046517 Unclassified 1249
400 Ga0495630_0330549 3300046517 Bacteria 1166
401 Ga0495630_0564115 3300046517 Bacteria 873
402 Ga0495644_0252688 3300046523 Unclassified 685
403 Ga0495652_0058657 3300046529 Bacteria 3258
404 Ga0495652_0208304 3300046529 Bacteria 1478
405 Ga0495652_0645166 3300046529 Bacteria 718
406 Ga0495640_0369563 3300046533 Unclassified 883
407 Ga0495640_0712173 3300046533 Bacteria 602
408 Ga0495586_0722448 3300046535 Unclassified 575
409 Ga0495587_0011452 3300046536 Bacteria 5618
410 Ga0495645_0183454 3300046543 Bacteria 1432
411 Ga0495667_0033364 3300046559 Bacteria 3446
412 Ga0495667_0035222 3300046559 Bacteria 3346
413 Ga0495667_0102803 3300046559 Bacteria 1848
414 Ga0495667_0149779 3300046559 Bacteria 1502
415 Ga0495667_0709325 3300046559 Bacteria 623
416 Ga0495656_0684788 3300046615 Unclassified 551
417 Ga0495634_0076008 3300046642 Bacteria 2205
418 Ga0495634_0132041 3300046642 Unclassified 1591
419 Ga0495635_0015872 3300046663 Bacteria 5262
420 Ga0495659_0568281 3300046664 Bacteria 501
421 Ga0495588_0102691 3300046674 Bacteria 1503
422 Ga0495657_0039870 3300046675 Bacteria 3225
423 Ga0495657_0365485 3300046675 Bacteria 852
424 Ga0495657_0633932 3300046675 Unclassified 617
425 Ga0495599_0026591 3300046678 Bacteria 3627
426 Ga0495623_0011753 3300046679 Bacteria 5672
427 Ga0495646_0128620 3300046680 Bacteria 1428
428 Ga0495647_0288135 3300046681 Unclassified 738
429 Ga0495658_0236424 3300046683 Unclassified 1147
430 Ga0495613_0011449 3300046689 Bacteria 6595
431 Ga0495613_0268263 3300046689 Bacteria 1188
432 Ga0495624_0098980 3300046690 Unclassified 1796
433 Ga0495624_0679514 3300046690 Unclassified 612
434 Ga0495624_0794129 3300046690 Bacteria 560
435 Ga0495670_0397036 3300046691 Bacteria 745
436 Ga0495600_0118077 3300046809 Bacteria 1726
437 Ga0495600_0154923 3300046809 Bacteria 1482
438 Ga0495600_0156982 3300046809 Bacteria 1471
439 Ga0495581_0718207 3300047315 Bacteria 576
440 Ga0495604_0018798 3300047317 Bacteria 5533
441 Ga0495604_0038048 3300047317 Unclassified 3786
442 Ga0495674_0000568 3300047319 Bacteria 34477
443 Ga0495674_0050622 3300047319 Bacteria 3665
444 Ga0495674_0245675 3300047319 Bacteria 1474
445 Ga0495674_0617603 3300047319 Bacteria 857
446 Ga0495674_1008100 3300047319 Unclassified 638
447 Ga0495676_0220037 3300047321 Unclassified 1309
448 Ga0495676_0271209 3300047321 Bacteria 1151
449 Ga0495676_0332176 3300047321 Bacteria 1019
450 Ga0495680_0000393 3300047322 Bacteria 48867
451 Ga0495680_0027665 3300047322 Bacteria 4654
452 Ga0495680_0042000 3300047322 Bacteria 3632
453 Ga0495675_0003965 3300047444 Bacteria 8975
454 Ga0495684_0020961 3300047471 Bacteria 5034
455 Ga0495684_0108331 3300047471 Bacteria 2098
456 Ga0495684_0146060 3300047471 Bacteria 1771
457 Ga0495602_0228521 3300048088 Bacteria 1399
458 Ga0495602_0382373 3300048088 Unclassified 1008
459 Ga0495614_0116126 3300048089 Bacteria 1178
460 Ga0496100_0000844 3300048903 Bacteria 14695
461 Ga0496100_0118631 3300048903 Bacteria 1848
462 Ga0496100_0625501 3300048903 Bacteria 837
463 Ga0496101_0063535 3300048904 Bacteria 2687
464 Ga0496101_0132720 3300048904 Bacteria 1892
465 Ga0496101_0154013 3300048904 Bacteria 1759
466 Ga0496101_0274826 3300048904 Bacteria 1316
467 Ga0496102_0002396 3300048905 Bacteria 16004
468 Ga0496102_0256026 3300048905 Bacteria 1650
469 Ga0496102_0354491 3300048905 Bacteria 1381
470 Ga0496102_0836338 3300048905 Bacteria 843
471 Ga0496102_1958682 3300048905 Bacteria 502
472 Ga0496103_0029795 3300048906 Bacteria 3318
473 Ga0496103_0075506 3300048906 Bacteria 2114
474 Ga0496103_0166823 3300048906 Bacteria 1413
475 Ga0496104_0012636 3300048907 Bacteria 7601
476 Ga0496104_0248359 3300048907 Bacteria 1692
477 Ga0496104_0283662 3300048907 Bacteria 1569
478 Ga0496104_0621152 3300048907 Unclassified 990
479 Ga0496104_0682814 3300048907 Bacteria 935
480 Ga0496105_0017306 3300048908 Bacteria 5776
481 Ga0496105_0103216 3300048908 Bacteria 2354
482 Ga0496105_0231093 3300048908 Bacteria 1503
483 Ga0496105_0349655 3300048908 Bacteria 1181
484 Ga0496105_0708367 3300048908 Bacteria 772
485 Ga0496105_1292637 3300048908 Bacteria 533
486 Ga0496106_0009460 3300048909 Bacteria 7205
487 Ga0496106_0020610 3300048909 Bacteria 4895
488 Ga0496106_0040557 3300048909 Bacteria 3487
489 Ga0496106_0203737 3300048909 Bacteria 1575
490 Ga0496107_0002519 3300048910 Bacteria 11919
491 Ga0496107_0026487 3300048910 Bacteria 4111
492 Ga0496107_0071656 3300048910 Bacteria 2518
493 Ga0496107_0148348 3300048910 Bacteria 1734
494 Ga0496108_0003357 3300048911 Bacteria 12857
495 Ga0496108_0036417 3300048911 Bacteria 4094
496 Ga0496108_0040525 3300048911 Bacteria 3883
497 Ga0496108_0136684 3300048911 Bacteria 2109
498 Ga0496108_0342824 3300048911 Bacteria 1304
499 Ga0496109_0001036 3300048912 Bacteria 22996
500 Ga0496109_0025212 3300048912 Bacteria 5296
501 Ga0496109_0224428 3300048912 Bacteria 1767
502 Ga0496110_0013144 3300048913 Bacteria 6835
503 Ga0496110_0015597 3300048913 Bacteria 6327
504 Ga0496110_0021509 3300048913 Bacteria 5463
505 Ga0496110_1173007 3300048913 Bacteria 677
506 Ga0496111_0007052 3300048914 Bacteria 7341
507 Ga0496111_0008438 3300048914 Bacteria 6822
508 Ga0496111_0060331 3300048914 Bacteria 2749
509 Ga0496112_0046421 3300048915 Bacteria 4260
510 Ga0496112_0148270 3300048915 Bacteria 2314
511 Ga0496113_0195667 3300048916 Bacteria 1606
512 Ga0496113_0621928 3300048916 Bacteria 864
513 Ga0496113_0960990 3300048916 Unclassified 674
514 Ga0496114_0000945 3300048917 Bacteria 21726
515 Ga0496114_0091517 3300048917 Bacteria 2583
516 Ga0496114_0116517 3300048917 Bacteria 2294
517 Ga0496114_0146523 3300048917 Bacteria 2047
518 Ga0496114_0417786 3300048917 Bacteria 1188
519 Ga0496114_0494800 3300048917 Bacteria 1082
520 Ga0496115_0001623 3300048918 Bacteria 16184
521 Ga0496115_0006166 3300048918 Bacteria 8769
522 Ga0496115_0234958 3300048918 Bacteria 1511
523 Ga0496115_0646801 3300048918 Bacteria 836
524 Ga0501067_0024721 3300049583 Bacteria 3331
525 Ga0501069_0075064 3300049585 Bacteria 1898
526 Ga0501069_0115490 3300049585 Bacteria 1531
527 nmdc:mga08y16_125742_c1 3300050511 Bacteria 2667
528 nmdc:mga08y16_662675_c1 3300050511 Bacteria 1047
529 nmdc:mga0n895_1081576_c1 3300050512 Bacteria 780
530 nmdc:mga0n895_228840_c1 3300050512 Bacteria 1887
531 nmdc:mga0n895_295097_c1 3300050512 Bacteria 1643
532 nmdc:mga0rr50_1068104_c1 3300050513 Bacteria 687
533 nmdc:mga0a205_720422_c1 3300050515 Bacteria 847
534 Ga0495601_0055203 3300053077 Bacteria 2514
535 Ga0495601_0057137 3300053077 Bacteria 2472
536 Ga0495601_0352727 3300053077 Unclassified 956
537 Ga0495601_0622426 3300053077 Unclassified 692
538 Ga0495612_0045100 3300053078 Bacteria 1805
539 Ga0495595_0587001 3300053084 Bacteria 569
540 Ga0495619_0175901 3300053085 Bacteria 1480
541 Ga0495619_0314449 3300053085 Bacteria 1084
542 Ga0466962_0148709 3300061719 Bacteria 1136
543 Ga0466962_0237536 3300061719 Bacteria 894
544 Ga0466967_1125194
545 Ga0070683_100067926
546 Ga0070690_100890416
547 Ga0070670_100152852
548 Ga0068869_100041542
549 Ga0068869_100684771
550 Ga0070666_10101817
551 Ga0070680_100209137
552 Ga0070680_101178598
553 Ga0070682_100033683
554 Ga0070682_100502377
555 Ga0070682_100702883
556 Ga0068868_100033256
557 Ga0068868_101401725
558 Ga0070660_100305896
559 Ga0070660_100523218
560 Ga0070689_100294018
561 Ga0070687_100476550
562 Ga0070661_100063397
563 Ga0070692_10125543
564 Ga0070668_100039744
565 Ga0070668_100187340
566 Ga0070669_100167938
567 Ga0070675_100025417
568 Ga0070675_100288024
569 Ga0070675_100397447
570 Ga0070671_100084967
571 Ga0070674_100091030
572 Ga0070674_100238260
573 Ga0070673_100033011
574 Ga0070688_100035408
575 Ga0070688_100203646
576 Ga0070659_100101388
577 Ga0070667_100325448
578 Ga0070709_10330720
579 Ga0070709_10595624
580 Ga0070714_100511728
581 Ga0070713_100481657
582 Ga0070710_10283403
583 Ga0070701_10007276
584 Ga0070711_100150196
585 Ga0070711_100476650
586 Ga0070705_100008137
587 Ga0070700_100036091
588 Ga0070700_100195927
589 Ga0070694_100426696
590 Ga0070708_100186945
591 Ga0070708_101922112
592 Ga0070663_100803367
593 Ga0070678_100020281
594 Ga0070678_100079385
595 Ga0070678_100403692
596 Ga0070662_100024449
597 Ga0070681_10051754
598 Ga0070681_10068265
599 Ga0070681_11304714
600 Ga0068867_100052695
601 Ga0070685_10117884
602 Ga0070685_11394671
603 Ga0070706_100017050
604 Ga0070706_100854435
605 Ga0070706_101428567
606 Ga0070707_100001665
607 Ga0070707_100794973
608 Ga0070698_100009772
609 Ga0070698_100084819
610 Ga0070698_100214818
611 Ga0070698_100353990
612 Ga0070699_100506864
613 Ga0070699_101505668
614 Ga0070679_100044921
615 Ga0070679_100136687
616 Ga0070684_100033485
617 Ga0070684_102203319
618 Ga0070697_100912447
619 Ga0070697_100940001
620 Ga0070697_101059497
621 Ga0070697_101367274
622 Ga0068853_100060168
623 Ga0068853_102188067
624 Ga0070672_100221319
625 Ga0070672_101162089
626 Ga0070695_100978893
627 Ga0070696_100015794
628 Ga0070696_100344761
629 Ga0070693_100077625
630 Ga0070693_100812170
631 Ga0070665_100083154
632 Ga0070665_101903367
633 Ga0070704_100671392
634 Ga0070704_101734777
635 Ga0068855_100613497
636 Ga0070664_100590398
637 Ga0070664_100612540
638 Ga0068854_100263820
639 Ga0068854_101815893
640 Ga0068856_100481101
641 Ga0070702_100049683
642 Ga0070702_100709083
643 Ga0068852_100117944
644 Ga0068859_100105276
645 Ga0068859_101193473
646 Ga0068864_100159242
647 Ga0068861_100040840
648 Ga0068851_10203063
649 Ga0068851_10235870
650 Ga0068870_10007682
651 Ga0068870_10332654
652 Ga0068863_100342471
653 Ga0068863_101016924
654 Ga0068858_100060089
655 Ga0068860_100400677
656 Ga0068862_100157903
657 Ga0081455_10027937
658 Ga0081455_10072462
659 Ga0081539_10000181
660 Ga0070717_10184922
661 Ga0070717_10830554
662 Ga0070717_11071904
663 Ga0070716_100185497
664 Ga0070716_100649089
665 Ga0070716_100754182
666 Ga0070712_100013778
667 Ga0097621_101018203
668 Ga0097621_101232407
669 Ga0097621_102280711
670 Ga0068871_100025601
671 Ga0075434_100268958
672 Ga0068865_100002396
673 Ga0068865_100009070
674 Ga0068865_100155548
675 Ga0075436_100815875
676 Ga0097620_100105275
677 Ga0097620_101193757
678 Ga0075435_100588306
679 Ga0111539_10065124
680 Ga0111539_10264203
681 Ga0105245_10037915
682 Ga0105245_10096517
683 Ga0105245_10405725
684 Ga0105245_10674193
685 Ga0114129_10467488
686 Ga0114129_11220632
687 Ga0105243_10012009
688 Ga0105243_10110418
689 Ga0105243_10573314
690 Ga0105241_10274650
691 Ga0105241_10502147
692 Ga0105242_10132662
693 Ga0105242_10741307
694 Ga0105242_11084808
695 Ga0105242_11803581
696 Ga0105248_10066630
697 Ga0105237_12088797
698 Ga0105238_10069385
699 Ga0105238_10971158
700 Ga0105249_10053861
701 Ga0105249_10252276
702 Ga0105249_10703779
703 Ga0105249_11063517
704 Ga0105239_10018276
705 Ga0105239_10572206
706 Ga0105246_11538896
707 Ga0105246_11556899
708 Ga0157320_1000978
709 Ga0157374_10573480
710 Ga0157378_10043433
711 Ga0157378_12689620
712 Ga0163162_10052683
713 Ga0163162_10053229
714 Ga0163162_11696189
715 Ga0163162_11837105
716 Ga0157372_10057323
717 Ga0157372_10334126
718 Ga0157375_10298029
719 Ga0157375_10818252
720 Ga0163163_10327119
721 Ga0157380_10006752
722 Ga0157380_10303591
723 Ga0182008_10018457
724 Ga0182008_10299868
725 Ga0157377_10004021
726 Ga0157377_10780647
727 Ga0157379_10009744
728 Ga0157376_10007690
729 Ga0157376_10847382
730 Ga0157376_11330270
731 Ga0163161_10066206
732 Ga0163161_10313260
733 Ga0207656_10191766
734 Ga0207682_10378280
735 Ga0207642_11008709
736 Ga0207688_10018669
737 Ga0207688_10160471
738 Ga0207680_11371393
739 Ga0207647_10208834
740 Ga0207699_11293867
741 Ga0207643_10001236
742 Ga0207705_10579724
743 Ga0207684_10011898
744 Ga0207684_11146499
745 Ga0207654_11124306
746 Ga0207654_11141874
747 Ga0207654_11197241
748 Ga0207707_10027506
749 Ga0207707_10568147
750 Ga0207693_10006171
751 Ga0207693_10106499
752 Ga0207693_10130889
753 Ga0207663_10053597
754 Ga0207663_10253230
755 Ga0207663_10255389
756 Ga0207663_10279445
757 Ga0207660_10176851
758 Ga0207660_10770676
759 Ga0207662_10113768
760 Ga0207662_11075168
761 Ga0207657_10055677
762 Ga0207657_10149494
763 Ga0207652_10366492
764 Ga0207646_10012253
765 Ga0207646_10765056
766 Ga0207681_10373127
767 Ga0207681_10447298
768 Ga0207681_10609426
769 Ga0207694_10122556
770 Ga0207694_10764801
771 Ga0207659_10192511
772 Ga0207659_10563081
773 Ga0207687_10165928
774 Ga0207687_10811082
775 Ga0207700_10475549
776 Ga0207700_10671087
777 Ga0207700_10897241
778 Ga0207664_10350895
779 Ga0207664_10577503
780 Ga0207644_10282629
781 Ga0207644_10654532
782 Ga0207644_11012736
783 Ga0207644_11592928
784 Ga0207690_11126897
785 Ga0207706_10053017
786 Ga0207706_10113451
787 Ga0207686_10210166
788 Ga0207686_10763223
789 Ga0207709_10018083
790 Ga0207709_10141833
791 Ga0207709_11043197
792 Ga0207709_11174752
793 Ga0207669_10079573
794 Ga0207669_11731883
795 Ga0207704_10040600
796 Ga0207704_10278874
797 Ga0207665_10102141
798 Ga0207665_10927182
799 Ga0207691_10013449
800 Ga0207691_10014290
801 Ga0207711_10115743
802 Ga0207689_10113884
803 Ga0207661_10514474
804 Ga0207679_10561628
805 Ga0207679_11456430
806 Ga0207712_10403005
807 Ga0207668_10118438
808 Ga0207668_10442984
809 Ga0207668_10580930
810 Ga0207668_11162329
811 Ga0207640_10192152
812 Ga0207658_11429536
813 Ga0207677_10022058
814 Ga0207677_10239923
815 Ga0207703_10071058
816 Ga0207639_10963468
817 Ga0207678_10099804
818 Ga0207678_10203047
819 Ga0207708_10052313
820 Ga0207708_10056220
821 Ga0207702_10464537
822 Ga0207702_11486349
823 Ga0207641_10385760
824 Ga0207648_10522622
825 Ga0207675_100001890
826 Ga0207675_101567231
827 Ga0207683_10124106
828 Ga0207683_10124798
829 Ga0207428_10171116
830 Ga0268266_10119850
831 Ga0268266_10134706
832 Ga0268265_10231030
833 Ga0268265_11319277
834 Ga0268265_11852402
835 Ga0268264_10362833
836 Ga0265320_10139799
837 Ga0373940_0156667
838 Ga0373923_0643465
839 Ga0373953_0044961
840 Ga0373943_0068203
841 Ga0373943_0508004
842 Ga0373946_0109649
843 Ga0373962_0006685
844 Ga0373924_0053736
845 Ga0373931_0036029
846 Ga0373927_0406815
847 Ga0373933_0083316
848 Ga0373947_0035324
849 Ga0373937_0171558
850 Ga0373925_1716672
851 Ga0395899_0125006
852 Ga0395899_0235271
853 Ga0395900_0146926
854 Ga0395900_0224219
855 Ga0395900_0272942
856 Ga0395900_0386562
857 Ga0395898_0019069
858 Ga0395898_0293765
859 Ga0395898_0493957
860 Ga0395898_0602923
861 Ga0395898_0641384
862 Ga0395898_0748614
863 Ga0395898_1052920
864 Ga0395898_1595827
865 Ga0395905_0011284
866 Ga0395905_0434059
867 Ga0395905_0465039
868 Ga0395905_1604892
869 Ga0395901_0232921
870 Ga0395901_0284013
871 Ga0395901_0300154
872 Ga0395901_0478545
873 Ga0395901_0867627
874 Ga0395901_1004469
875 Ga0395901_1443757
876 Ga0436365_1551408
877 Ga0466965_0502871
878 Ga0466966_0425637
879 Ga0466961_0211009
880 Ga0466961_0452774
881 Ga0466963_0001434
882 Ga0466963_0004803
883 Ga0466963_0009131
884 Ga0466963_0417035
885 Ga0466963_0568580
886 Ga0466964_0020462
887 Ga0466964_0317249
888 Ga0466971_0115425
889 Ga0466968_0010569
890 Ga0466968_0119088
891 Ga0466957_0058159
892 Ga0466960_0664575
893 Ga0466959_0020702
894 Ga0466959_0202382
895 Ga0451576_1777161
896 Ga0466958_0001543
897 Ga0466958_0072457
898 Ga0466958_0105598
899 Ga0466958_0143555
900 Ga0466958_0276809
901 Ga0466967_0002088
902 Ga0466967_0037546
903 Ga0466967_0211638
904 Ga0466967_0215504
905 Ga0466967_0309133
906 Ga0466967_0373592
907 Ga0466967_0685843
908 Ga0466967_1286983
909 Ga0466967_1732834
910 Ga0466967_1807086
911 Ga0466967_1808455
912 Ga0495592_0028783
913 Ga0495592_0140405
914 Ga0495592_0295186
915 Ga0495603_0083624
916 Ga0495629_0179501
917 Ga0495629_1074487
918 Ga0495641_0043834
919 Ga0495651_0016309
920 Ga0495651_0019505
921 Ga0495653_0003414
922 Ga0495653_0025979
923 Ga0495653_0186610
924 Ga0495653_0257841
925 Ga0495582_0343931
926 Ga0495639_0564257
927 Ga0495664_0112474
928 Ga0495664_0184466
929 Ga0495664_0485452
930 Ga0495664_0663222
931 Ga0495594_0602322
932 Ga0495596_0054048
933 Ga0495608_0006946
934 Ga0495608_0013918
935 Ga0495608_0394354
936 Ga0495618_0084816
937 Ga0495628_0029772
938 Ga0495628_0247549
939 Ga0495628_0253503
940 Ga0495630_0001521
941 Ga0495630_0242428
942 Ga0495630_0290560
943 Ga0495630_0330549
944 Ga0495630_0564115
945 Ga0495644_0252688
946 Ga0495652_0058657
947 Ga0495652_0208304
948 Ga0495652_0645166
949 Ga0495640_0369563
950 Ga0495640_0712173
951 Ga0495586_0722448
952 Ga0495587_0011452
953 Ga0495645_0183454
954 Ga0495667_0033364
955 Ga0495667_0035222
956 Ga0495667_0102803
957 Ga0495667_0149779
958 Ga0495667_0709325
959 Ga0495656_0684788
960 Ga0495634_0076008
961 Ga0495634_0132041
962 Ga0495635_0015872
963 Ga0495659_0568281
964 Ga0495588_0102691
965 Ga0495657_0039870
966 Ga0495657_0365485
967 Ga0495657_0633932
968 Ga0495599_0026591
969 Ga0495623_0011753
970 Ga0495646_0128620
971 Ga0495647_0288135
972 Ga0495658_0236424
973 Ga0495613_0011449
974 Ga0495613_0268263
975 Ga0495624_0098980
976 Ga0495624_0679514
977 Ga0495624_0794129
978 Ga0495670_0397036
979 Ga0495600_0118077
980 Ga0495600_0154923
981 Ga0495600_0156982
982 Ga0495581_0718207
983 Ga0495604_0018798
984 Ga0495604_0038048
985 Ga0495674_0000568
986 Ga0495674_0050622
987 Ga0495674_0245675
988 Ga0495674_0617603
989 Ga0495674_1008100
990 Ga0495676_0220037
991 Ga0495676_0271209
992 Ga0495676_0332176
993 Ga0495680_0000393
994 Ga0495680_0027665
995 Ga0495680_0042000
996 Ga0495675_0003965
997 Ga0495684_0020961
998 Ga0495684_0108331
999 Ga0495684_0146060
1000 Ga0495602_0228521
1001 Ga0495602_0382373
1002 Ga0495614_0116126
1003 Ga0496100_0000844
1004 Ga0496100_0118631
1005 Ga0496100_0625501
1006 Ga0496101_0063535
1007 Ga0496101_0132720
1008 Ga0496101_0154013
1009 Ga0496101_0274826
1010 Ga0496102_0002396
1011 Ga0496102_0256026
1012 Ga0496102_0354491
1013 Ga0496102_0836338
1014 Ga0496102_1958682
1015 Ga0496103_0029795
1016 Ga0496103_0075506
1017 Ga0496103_0166823
1018 Ga0496104_0012636
1019 Ga0496104_0248359
1020 Ga0496104_0283662
1021 Ga0496104_0621152
1022 Ga0496104_0682814
1023 Ga0496105_0017306
1024 Ga0496105_0103216
1025 Ga0496105_0231093
1026 Ga0496105_0349655
1027 Ga0496105_0708367
1028 Ga0496105_1292637
1029 Ga0496106_0009460
1030 Ga0496106_0020610
1031 Ga0496106_0040557
1032 Ga0496106_0203737
1033 Ga0496107_0002519
1034 Ga0496107_0026487
1035 Ga0496107_0071656
1036 Ga0496107_0148348
1037 Ga0496108_0003357
1038 Ga0496108_0036417
1039 Ga0496108_0040525
1040 Ga0496108_0136684
1041 Ga0496108_0342824
1042 Ga0496109_0001036
1043 Ga0496109_0025212
1044 Ga0496109_0224428
1045 Ga0496110_0013144
1046 Ga0496110_0015597
1047 Ga0496110_0021509
1048 Ga0496110_1173007
1049 Ga0496111_0007052
1050 Ga0496111_0008438
1051 Ga0496111_0060331
1052 Ga0496112_0046421
1053 Ga0496112_0148270
1054 Ga0496113_0195667
1055 Ga0496113_0621928
1056 Ga0496113_0960990
1057 Ga0496114_0000945
1058 Ga0496114_0091517
1059 Ga0496114_0116517
1060 Ga0496114_0146523
1061 Ga0496114_0417786
1062 Ga0496114_0494800
1063 Ga0496115_0001623
1064 Ga0496115_0006166
1065 Ga0496115_0234958
1066 Ga0496115_0646801
1067 Ga0501067_0024721
1068 Ga0501069_0075064
1069 Ga0501069_0115490
1070 nmdc:mga08y16_125742_c1
1071 nmdc:mga08y16_662675_c1
1072 nmdc:mga0n895_1081576_c1
1073 nmdc:mga0n895_228840_c1
1074 nmdc:mga0n895_295097_c1
1075 nmdc:mga0rr50_1068104_c1
1076 nmdc:mga0a205_720422_c1
1077 Ga0495601_0055203
1078 Ga0495601_0057137
1079 Ga0495601_0352727
1080 Ga0495601_0622426
1081 Ga0495612_0045100
1082 Ga0495595_0587001
1083 Ga0495619_0175901
1084 Ga0495619_0314449
1085 Ga0466962_0148709
1086 Ga0466962_0237536

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05336

rhaM

L-rhamnose mutarotase

24

122

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7byw-assembly1.cif.gz_B crystal structure of acidovorax avenae l-fucose mutarotase (l-fucose-bound form) 0.8653 3 103
1x8d-assembly2.cif.gz_D crystal structure of e. coli yiil protein containing l-rhamnose 0.86 3 103
7byw-assembly1.cif.gz_B crystal structure of acidovorax avenae l-fucose mutarotase (l-fucose-bound form) 0.8425 3 103
1x8d-assembly2.cif.gz_D crystal structure of e. coli yiil protein containing l-rhamnose 0.8371 3 103
6hhn-assembly1.cif.gz_A-2 crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila 0.8277 3 103
ID Description Score Start End Superfamily
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.856 3 96 3.30.70.100
af_Q556R9_3_105_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8444 1 86 3.30.70.100
af_Q9VXK0_45_165_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8276 2 86 3.30.70.100
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8247 3 96 3.30.70.100
af_P34492_299_417_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7726 2 85 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A357TQ45-F1-model_v4 L-rhamnose mutarotase 0.9803 3 85 GO:0016857
GO:0019301
AF-A0A810L132-F1-model_v4 L-rhamnose mutarotase 0.9788 3 103 GO:0016857
GO:0019301
AF-A0A2V9QIW7-F1-model_v4 L-rhamnose/proton symporter RhaT 0.9634 3 86 GO:0005886
GO:0015153
GO:0015293
GO:0016857
GO:0019301
AF-A0A420HSC8-F1-model_v4 Uncharacterized protein 0.9606 1 60 GO:0016857
AF-A0A810L132-F1-model_v4 L-rhamnose mutarotase 0.9601 3 103 GO:0016857
GO:0019301

Map