F461650

General Info

Members Datasets Scaffolds Average Seq Length
543 200 1086 266

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0072858|Ga0395899_0072858_1347_2276
Length 309
Sequence MAARGSIPLPPIPQKKYRSVIAPRPMRARSFVQLMDAMKIAVVAPSCTLRPEAAEAVAAIVETRGDVELMIHPQCFLSDGHFAGPDKERLAALREVMADESVDAVWFARGGYGSNRIAEAAVADLPPAARAKTYLGYSDAGFLLAPFDKAGLSVAHGPMVQDIARTGGEAAIHRALDWLVRRDEGSIEPRLKSGQRAMAFNLTVLSNLIGTPIEPDFTDAELLIEDVAEHEYRIDRAMFHVTNSPAVRRVASIRMGRMSEIPENDPVFGRDAESIVRDWCDRSGISFGGAADIGHDAANRVVPFDLGRN

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
155 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
165 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
166 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
167 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
168 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
172 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
173 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
200 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.42
Rhizosphere 95.4
Stem 0
Stem Tuber 0.18
Unclassified 1.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0072858 3300037312 Bacteria 2513
2 JGI24737J22298_10027448 3300001990 Bacteria 1795
3 JGI24745J21846_1002720 3300002073 Bacteria 1821
4 JGI24749J21850_1002896 3300002076 Bacteria 2403
5 JGI24034J26672_10001870 3300002239 Bacteria 2838
6 Ga0065715_10141041 3300005293 Bacteria 1853
7 Ga0070658_10035126 3300005327 Bacteria 4036
8 Ga0070658_10052518 3300005327 Bacteria 3306
9 Ga0070658_10098480 3300005327 Bacteria 2415
10 Ga0070676_10007325 3300005328 Bacteria 5920
11 Ga0070676_10007457 3300005328 Bacteria 5872
12 Ga0070670_100019632 3300005331 Bacteria 5801
13 Ga0070670_100040798 3300005331 Bacteria 3989
14 Ga0070670_100370050 3300005331 Unclassified 1261
15 Ga0070670_100390020 3300005331 Bacteria 1228
16 Ga0070677_10039781 3300005333 Bacteria 1847
17 Ga0068869_100018243 3300005334 Bacteria 4773
18 Ga0068869_100070905 3300005334 Bacteria 2579
19 Ga0068869_100269896 3300005334 Bacteria 1365
20 Ga0070666_10001949 3300005335 Bacteria 12559
21 Ga0070666_10043980 3300005335 Bacteria 2991
22 Ga0070666_10475703 3300005335 Bacteria 904
23 Ga0070680_100000330 3300005336 Bacteria 31672
24 Ga0070682_100231323 3300005337 Bacteria 1321
25 Ga0068868_100022483 3300005338 Bacteria 4759
26 Ga0068868_100072040 3300005338 Bacteria 2756
27 Ga0070660_100030113 3300005339 Bacteria 4069
28 Ga0070660_100030175 3300005339 Bacteria 4066
29 Ga0070660_100197443 3300005339 Bacteria 1631
30 Ga0070660_100261742 3300005339 Bacteria 1412
31 Ga0070661_100019684 3300005344 Bacteria 4810
32 Ga0070661_100024865 3300005344 Bacteria 4298
33 Ga0070661_100038432 3300005344 Bacteria 3484
34 Ga0070661_100073682 3300005344 Bacteria 2514
35 Ga0070661_100137272 3300005344 Bacteria 1841
36 Ga0070661_100356609 3300005344 Bacteria 1148
37 Ga0070692_10017071 3300005345 Bacteria 3463
38 Ga0070692_10235078 3300005345 Bacteria 1090
39 Ga0070668_100005709 3300005347 Bacteria 9225
40 Ga0070668_100006304 3300005347 Bacteria 8784
41 Ga0070668_100174183 3300005347 Bacteria 1753
42 Ga0070669_100001479 3300005353 Bacteria 16994
43 Ga0070669_100064625 3300005353 Bacteria 2695
44 Ga0070669_100086105 3300005353 Bacteria 2347
45 Ga0070669_100096145 3300005353 Bacteria 2228
46 Ga0070675_100001684 3300005354 Bacteria 16309
47 Ga0070675_100045402 3300005354 Bacteria 3595
48 Ga0070675_100129063 3300005354 Bacteria 2153
49 Ga0070671_100004963 3300005355 Bacteria 10589
50 Ga0070671_100008256 3300005355 Bacteria 8334
51 Ga0070671_100012494 3300005355 Bacteria 6838
52 Ga0070671_100038367 3300005355 Bacteria 3976
53 Ga0070671_100047637 3300005355 Bacteria 3564
54 Ga0070671_100057188 3300005355 Bacteria 3245
55 Ga0070674_100018755 3300005356 Bacteria 4383
56 Ga0070674_100072899 3300005356 Bacteria 2433
57 Ga0070674_100197785 3300005356 Bacteria 1550
58 Ga0070673_100009105 3300005364 Bacteria 6648
59 Ga0070673_100017342 3300005364 Bacteria 5118
60 Ga0070673_100028535 3300005364 Bacteria 4151
61 Ga0070673_100529644 3300005364 Bacteria 1068
62 Ga0070673_100608124 3300005364 Bacteria 997
63 Ga0070659_100104328 3300005366 Bacteria 2284
64 Ga0070659_100120635 3300005366 Bacteria 2123
65 Ga0070667_100078226 3300005367 Bacteria 2825
66 Ga0070667_100365438 3300005367 Bacteria 1308
67 Ga0070714_100026375 3300005435 Bacteria 4802
68 Ga0070714_100153423 3300005435 Bacteria 2077
69 Ga0070714_100554483 3300005435 Bacteria 1100
70 Ga0070713_100014225 3300005436 Bacteria 5899
71 Ga0070694_100109451 3300005444 Bacteria 1966
72 Ga0070663_100014598 3300005455 Bacteria 5046
73 Ga0070663_100069757 3300005455 Bacteria 2554
74 Ga0070678_100008748 3300005456 Bacteria 6082
75 Ga0070678_100036046 3300005456 Bacteria 3459
76 Ga0070662_100001900 3300005457 Bacteria 12824
77 Ga0070662_100087190 3300005457 Bacteria 2336
78 Ga0070662_100142854 3300005457 Bacteria 1857
79 Ga0070662_100176058 3300005457 Bacteria 1683
80 Ga0070662_100386614 3300005457 Unclassified 1152
81 Ga0070681_10074537 3300005458 Bacteria 3355
82 Ga0068867_100039458 3300005459 Bacteria 3443
83 Ga0068867_100286299 3300005459 Bacteria 1353
84 Ga0070685_10002961 3300005466 Bacteria 8670
85 Ga0070679_100115849 3300005530 Bacteria 2665
86 Ga0068853_100040695 3300005539 Bacteria 3966
87 Ga0068853_100087739 3300005539 Bacteria 2730
88 Ga0068853_100208133 3300005539 Bacteria 1782
89 Ga0070672_100000688 3300005543 Bacteria 19954
90 Ga0070672_100026119 3300005543 Bacteria 4341
91 Ga0070672_100039605 3300005543 Bacteria 3611
92 Ga0070672_100128806 3300005543 Bacteria 2078
93 Ga0070672_100292006 3300005543 Bacteria 1380
94 Ga0070695_100128253 3300005545 Bacteria 1745
95 Ga0070696_100018851 3300005546 Bacteria 4671
96 Ga0070665_100007901 3300005548 Bacteria 10790
97 Ga0070665_100045109 3300005548 Bacteria 4426
98 Ga0070665_100088582 3300005548 Bacteria 3101
99 Ga0070665_100161735 3300005548 Bacteria 2241
100 Ga0070665_100537150 3300005548 Bacteria 1181
101 Ga0070704_100034464 3300005549 Bacteria 3434
102 Ga0068855_100032090 3300005563 Bacteria 6270
103 Ga0068855_100177995 3300005563 Bacteria 2405
104 Ga0070664_100034127 3300005564 Bacteria 4267
105 Ga0070664_100066797 3300005564 Bacteria 3071
106 Ga0070664_100078191 3300005564 Bacteria 2846
107 Ga0070664_100078531 3300005564 Bacteria 2839
108 Ga0068857_100029167 3300005577 Bacteria 4869
109 Ga0068857_100560082 3300005577 Bacteria 1077
110 Ga0068854_100082291 3300005578 Bacteria 2379
111 Ga0068854_100116405 3300005578 Bacteria 2023
112 Ga0068854_100561320 3300005578 Bacteria 970
113 Ga0068856_100264297 3300005614 Bacteria 1736
114 Ga0068856_100371191 3300005614 Bacteria 1450
115 Ga0068852_100202270 3300005616 Bacteria 1880
116 Ga0068852_100216767 3300005616 Bacteria 1818
117 Ga0068852_100355870 3300005616 Bacteria 1431
118 Ga0068852_100383147 3300005616 Bacteria 1380
119 Ga0068852_100727609 3300005616 Bacteria 1004
120 Ga0068859_100003124 3300005617 Bacteria 16823
121 Ga0068859_100039697 3300005617 Bacteria 4723
122 Ga0068859_100050993 3300005617 Bacteria 4159
123 Ga0068859_100068469 3300005617 Bacteria 3584
124 Ga0068864_100020439 3300005618 Bacteria 5539
125 Ga0068864_100030516 3300005618 Bacteria 4569
126 Ga0068864_100169187 3300005618 Bacteria 1991
127 Ga0068864_100712736 3300005618 Bacteria 981
128 Ga0068866_10046249 3300005718 Bacteria 2187
129 Ga0068861_100046634 3300005719 Bacteria 3268
130 Ga0068851_10003307 3300005834 Bacteria 7161
131 Ga0068851_10006341 3300005834 Bacteria 5397
132 Ga0068851_10017397 3300005834 Bacteria 3452
133 Ga0068870_10008684 3300005840 Bacteria 4581
134 Ga0068863_100002308 3300005841 Bacteria 18967
135 Ga0068863_100851399 3300005841 Unclassified 911
136 Ga0068858_100005445 3300005842 Bacteria 12460
137 Ga0068858_100033887 3300005842 Bacteria 4737
138 Ga0068858_100046039 3300005842 Bacteria 4044
139 Ga0068860_100014890 3300005843 Bacteria 7604
140 Ga0068860_100019391 3300005843 Bacteria 6596
141 Ga0068860_100587333 3300005843 Bacteria 1118
142 Ga0068862_100031993 3300005844 Bacteria 4444
143 Ga0068862_100036031 3300005844 Bacteria 4191
144 Ga0068862_100119623 3300005844 Bacteria 2320
145 Ga0068862_100334335 3300005844 Bacteria 1401
146 Ga0070717_10018931 3300006028 Bacteria 5389
147 Ga0097621_100008765 3300006237 Bacteria 7306
148 Ga0097621_100088627 3300006237 Bacteria 2586
149 Ga0097621_100618072 3300006237 Unclassified 992
150 Ga0068871_100398280 3300006358 Bacteria 1225
151 Ga0075431_100006200 3300006847 Bacteria 11872
152 Ga0075433_10002017 3300006852 Bacteria 15313
153 Ga0068865_100152781 3300006881 Bacteria 1753
154 Ga0097620_100003124 3300006931 Bacteria 16823
155 Ga0097620_100039692 3300006931 Bacteria 4723
156 Ga0097620_100050992 3300006931 Bacteria 4159
157 Ga0097620_100068470 3300006931 Bacteria 3584
158 Ga0105240_10304870 3300009093 Bacteria 1821
159 Ga0105247_10433792 3300009101 Bacteria 943
160 Ga0105242_10184209 3300009176 Bacteria 1844
161 Ga0105248_10016490 3300009177 Bacteria 8132
162 Ga0105248_10080678 3300009177 Bacteria 3657
163 Ga0105248_10105484 3300009177 Bacteria 3177
164 Ga0105248_10144228 3300009177 Bacteria 2687
165 Ga0105248_10146649 3300009177 Bacteria 2663
166 Ga0105248_10233697 3300009177 Bacteria 2070
167 Ga0105237_10160591 3300009545 Bacteria 2246
168 Ga0105249_10021088 3300009553 Bacteria 5831
169 Ga0105249_10098590 3300009553 Bacteria 2745
170 Ga0105249_10113045 3300009553 Bacteria 2569
171 Ga0105249_10200693 3300009553 Bacteria 1952
172 Ga0105246_10055172 3300011119 Bacteria 2741
173 Ga0157373_10035700 3300013100 Bacteria 3568
174 Ga0157373_10089583 3300013100 Bacteria 2167
175 Ga0157371_10094098 3300013102 Bacteria 2123
176 Ga0157371_10143076 3300013102 Bacteria 1704
177 Ga0157371_10205681 3300013102 Bacteria 1412
178 Ga0157369_10355689 3300013105 Bacteria 1521
179 Ga0157374_10033321 3300013296 Bacteria 4700
180 Ga0157374_10038488 3300013296 Bacteria 4396
181 Ga0157374_10374214 3300013296 Bacteria 1418
182 Ga0163162_10313058 3300013306 Bacteria 1702
183 Ga0157372_10135730 3300013307 Bacteria 2833
184 Ga0157372_10478075 3300013307 Bacteria 1452
185 Ga0157375_10019279 3300013308 Bacteria 6201
186 Ga0157375_10114358 3300013308 Bacteria 2800
187 Ga0157375_10132831 3300013308 Bacteria 2610
188 Ga0157375_10547663 3300013308 Bacteria 1319
189 Ga0163163_10276958 3300014325 Bacteria 1729
190 Ga0163163_10346949 3300014325 Bacteria 1540
191 Ga0157380_10006161 3300014326 Bacteria 8411
192 Ga0157380_10009669 3300014326 Bacteria 6916
193 Ga0157380_10375911 3300014326 Bacteria 1339
194 Ga0157377_10121830 3300014745 Bacteria 1582
195 Ga0157376_10624723 3300014969 Bacteria 1075
196 Ga0163161_10030965 3300017792 Bacteria 3810
197 Ga0207673_1011606 3300025290 Bacteria 1141
198 Ga0207697_10006648 3300025315 Bacteria 5212
199 Ga0207697_10083351 3300025315 Bacteria 1349
200 Ga0207656_10005121 3300025321 Bacteria 4610
201 Ga0207656_10060340 3300025321 Bacteria 1662
202 Ga0207682_10002049 3300025893 Bacteria 9125
203 Ga0207688_10008628 3300025901 Bacteria 5549
204 Ga0207688_10053082 3300025901 Bacteria 2272
205 Ga0207688_10109453 3300025901 Bacteria 1603
206 Ga0207688_10185667 3300025901 Bacteria 1241
207 Ga0207680_10036747 3300025903 Bacteria 2822
208 Ga0207647_10000365 3300025904 Bacteria 36940
209 Ga0207647_10041018 3300025904 Bacteria 2912
210 Ga0207645_10006396 3300025907 Bacteria 8460
211 Ga0207645_10055027 3300025907 Bacteria 2541
212 Ga0207643_10012316 3300025908 Bacteria 4624
213 Ga0207643_10053809 3300025908 Bacteria 2287
214 Ga0207705_10001737 3300025909 Bacteria 17260
215 Ga0207705_10004761 3300025909 Bacteria 10224
216 Ga0207707_10150242 3300025912 Bacteria 2037
217 Ga0207660_10000698 3300025917 Bacteria 22444
218 Ga0207662_10177724 3300025918 Bacteria 1368
219 Ga0207657_10010870 3300025919 Bacteria 9055
220 Ga0207657_10018734 3300025919 Bacteria 6595
221 Ga0207657_10022437 3300025919 Bacteria 5904
222 Ga0207657_10076023 3300025919 Bacteria 2834
223 Ga0207657_10453438 3300025919 Bacteria 1006
224 Ga0207649_10039447 3300025920 Bacteria 2864
225 Ga0207649_10050473 3300025920 Bacteria 2573
226 Ga0207649_10062523 3300025920 Bacteria 2347
227 Ga0207649_10149153 3300025920 Bacteria 1609
228 Ga0207652_10224978 3300025921 Bacteria 1691
229 Ga0207681_10006755 3300025923 Bacteria 7041
230 Ga0207681_10064096 3300025923 Bacteria 2536
231 Ga0207681_10074051 3300025923 Bacteria 2384
232 Ga0207681_10143943 3300025923 Bacteria 1778
233 Ga0207681_10171681 3300025923 Bacteria 1644
234 Ga0207650_10003614 3300025925 Bacteria 10605
235 Ga0207650_10020482 3300025925 Bacteria 4665
236 Ga0207650_10039508 3300025925 Bacteria 3448
237 Ga0207650_10041170 3300025925 Bacteria 3384
238 Ga0207659_10007449 3300025926 Bacteria 6729
239 Ga0207659_10017306 3300025926 Bacteria 4708
240 Ga0207659_10178160 3300025926 Bacteria 1682
241 Ga0207659_10421882 3300025926 Bacteria 1119
242 Ga0207687_10141165 3300025927 Bacteria 1827
243 Ga0207687_10330707 3300025927 Bacteria 1236
244 Ga0207644_10001060 3300025931 Bacteria 17587
245 Ga0207644_10002917 3300025931 Bacteria 11016
246 Ga0207644_10012553 3300025931 Bacteria 5630
247 Ga0207644_10021768 3300025931 Bacteria 4372
248 Ga0207644_10157208 3300025931 Bacteria 1764
249 Ga0207644_10195430 3300025931 Bacteria 1593
250 Ga0207644_10512306 3300025931 Bacteria 990
251 Ga0207690_10088559 3300025932 Bacteria 2181
252 Ga0207706_10000842 3300025933 Bacteria 31703
253 Ga0207706_10044509 3300025933 Bacteria 3934
254 Ga0207706_10048382 3300025933 Bacteria 3761
255 Ga0207706_10061691 3300025933 Bacteria 3301
256 Ga0207706_10074799 3300025933 Bacteria 2978
257 Ga0207706_10097374 3300025933 Bacteria 2588
258 Ga0207670_10368828 3300025936 Bacteria 1141
259 Ga0207669_10002732 3300025937 Bacteria 7561
260 Ga0207669_10009631 3300025937 Bacteria 4616
261 Ga0207669_10031694 3300025937 Bacteria 2957
262 Ga0207669_10064423 3300025937 Bacteria 2268
263 Ga0207669_10179254 3300025937 Bacteria 1517
264 Ga0207704_10134996 3300025938 Bacteria 1716
265 Ga0207691_10002897 3300025940 Bacteria 16732
266 Ga0207691_10010496 3300025940 Bacteria 8886
267 Ga0207691_10050900 3300025940 Bacteria 3790
268 Ga0207691_10058398 3300025940 Bacteria 3509
269 Ga0207691_10094177 3300025940 Bacteria 2680
270 Ga0207691_10202019 3300025940 Bacteria 1729
271 Ga0207691_10590724 3300025940 Bacteria 940
272 Ga0207711_10025173 3300025941 Bacteria 4993
273 Ga0207711_10119034 3300025941 Bacteria 2356
274 Ga0207711_10141470 3300025941 Bacteria 2165
275 Ga0207711_10551173 3300025941 Unclassified 1075
276 Ga0207689_10057836 3300025942 Bacteria 3189
277 Ga0207689_10124750 3300025942 Bacteria 2118
278 Ga0207679_10042026 3300025945 Bacteria 3282
279 Ga0207679_10051863 3300025945 Bacteria 3006
280 Ga0207679_10124321 3300025945 Bacteria 2059
281 Ga0207679_10406081 3300025945 Bacteria 1199
282 Ga0207667_10129824 3300025949 Bacteria 2595
283 Ga0207667_10206599 3300025949 Bacteria 2013
284 Ga0207651_10014618 3300025960 Bacteria 4539
285 Ga0207651_10019907 3300025960 Bacteria 4035
286 Ga0207651_10048226 3300025960 Bacteria 2877
287 Ga0207651_10200880 3300025960 Bacteria 1597
288 Ga0207651_10289255 3300025960 Bacteria 1358
289 Ga0207651_10542310 3300025960 Bacteria 1010
290 Ga0207712_10000309 3300025961 Bacteria 44746
291 Ga0207712_10141903 3300025961 Bacteria 1844
292 Ga0207712_10205766 3300025961 Unclassified 1564
293 Ga0207668_10006538 3300025972 Bacteria 6887
294 Ga0207668_10031303 3300025972 Bacteria 3502
295 Ga0207668_10270305 3300025972 Bacteria 1389
296 Ga0207668_10353682 3300025972 Bacteria 1229
297 Ga0207640_10014494 3300025981 Bacteria 4541
298 Ga0207640_10186687 3300025981 Bacteria 1559
299 Ga0207640_10226223 3300025981 Bacteria 1436
300 Ga0207640_10533977 3300025981 Bacteria 983
301 Ga0207658_10032384 3300025986 Bacteria 3720
302 Ga0207658_10034522 3300025986 Bacteria 3615
303 Ga0207658_10064422 3300025986 Bacteria 2749
304 Ga0207658_10168233 3300025986 Bacteria 1803
305 Ga0207677_10010269 3300026023 Bacteria 5294
306 Ga0207677_10028374 3300026023 Bacteria 3538
307 Ga0207703_10014504 3300026035 Bacteria 6147
308 Ga0207703_10019171 3300026035 Bacteria 5343
309 Ga0207703_10021182 3300026035 Bacteria 5088
310 Ga0207703_10189979 3300026035 Unclassified 1818
311 Ga0207639_10188353 3300026041 Bacteria 1760
312 Ga0207639_10207471 3300026041 Bacteria 1685
313 Ga0207678_10010821 3300026067 Bacteria 8016
314 Ga0207678_10011581 3300026067 Bacteria 7746
315 Ga0207678_10030212 3300026067 Bacteria 4730
316 Ga0207678_10079808 3300026067 Bacteria 2801
317 Ga0207641_10008661 3300026088 Bacteria 8402
318 Ga0207641_10014240 3300026088 Bacteria 6516
319 Ga0207641_10346929 3300026088 Bacteria 1414
320 Ga0207648_10000838 3300026089 Bacteria 34648
321 Ga0207648_10034306 3300026089 Bacteria 4473
322 Ga0207648_10471365 3300026089 Bacteria 1146
323 Ga0207676_10003525 3300026095 Bacteria 11074
324 Ga0207676_10016510 3300026095 Bacteria 5346
325 Ga0207676_10058836 3300026095 Bacteria 3033
326 Ga0207676_10694278 3300026095 Bacteria 985
327 Ga0207674_10000151 3300026116 Bacteria 81529
328 Ga0207674_10014364 3300026116 Bacteria 8747
329 Ga0207674_10080912 3300026116 Bacteria 3251
330 Ga0207674_10233646 3300026116 Bacteria 1786
331 Ga0207675_100054755 3300026118 Bacteria 3721
332 Ga0207675_100200756 3300026118 Bacteria 1915
333 Ga0207683_10017932 3300026121 Bacteria 6037
334 Ga0207683_10055618 3300026121 Bacteria 3470
335 Ga0207683_10237076 3300026121 Bacteria 1664
336 Ga0207698_10009623 3300026142 Bacteria 6171
337 Ga0207698_10112134 3300026142 Bacteria 2288
338 Ga0207698_10278217 3300026142 Bacteria 1546
339 Ga0209983_1011333 3300027665 Bacteria 1824
340 Ga0207428_10088925 3300027907 Bacteria 2401
341 Ga0268266_10144765 3300028379 Bacteria 2135
342 Ga0268266_10246189 3300028379 Bacteria 1652
343 Ga0268266_10456620 3300028379 Bacteria 1215
344 Ga0268265_10014099 3300028380 Bacteria 5447
345 Ga0268265_10038428 3300028380 Bacteria 3521
346 Ga0268265_10066407 3300028380 Bacteria 2788
347 Ga0268265_10281362 3300028380 Bacteria 1488
348 Ga0268265_10443562 3300028380 Bacteria 1210
349 Ga0268265_10573415 3300028380 Bacteria 1074
350 Ga0268264_10002540 3300028381 Bacteria 16031
351 Ga0268264_10107018 3300028381 Bacteria 2442
352 Ga0268264_10110222 3300028381 Bacteria 2410
353 Ga0265320_10034105 3300031240 Bacteria 2593
354 Ga0307408_100043045 3300031548 Bacteria 3211
355 Ga0307408_100073855 3300031548 Bacteria 2528
356 Ga0307408_100105062 3300031548 Bacteria 2158
357 Ga0307408_100131570 3300031548 Bacteria 1953
358 Ga0307408_100171922 3300031548 Bacteria 1731
359 Ga0307408_100415042 3300031548 Bacteria 1159
360 Ga0307408_100415811 3300031548 Bacteria 1158
361 Ga0307405_10003577 3300031731 Bacteria 7176
362 Ga0307405_10117440 3300031731 Bacteria 1814
363 Ga0307405_10169069 3300031731 Bacteria 1558
364 Ga0307405_10198977 3300031731 Bacteria 1453
365 Ga0307405_10311501 3300031731 Bacteria 1198
366 Ga0307413_10017785 3300031824 Bacteria 3711
367 Ga0307413_10018908 3300031824 Bacteria 3627
368 Ga0307413_10023514 3300031824 Bacteria 3341
369 Ga0307413_10025728 3300031824 Bacteria 3231
370 Ga0307413_10037885 3300031824 Bacteria 2789
371 Ga0307413_10113120 3300031824 Bacteria 1821
372 Ga0307413_10128204 3300031824 Bacteria 1731
373 Ga0307410_10000527 3300031852 Bacteria 15618
374 Ga0307410_10003026 3300031852 Bacteria 8304
375 Ga0307410_10006623 3300031852 Bacteria 6268
376 Ga0307410_10016186 3300031852 Bacteria 4441
377 Ga0307410_10022965 3300031852 Bacteria 3867
378 Ga0307410_10041290 3300031852 Bacteria 3041
379 Ga0307410_10046307 3300031852 Bacteria 2901
380 Ga0307410_10059702 3300031852 Bacteria 2604
381 Ga0307410_10065346 3300031852 Bacteria 2502
382 Ga0307410_10268977 3300031852 Bacteria 1332
383 Ga0307410_10309959 3300031852 Bacteria 1248
384 Ga0307410_10356924 3300031852 Bacteria 1169
385 Ga0307410_10424530 3300031852 Bacteria 1079
386 Ga0307410_10479423 3300031852 Bacteria 1020
387 Ga0307406_10010861 3300031901 Bacteria 5149
388 Ga0307406_10017306 3300031901 Bacteria 4197
389 Ga0307406_10062399 3300031901 Bacteria 2411
390 Ga0307406_10086171 3300031901 Bacteria 2102
391 Ga0307406_10132762 3300031901 Bacteria 1750
392 Ga0307406_10156518 3300031901 Bacteria 1632
393 Ga0307407_10013558 3300031903 Bacteria 3961
394 Ga0307407_10017853 3300031903 Bacteria 3572
395 Ga0307407_10043648 3300031903 Bacteria 2522
396 Ga0307407_10044291 3300031903 Bacteria 2507
397 Ga0307407_10159999 3300031903 Bacteria 1473
398 Ga0307412_10005577 3300031911 Bacteria 7065
399 Ga0307412_10047367 3300031911 Bacteria 2824
400 Ga0307412_10070533 3300031911 Bacteria 2382
401 Ga0307412_10101438 3300031911 Bacteria 2036
402 Ga0307412_10123363 3300031911 Bacteria 1869
403 Ga0307412_10132170 3300031911 Bacteria 1814
404 Ga0307412_10168205 3300031911 Bacteria 1636
405 Ga0307412_10200980 3300031911 Bacteria 1513
406 Ga0307412_10256000 3300031911 Bacteria 1362
407 Ga0307412_10377624 3300031911 Bacteria 1146
408 Ga0307409_100011382 3300031995 Bacteria 5605
409 Ga0307409_100015222 3300031995 Bacteria 5039
410 Ga0307409_100032636 3300031995 Bacteria 3778
411 Ga0307409_100037706 3300031995 Bacteria 3566
412 Ga0307409_100059912 3300031995 Bacteria 2965
413 Ga0307409_100065782 3300031995 Bacteria 2854
414 Ga0307409_100094748 3300031995 Bacteria 2458
415 Ga0307409_100118991 3300031995 Bacteria 2232
416 Ga0307409_100125528 3300031995 Bacteria 2182
417 Ga0307409_100431084 3300031995 Bacteria 1267
418 Ga0307416_100073075 3300032002 Bacteria 2857
419 Ga0307416_100096182 3300032002 Bacteria 2560
420 Ga0307416_100131131 3300032002 Bacteria 2256
421 Ga0307416_100464683 3300032002 Bacteria 1321
422 Ga0307416_101100171 3300032002 Bacteria 899
423 Ga0307414_10012869 3300032004 Bacteria 4965
424 Ga0307414_10017862 3300032004 Bacteria 4351
425 Ga0307414_10020278 3300032004 Bacteria 4140
426 Ga0307414_10034625 3300032004 Bacteria 3351
427 Ga0307414_10045213 3300032004 Bacteria 3014
428 Ga0307414_10045922 3300032004 Bacteria 2994
429 Ga0307414_10058109 3300032004 Bacteria 2723
430 Ga0307414_10084887 3300032004 Bacteria 2331
431 Ga0307414_10181251 3300032004 Bacteria 1694
432 Ga0307414_10233302 3300032004 Bacteria 1518
433 Ga0307414_10260805 3300032004 Bacteria 1446
434 Ga0307414_10295083 3300032004 Bacteria 1368
435 Ga0307411_10004427 3300032005 Bacteria 6726
436 Ga0307411_10015631 3300032005 Bacteria 4270
437 Ga0307411_10018335 3300032005 Bacteria 4012
438 Ga0307411_10023780 3300032005 Bacteria 3638
439 Ga0307411_10059530 3300032005 Bacteria 2532
440 Ga0307411_10098783 3300032005 Bacteria 2058
441 Ga0307411_10153535 3300032005 Bacteria 1714
442 Ga0307415_100009276 3300032126 Bacteria 5503
443 Ga0307415_100024469 3300032126 Bacteria 3770
444 Ga0307415_100090942 3300032126 Bacteria 2209
445 Ga0307415_100645252 3300032126 Bacteria 948
446 Ga0395899_0004945 3300037312 Bacteria 10372
447 Ga0395899_0035291 3300037312 Bacteria 3754
448 Ga0395899_0050746 3300037312 Bacteria 3080
449 Ga0395900_0000325 3300037418 Bacteria 70579
450 Ga0395900_0077599 3300037418 Bacteria 3412
451 Ga0395900_0536429 3300037418 Bacteria 1116
452 Ga0395898_0009505 3300037466 Bacteria 10208
453 Ga0395898_0091177 3300037466 Bacteria 2932
454 Ga0395898_0458748 3300037466 Bacteria 1213
455 Ga0395905_0000916 3300037471 Bacteria 38099
456 Ga0395905_0006019 3300037471 Bacteria 12280
457 Ga0395905_0016863 3300037471 Bacteria 6940
458 Ga0395905_0031072 3300037471 Bacteria 5030
459 Ga0395905_0088460 3300037471 Bacteria 2903
460 Ga0395905_0156031 3300037471 Bacteria 2147
461 Ga0395905_0321737 3300037471 Bacteria 1436
462 Ga0395905_0382962 3300037471 Bacteria 1300
463 Ga0395905_0643534 3300037471 Bacteria 962
464 Ga0395905_0706199 3300037471 Bacteria 911
465 Ga0395901_0006519 3300038443 Bacteria 11810
466 Ga0395901_0058603 3300038443 Bacteria 4005
467 Ga0395901_0122006 3300038443 Bacteria 2739
468 Ga0439445_0004023 3300042004 Bacteria 3320
469 Ga0439458_0003445 3300042157 Bacteria 3700
470 Ga0466965_0120871 3300044683 Bacteria 1353
471 Ga0466966_0145970 3300044684 Bacteria 1444
472 Ga0466966_0246004 3300044684 Bacteria 1078
473 Ga0466963_0040178 3300044694 Bacteria 3066
474 Ga0466963_0119152 3300044694 Bacteria 1815
475 Ga0466963_0387283 3300044694 Bacteria 985
476 Ga0466963_0478322 3300044694 Unclassified 879
477 Ga0466964_0178916 3300044706 Unclassified 1004
478 Ga0466970_0044666 3300044765 Bacteria 2359
479 Ga0466970_0138203 3300044765 Bacteria 1341
480 Ga0466957_0032261 3300044842 Bacteria 3136
481 Ga0466958_0192872 3300045836 Bacteria 1295
482 Ga0466958_0362525 3300045836 Bacteria 934
483 Ga0466967_0201282 3300045976 Bacteria 1886
484 Ga0466967_0345243 3300045976 Bacteria 1440
485 Ga0466967_0426407 3300045976 Bacteria 1293
486 Ga0495663_0002357 3300046525 Bacteria 5704
487 Ga0495663_0006770 3300046525 Bacteria 3160
488 Ga0495663_0057966 3300046525 Bacteria 1213
489 Ga0495642_0103796 3300046528 Bacteria 1212
490 Ga0495598_0015586 3300046537 Bacteria 1922
491 Ga0495621_0000038 3300046539 Bacteria 25465
492 Ga0495621_0001137 3300046539 Bacteria 6871
493 Ga0495621_0001251 3300046539 Bacteria 6557
494 Ga0495621_0004558 3300046539 Bacteria 3909
495 Ga0495621_0004560 3300046539 Bacteria 3909
496 Ga0495633_0017993 3300046558 Bacteria 3595
497 Ga0495659_0036492 3300046664 Bacteria 1737
498 Ga0495669_0008845 3300046684 Bacteria 4243
499 Ga0495669_0037798 3300046684 Bacteria 2137
500 Ga0495669_0038966 3300046684 Bacteria 2104
501 Ga0495670_0007185 3300046691 Bacteria 5481
502 Ga0495670_0041198 3300046691 Bacteria 2303
503 Ga0495670_0098417 3300046691 Bacteria 1504
504 Ga0495636_0147053 3300047318 Bacteria 1055
505 Ga0495677_0006961 3300047445 Bacteria 4246
506 Ga0495686_0000013 3300047472 Bacteria 489656
507 Ga0495615_0035478 3300048090 Bacteria 1219
508 Ga0496100_0040126 3300048903 Bacteria 2976
509 Ga0496100_0728793 3300048903 Bacteria 775
510 Ga0496101_0182236 3300048904 Bacteria 1617
511 Ga0496103_0299300 3300048906 Unclassified 1035
512 Ga0496105_0127200 3300048908 Bacteria 2101
513 Ga0496107_0103444 3300048910 Bacteria 2089
514 Ga0496107_0213746 3300048910 Bacteria 1434
515 Ga0496108_0013655 3300048911 Bacteria 6630
516 Ga0496108_0020760 3300048911 Bacteria 5399
517 Ga0496108_0061994 3300048911 Bacteria 3148
518 Ga0496109_0020519 3300048912 Bacteria 5836
519 Ga0496109_0247483 3300048912 Bacteria 1678
520 Ga0496110_0035906 3300048913 Bacteria 4304
521 Ga0496110_0105815 3300048913 Bacteria 2524
522 Ga0496111_0016317 3300048914 Bacteria 5116
523 Ga0496111_0060840 3300048914 Bacteria 2737
524 Ga0496112_0017689 3300048915 Bacteria 6705
525 Ga0496112_0046202 3300048915 Bacteria 4270
526 Ga0496112_0470157 3300048915 Bacteria 1194
527 Ga0496113_0001233 3300048916 Bacteria 14076
528 Ga0496113_0015150 3300048916 Bacteria 5288
529 Ga0496114_0012137 3300048917 Bacteria 6894
530 Ga0496115_0001150 3300048918 Bacteria 19121
531 Ga0496115_0036965 3300048918 Bacteria 3868
532 Ga0501067_0034496 3300049583 Bacteria 2808
533 Ga0501068_0233545 3300049584 Bacteria 1170
534 Ga0501069_0098795 3300049585 Bacteria 1656
535 Ga0501249_014558 3300049679 Bacteria 1677
536 Ga0501079_0437338 3300049741 Bacteria 1027
537 Ga0501080_0077277 3300049742 Bacteria 3096
538 Ga0501272_001259 3300049769 Bacteria 2376
539 nmdc:mga06r32_5039_c1 3300050510 Bacteria 11897
540 nmdc:mga08y16_155181_c1 3300050511 Bacteria 2379
541 nmdc:mga0a205_53466_c1 3300050515 Bacteria 3898
542 Ga0590075_036304 3300059424 Bacteria 1256
543 2885427766 2885427238 Bacteria 2291351
544 Ga0395899_0072858
545 JGI24737J22298_10027448
546 JGI24745J21846_1002720
547 JGI24749J21850_1002896
548 JGI24034J26672_10001870
549 Ga0065715_10141041
550 Ga0070658_10035126
551 Ga0070658_10052518
552 Ga0070658_10098480
553 Ga0070676_10007325
554 Ga0070676_10007457
555 Ga0070670_100019632
556 Ga0070670_100040798
557 Ga0070670_100370050
558 Ga0070670_100390020
559 Ga0070677_10039781
560 Ga0068869_100018243
561 Ga0068869_100070905
562 Ga0068869_100269896
563 Ga0070666_10001949
564 Ga0070666_10043980
565 Ga0070666_10475703
566 Ga0070680_100000330
567 Ga0070682_100231323
568 Ga0068868_100022483
569 Ga0068868_100072040
570 Ga0070660_100030113
571 Ga0070660_100030175
572 Ga0070660_100197443
573 Ga0070660_100261742
574 Ga0070661_100019684
575 Ga0070661_100024865
576 Ga0070661_100038432
577 Ga0070661_100073682
578 Ga0070661_100137272
579 Ga0070661_100356609
580 Ga0070692_10017071
581 Ga0070692_10235078
582 Ga0070668_100005709
583 Ga0070668_100006304
584 Ga0070668_100174183
585 Ga0070669_100001479
586 Ga0070669_100064625
587 Ga0070669_100086105
588 Ga0070669_100096145
589 Ga0070675_100001684
590 Ga0070675_100045402
591 Ga0070675_100129063
592 Ga0070671_100004963
593 Ga0070671_100008256
594 Ga0070671_100012494
595 Ga0070671_100038367
596 Ga0070671_100047637
597 Ga0070671_100057188
598 Ga0070674_100018755
599 Ga0070674_100072899
600 Ga0070674_100197785
601 Ga0070673_100009105
602 Ga0070673_100017342
603 Ga0070673_100028535
604 Ga0070673_100529644
605 Ga0070673_100608124
606 Ga0070659_100104328
607 Ga0070659_100120635
608 Ga0070667_100078226
609 Ga0070667_100365438
610 Ga0070714_100026375
611 Ga0070714_100153423
612 Ga0070714_100554483
613 Ga0070713_100014225
614 Ga0070694_100109451
615 Ga0070663_100014598
616 Ga0070663_100069757
617 Ga0070678_100008748
618 Ga0070678_100036046
619 Ga0070662_100001900
620 Ga0070662_100087190
621 Ga0070662_100142854
622 Ga0070662_100176058
623 Ga0070662_100386614
624 Ga0070681_10074537
625 Ga0068867_100039458
626 Ga0068867_100286299
627 Ga0070685_10002961
628 Ga0070679_100115849
629 Ga0068853_100040695
630 Ga0068853_100087739
631 Ga0068853_100208133
632 Ga0070672_100000688
633 Ga0070672_100026119
634 Ga0070672_100039605
635 Ga0070672_100128806
636 Ga0070672_100292006
637 Ga0070695_100128253
638 Ga0070696_100018851
639 Ga0070665_100007901
640 Ga0070665_100045109
641 Ga0070665_100088582
642 Ga0070665_100161735
643 Ga0070665_100537150
644 Ga0070704_100034464
645 Ga0068855_100032090
646 Ga0068855_100177995
647 Ga0070664_100034127
648 Ga0070664_100066797
649 Ga0070664_100078191
650 Ga0070664_100078531
651 Ga0068857_100029167
652 Ga0068857_100560082
653 Ga0068854_100082291
654 Ga0068854_100116405
655 Ga0068854_100561320
656 Ga0068856_100264297
657 Ga0068856_100371191
658 Ga0068852_100202270
659 Ga0068852_100216767
660 Ga0068852_100355870
661 Ga0068852_100383147
662 Ga0068852_100727609
663 Ga0068859_100003124
664 Ga0068859_100039697
665 Ga0068859_100050993
666 Ga0068859_100068469
667 Ga0068864_100020439
668 Ga0068864_100030516
669 Ga0068864_100169187
670 Ga0068864_100712736
671 Ga0068866_10046249
672 Ga0068861_100046634
673 Ga0068851_10003307
674 Ga0068851_10006341
675 Ga0068851_10017397
676 Ga0068870_10008684
677 Ga0068863_100002308
678 Ga0068863_100851399
679 Ga0068858_100005445
680 Ga0068858_100033887
681 Ga0068858_100046039
682 Ga0068860_100014890
683 Ga0068860_100019391
684 Ga0068860_100587333
685 Ga0068862_100031993
686 Ga0068862_100036031
687 Ga0068862_100119623
688 Ga0068862_100334335
689 Ga0070717_10018931
690 Ga0097621_100008765
691 Ga0097621_100088627
692 Ga0097621_100618072
693 Ga0068871_100398280
694 Ga0075431_100006200
695 Ga0075433_10002017
696 Ga0068865_100152781
697 Ga0097620_100003124
698 Ga0097620_100039692
699 Ga0097620_100050992
700 Ga0097620_100068470
701 Ga0105240_10304870
702 Ga0105247_10433792
703 Ga0105242_10184209
704 Ga0105248_10016490
705 Ga0105248_10080678
706 Ga0105248_10105484
707 Ga0105248_10144228
708 Ga0105248_10146649
709 Ga0105248_10233697
710 Ga0105237_10160591
711 Ga0105249_10021088
712 Ga0105249_10098590
713 Ga0105249_10113045
714 Ga0105249_10200693
715 Ga0105246_10055172
716 Ga0157373_10035700
717 Ga0157373_10089583
718 Ga0157371_10094098
719 Ga0157371_10143076
720 Ga0157371_10205681
721 Ga0157369_10355689
722 Ga0157374_10033321
723 Ga0157374_10038488
724 Ga0157374_10374214
725 Ga0163162_10313058
726 Ga0157372_10135730
727 Ga0157372_10478075
728 Ga0157375_10019279
729 Ga0157375_10114358
730 Ga0157375_10132831
731 Ga0157375_10547663
732 Ga0163163_10276958
733 Ga0163163_10346949
734 Ga0157380_10006161
735 Ga0157380_10009669
736 Ga0157380_10375911
737 Ga0157377_10121830
738 Ga0157376_10624723
739 Ga0163161_10030965
740 Ga0207673_1011606
741 Ga0207697_10006648
742 Ga0207697_10083351
743 Ga0207656_10005121
744 Ga0207656_10060340
745 Ga0207682_10002049
746 Ga0207688_10008628
747 Ga0207688_10053082
748 Ga0207688_10109453
749 Ga0207688_10185667
750 Ga0207680_10036747
751 Ga0207647_10000365
752 Ga0207647_10041018
753 Ga0207645_10006396
754 Ga0207645_10055027
755 Ga0207643_10012316
756 Ga0207643_10053809
757 Ga0207705_10001737
758 Ga0207705_10004761
759 Ga0207707_10150242
760 Ga0207660_10000698
761 Ga0207662_10177724
762 Ga0207657_10010870
763 Ga0207657_10018734
764 Ga0207657_10022437
765 Ga0207657_10076023
766 Ga0207657_10453438
767 Ga0207649_10039447
768 Ga0207649_10050473
769 Ga0207649_10062523
770 Ga0207649_10149153
771 Ga0207652_10224978
772 Ga0207681_10006755
773 Ga0207681_10064096
774 Ga0207681_10074051
775 Ga0207681_10143943
776 Ga0207681_10171681
777 Ga0207650_10003614
778 Ga0207650_10020482
779 Ga0207650_10039508
780 Ga0207650_10041170
781 Ga0207659_10007449
782 Ga0207659_10017306
783 Ga0207659_10178160
784 Ga0207659_10421882
785 Ga0207687_10141165
786 Ga0207687_10330707
787 Ga0207644_10001060
788 Ga0207644_10002917
789 Ga0207644_10012553
790 Ga0207644_10021768
791 Ga0207644_10157208
792 Ga0207644_10195430
793 Ga0207644_10512306
794 Ga0207690_10088559
795 Ga0207706_10000842
796 Ga0207706_10044509
797 Ga0207706_10048382
798 Ga0207706_10061691
799 Ga0207706_10074799
800 Ga0207706_10097374
801 Ga0207670_10368828
802 Ga0207669_10002732
803 Ga0207669_10009631
804 Ga0207669_10031694
805 Ga0207669_10064423
806 Ga0207669_10179254
807 Ga0207704_10134996
808 Ga0207691_10002897
809 Ga0207691_10010496
810 Ga0207691_10050900
811 Ga0207691_10058398
812 Ga0207691_10094177
813 Ga0207691_10202019
814 Ga0207691_10590724
815 Ga0207711_10025173
816 Ga0207711_10119034
817 Ga0207711_10141470
818 Ga0207711_10551173
819 Ga0207689_10057836
820 Ga0207689_10124750
821 Ga0207679_10042026
822 Ga0207679_10051863
823 Ga0207679_10124321
824 Ga0207679_10406081
825 Ga0207667_10129824
826 Ga0207667_10206599
827 Ga0207651_10014618
828 Ga0207651_10019907
829 Ga0207651_10048226
830 Ga0207651_10200880
831 Ga0207651_10289255
832 Ga0207651_10542310
833 Ga0207712_10000309
834 Ga0207712_10141903
835 Ga0207712_10205766
836 Ga0207668_10006538
837 Ga0207668_10031303
838 Ga0207668_10270305
839 Ga0207668_10353682
840 Ga0207640_10014494
841 Ga0207640_10186687
842 Ga0207640_10226223
843 Ga0207640_10533977
844 Ga0207658_10032384
845 Ga0207658_10034522
846 Ga0207658_10064422
847 Ga0207658_10168233
848 Ga0207677_10010269
849 Ga0207677_10028374
850 Ga0207703_10014504
851 Ga0207703_10019171
852 Ga0207703_10021182
853 Ga0207703_10189979
854 Ga0207639_10188353
855 Ga0207639_10207471
856 Ga0207678_10010821
857 Ga0207678_10011581
858 Ga0207678_10030212
859 Ga0207678_10079808
860 Ga0207641_10008661
861 Ga0207641_10014240
862 Ga0207641_10346929
863 Ga0207648_10000838
864 Ga0207648_10034306
865 Ga0207648_10471365
866 Ga0207676_10003525
867 Ga0207676_10016510
868 Ga0207676_10058836
869 Ga0207676_10694278
870 Ga0207674_10000151
871 Ga0207674_10014364
872 Ga0207674_10080912
873 Ga0207674_10233646
874 Ga0207675_100054755
875 Ga0207675_100200756
876 Ga0207683_10017932
877 Ga0207683_10055618
878 Ga0207683_10237076
879 Ga0207698_10009623
880 Ga0207698_10112134
881 Ga0207698_10278217
882 Ga0209983_1011333
883 Ga0207428_10088925
884 Ga0268266_10144765
885 Ga0268266_10246189
886 Ga0268266_10456620
887 Ga0268265_10014099
888 Ga0268265_10038428
889 Ga0268265_10066407
890 Ga0268265_10281362
891 Ga0268265_10443562
892 Ga0268265_10573415
893 Ga0268264_10002540
894 Ga0268264_10107018
895 Ga0268264_10110222
896 Ga0265320_10034105
897 Ga0307408_100043045
898 Ga0307408_100073855
899 Ga0307408_100105062
900 Ga0307408_100131570
901 Ga0307408_100171922
902 Ga0307408_100415042
903 Ga0307408_100415811
904 Ga0307405_10003577
905 Ga0307405_10117440
906 Ga0307405_10169069
907 Ga0307405_10198977
908 Ga0307405_10311501
909 Ga0307413_10017785
910 Ga0307413_10018908
911 Ga0307413_10023514
912 Ga0307413_10025728
913 Ga0307413_10037885
914 Ga0307413_10113120
915 Ga0307413_10128204
916 Ga0307410_10000527
917 Ga0307410_10003026
918 Ga0307410_10006623
919 Ga0307410_10016186
920 Ga0307410_10022965
921 Ga0307410_10041290
922 Ga0307410_10046307
923 Ga0307410_10059702
924 Ga0307410_10065346
925 Ga0307410_10268977
926 Ga0307410_10309959
927 Ga0307410_10356924
928 Ga0307410_10424530
929 Ga0307410_10479423
930 Ga0307406_10010861
931 Ga0307406_10017306
932 Ga0307406_10062399
933 Ga0307406_10086171
934 Ga0307406_10132762
935 Ga0307406_10156518
936 Ga0307407_10013558
937 Ga0307407_10017853
938 Ga0307407_10043648
939 Ga0307407_10044291
940 Ga0307407_10159999
941 Ga0307412_10005577
942 Ga0307412_10047367
943 Ga0307412_10070533
944 Ga0307412_10101438
945 Ga0307412_10123363
946 Ga0307412_10132170
947 Ga0307412_10168205
948 Ga0307412_10200980
949 Ga0307412_10256000
950 Ga0307412_10377624
951 Ga0307409_100011382
952 Ga0307409_100015222
953 Ga0307409_100032636
954 Ga0307409_100037706
955 Ga0307409_100059912
956 Ga0307409_100065782
957 Ga0307409_100094748
958 Ga0307409_100118991
959 Ga0307409_100125528
960 Ga0307409_100431084
961 Ga0307416_100073075
962 Ga0307416_100096182
963 Ga0307416_100131131
964 Ga0307416_100464683
965 Ga0307416_101100171
966 Ga0307414_10012869
967 Ga0307414_10017862
968 Ga0307414_10020278
969 Ga0307414_10034625
970 Ga0307414_10045213
971 Ga0307414_10045922
972 Ga0307414_10058109
973 Ga0307414_10084887
974 Ga0307414_10181251
975 Ga0307414_10233302
976 Ga0307414_10260805
977 Ga0307414_10295083
978 Ga0307411_10004427
979 Ga0307411_10015631
980 Ga0307411_10018335
981 Ga0307411_10023780
982 Ga0307411_10059530
983 Ga0307411_10098783
984 Ga0307411_10153535
985 Ga0307415_100009276
986 Ga0307415_100024469
987 Ga0307415_100090942
988 Ga0307415_100645252
989 Ga0395899_0004945
990 Ga0395899_0035291
991 Ga0395899_0050746
992 Ga0395900_0000325
993 Ga0395900_0077599
994 Ga0395900_0536429
995 Ga0395898_0009505
996 Ga0395898_0091177
997 Ga0395898_0458748
998 Ga0395905_0000916
999 Ga0395905_0006019
1000 Ga0395905_0016863
1001 Ga0395905_0031072
1002 Ga0395905_0088460
1003 Ga0395905_0156031
1004 Ga0395905_0321737
1005 Ga0395905_0382962
1006 Ga0395905_0643534
1007 Ga0395905_0706199
1008 Ga0395901_0006519
1009 Ga0395901_0058603
1010 Ga0395901_0122006
1011 Ga0439445_0004023
1012 Ga0439458_0003445
1013 Ga0466965_0120871
1014 Ga0466966_0145970
1015 Ga0466966_0246004
1016 Ga0466963_0040178
1017 Ga0466963_0119152
1018 Ga0466963_0387283
1019 Ga0466963_0478322
1020 Ga0466964_0178916
1021 Ga0466970_0044666
1022 Ga0466970_0138203
1023 Ga0466957_0032261
1024 Ga0466958_0192872
1025 Ga0466958_0362525
1026 Ga0466967_0201282
1027 Ga0466967_0345243
1028 Ga0466967_0426407
1029 Ga0495663_0002357
1030 Ga0495663_0006770
1031 Ga0495663_0057966
1032 Ga0495642_0103796
1033 Ga0495598_0015586
1034 Ga0495621_0000038
1035 Ga0495621_0001137
1036 Ga0495621_0001251
1037 Ga0495621_0004558
1038 Ga0495621_0004560
1039 Ga0495633_0017993
1040 Ga0495659_0036492
1041 Ga0495669_0008845
1042 Ga0495669_0037798
1043 Ga0495669_0038966
1044 Ga0495670_0007185
1045 Ga0495670_0041198
1046 Ga0495670_0098417
1047 Ga0495636_0147053
1048 Ga0495677_0006961
1049 Ga0495686_0000013
1050 Ga0495615_0035478
1051 Ga0496100_0040126
1052 Ga0496100_0728793
1053 Ga0496101_0182236
1054 Ga0496103_0299300
1055 Ga0496105_0127200
1056 Ga0496107_0103444
1057 Ga0496107_0213746
1058 Ga0496108_0013655
1059 Ga0496108_0020760
1060 Ga0496108_0061994
1061 Ga0496109_0020519
1062 Ga0496109_0247483
1063 Ga0496110_0035906
1064 Ga0496110_0105815
1065 Ga0496111_0016317
1066 Ga0496111_0060840
1067 Ga0496112_0017689
1068 Ga0496112_0046202
1069 Ga0496112_0470157
1070 Ga0496113_0001233
1071 Ga0496113_0015150
1072 Ga0496114_0012137
1073 Ga0496115_0001150
1074 Ga0496115_0036965
1075 Ga0501067_0034496
1076 Ga0501068_0233545
1077 Ga0501069_0098795
1078 Ga0501249_014558
1079 Ga0501079_0437338
1080 Ga0501080_0077277
1081 Ga0501272_001259
1082 nmdc:mga06r32_5039_c1
1083 nmdc:mga08y16_155181_c1
1084 nmdc:mga0a205_53466_c1
1085 Ga0590075_036304
1086 2885427766

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17676

Peptidase_S66C

LD-carboxypeptidase C-terminal domain

196

307

0.91

PF02016

Peptidase_S66

LD-carboxypeptidase N-terminal domain

40

157

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g23-assembly1.cif.gz_B crystal structure of a ld-carboxypeptidase a (saro_1426) from novosphingobium aromaticivorans dsm at 1.89 a resolution 0.959 2 270
3g23-assembly1.cif.gz_B crystal structure of a ld-carboxypeptidase a (saro_1426) from novosphingobium aromaticivorans dsm at 1.89 a resolution 0.9381 2 270
6uuk-assembly1.cif.gz_B crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes 0.8384 1 271
3sr3-assembly1.cif.gz_A crystal structure of the w180a mutant of microcin immunity protein mccf from bacillus anthracis shows the active site loop in the open conformation. 0.8313 2 269
1zl0-assembly2.cif.gz_B structure of protein of unknown function pa5198 from pseudomonas aeruginosa 0.8306 2 271
ID Description Score Start End Superfamily
3g23B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.9638 2 157 3.40.50.10740
3g23B02 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;LD-carboxypeptidase A C-terminal domain-like 0.9304 161 262 3.50.30.60
3g23B02 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;LD-carboxypeptidase A C-terminal domain-like 0.8952 161 262 3.50.30.60
3g23B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.8885 2 157 3.40.50.10740
1zrsA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.8807 2 125 3.40.50.10740
ID Description Score Start End GO Terms
AF-A0A354TU40-F1-model_v4 deleted 0.9887 162 268
AF-A0A3B9AYL7-F1-model_v4 deleted 0.9825 1 83
AF-A0A839Z270-F1-model_v4 Muramoyltetrapeptide carboxypeptidase (EC 3.4.17.13) 0.9822 1 270 GO:0004180
GO:0006508
GO:0008236
AF-A0A2D9X8E8-F1-model_v4 deleted 0.9806 1 111
AF-A0A1E4JDD5-F1-model_v4 LD-carboxypeptidase 0.9767 1 270 GO:0004180
GO:0006508
GO:0008236

Map