F461605

General Info

Members Datasets Scaffolds Average Seq Length
543 258 543 141

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10127896|Ga0075433_101278963
Length 172
Sequence MAQAITFYTLSAFILGFAIMVVSTKNTVHSVLFLVVNFLFVAALYVTLGAQFLAVIQILVYAGGIVVLYLFVVMLVNLKRPPEAHQDPHRMTRLGFGMAAAVLLELGMIAAYSATAPPTRPPVAATAAIPVSGNTEQVGWLLYTSYLIPFEIASMLLLVAMIGAIVLAKREL

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
159 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
160 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
165 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
171 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
193 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
194 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
210 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
254 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
255 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
256 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 5.89
Rhizosphere 93.37
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10003181 3300002459 Bacteria 3310
2 Ga0065712_10107098 3300005290 Bacteria 1892
3 Ga0065715_10264523 3300005293 Bacteria 1101
4 Ga0065715_10604915 3300005293 Bacteria 705
5 Ga0070676_10127053 3300005328 Bacteria 1608
6 Ga0070683_100092730 3300005329 Bacteria 2837
7 Ga0070690_100439114 3300005330 Bacteria 966
8 Ga0070670_100256084 3300005331 Bacteria 1525
9 Ga0070670_100590021 3300005331 Bacteria 994
10 Ga0068869_100237153 3300005334 Bacteria 1452
11 Ga0068869_100547186 3300005334 Bacteria 972
12 Ga0068869_100598900 3300005334 Bacteria 931
13 Ga0068869_100914677 3300005334 Bacteria 760
14 Ga0070666_10035550 3300005335 Bacteria 3304
15 Ga0070666_10113025 3300005335 Bacteria 1879
16 Ga0070666_10725120 3300005335 Bacteria 730
17 Ga0070680_100332431 3300005336 Bacteria 1291
18 Ga0070680_101156447 3300005336 Bacteria 669
19 Ga0070680_101223292 3300005336 Bacteria 650
20 Ga0070682_100668414 3300005337 Bacteria 829
21 Ga0068868_100183765 3300005338 Bacteria 1736
22 Ga0068868_100316879 3300005338 Bacteria 1328
23 Ga0068868_100358476 3300005338 Bacteria 1250
24 Ga0068868_100558594 3300005338 Bacteria 1010
25 Ga0068868_101210718 3300005338 Bacteria 699
26 Ga0070660_100009103 3300005339 Bacteria 6968
27 Ga0070660_100089402 3300005339 Bacteria 2426
28 Ga0070660_100281517 3300005339 Bacteria 1361
29 Ga0070687_100087190 3300005343 Bacteria 1717
30 Ga0070661_100081651 3300005344 Bacteria 2387
31 Ga0070692_10462865 3300005345 Bacteria 814
32 Ga0070668_100714119 3300005347 Bacteria 885
33 Ga0070675_100000896 3300005354 Bacteria 21182
34 Ga0070673_100021840 3300005364 Bacteria 4649
35 Ga0070673_100074095 3300005364 Bacteria 2742
36 Ga0070659_100594172 3300005366 Bacteria 951
37 Ga0070667_101064053 3300005367 Bacteria 756
38 Ga0070709_10182931 3300005434 Bacteria 1473
39 Ga0070709_10239361 3300005434 Bacteria 1303
40 Ga0070714_100006151 3300005435 Bacteria 9229
41 Ga0070713_100023631 3300005436 Bacteria 4774
42 Ga0070711_100290895 3300005439 Bacteria 1296
43 Ga0070705_100614482 3300005440 Bacteria 843
44 Ga0070705_100637798 3300005440 Bacteria 829
45 Ga0070700_100174780 3300005441 Bacteria 1490
46 Ga0070700_100586120 3300005441 Bacteria 871
47 Ga0070694_100146589 3300005444 Bacteria 1720
48 Ga0070694_100767138 3300005444 Bacteria 788
49 Ga0070708_100147914 3300005445 Bacteria 2183
50 Ga0070678_100459192 3300005456 Bacteria 1117
51 Ga0070662_100326341 3300005457 Bacteria 1253
52 Ga0070681_10001072 3300005458 Bacteria 23292
53 Ga0070681_10173967 3300005458 Bacteria 2075
54 Ga0070681_11003350 3300005458 Bacteria 755
55 Ga0068867_100107713 3300005459 Bacteria 2136
56 Ga0070706_100462233 3300005467 Bacteria 1181
57 Ga0070706_100539969 3300005467 Bacteria 1084
58 Ga0070707_100188117 3300005468 Bacteria 2013
59 Ga0070698_100690312 3300005471 Bacteria 963
60 Ga0070698_101225675 3300005471 Bacteria 700
61 Ga0070699_100190490 3300005518 Bacteria 1822
62 Ga0070679_100191850 3300005530 Bacteria 2012
63 Ga0070684_100859707 3300005535 Bacteria 849
64 Ga0070697_100044984 3300005536 Bacteria 3576
65 Ga0068853_100344066 3300005539 Bacteria 1386
66 Ga0070672_100200723 3300005543 Bacteria 1668
67 Ga0070686_100003673 3300005544 Bacteria 8426
68 Ga0070686_101202523 3300005544 Unclassified 630
69 Ga0070695_100052287 3300005545 Bacteria 2624
70 Ga0070695_100380768 3300005545 Bacteria 1065
71 Ga0070696_100042402 3300005546 Bacteria 3146
72 Ga0070696_100385540 3300005546 Bacteria 1093
73 Ga0070665_100045395 3300005548 Bacteria 4413
74 Ga0070665_100103394 3300005548 Bacteria 2851
75 Ga0070665_100427959 3300005548 Bacteria 1333
76 Ga0070704_100109082 3300005549 Bacteria 2103
77 Ga0070704_100275094 3300005549 Bacteria 1393
78 Ga0068855_100142552 3300005563 Bacteria 2730
79 Ga0068855_100454792 3300005563 Bacteria 1397
80 Ga0068855_100470338 3300005563 Bacteria 1369
81 Ga0070664_100357348 3300005564 Bacteria 1330
82 Ga0070664_100369754 3300005564 Bacteria 1307
83 Ga0070664_100575934 3300005564 Bacteria 1043
84 Ga0070664_100669546 3300005564 Bacteria 965
85 Ga0068857_100722002 3300005577 Bacteria 948
86 Ga0068857_100764389 3300005577 Bacteria 921
87 Ga0068854_100056641 3300005578 Bacteria 2826
88 Ga0068856_100824703 3300005614 Bacteria 947
89 Ga0070702_100195069 3300005615 Bacteria 1336
90 Ga0068852_100617370 3300005616 Bacteria 1090
91 Ga0068859_100243084 3300005617 Bacteria 1889
92 Ga0068859_100303885 3300005617 Bacteria 1689
93 Ga0068859_100343187 3300005617 Bacteria 1588
94 Ga0068859_100590821 3300005617 Bacteria 1204
95 Ga0068859_101802213 3300005617 Bacteria 676
96 Ga0068864_100004916 3300005618 Bacteria 10948
97 Ga0068864_100047073 3300005618 Bacteria 3702
98 Ga0068864_100107404 3300005618 Bacteria 2483
99 Ga0068866_10103331 3300005718 Bacteria 1576
100 Ga0068866_10254657 3300005718 Bacteria 1076
101 Ga0068851_10484545 3300005834 Bacteria 740
102 Ga0068863_100923722 3300005841 Bacteria 874
103 Ga0068858_100000616 3300005842 Bacteria 37281
104 Ga0068858_100125210 3300005842 Bacteria 2405
105 Ga0068858_100149427 3300005842 Bacteria 2196
106 Ga0068858_100454306 3300005842 Bacteria 1235
107 Ga0068860_100160046 3300005843 Bacteria 2171
108 Ga0068860_100240255 3300005843 Bacteria 1762
109 Ga0068860_100367210 3300005843 Bacteria 1419
110 Ga0068860_100426076 3300005843 Bacteria 1316
111 Ga0068860_100601573 3300005843 Bacteria 1105
112 Ga0068860_100765841 3300005843 Bacteria 977
113 Ga0068862_100460409 3300005844 Bacteria 1200
114 Ga0068862_100696995 3300005844 Bacteria 983
115 Ga0068862_101534483 3300005844 Bacteria 672
116 Ga0081455_10450736 3300005937 Bacteria 879
117 Ga0081539_10063795 3300005985 Bacteria 2008
118 Ga0097621_100002570 3300006237 Bacteria 12432
119 Ga0097621_100006615 3300006237 Bacteria 8233
120 Ga0097621_100028285 3300006237 Bacteria 4418
121 Ga0097621_100101968 3300006237 Bacteria 2416
122 Ga0097621_100133696 3300006237 Bacteria 2114
123 Ga0097621_100354397 3300006237 Bacteria 1306
124 Ga0097621_100424109 3300006237 Bacteria 1194
125 Ga0097621_100472189 3300006237 Bacteria 1133
126 Ga0068871_100000646 3300006358 Bacteria 23974
127 Ga0068871_100001797 3300006358 Bacteria 14469
128 Ga0068871_100302235 3300006358 Bacteria 1405
129 Ga0068871_100341428 3300006358 Bacteria 1323
130 Ga0068871_100547587 3300006358 Bacteria 1048
131 Ga0075428_100299607 3300006844 Bacteria 1728
132 Ga0075433_10080717 3300006852 Bacteria 2868
133 Ga0075433_10105351 3300006852 Bacteria 2499
134 Ga0075433_10127896 3300006852 Bacteria 2256
135 Ga0075433_10219286 3300006852 Bacteria 1690
136 Ga0075433_10270472 3300006852 Bacteria 1506
137 Ga0075433_10310118 3300006852 Bacteria 1397
138 Ga0075433_10970186 3300006852 Bacteria 741
139 Ga0075434_100007600 3300006871 Bacteria 10036
140 Ga0075434_100088908 3300006871 Bacteria 3091
141 Ga0075434_100917221 3300006871 Bacteria 891
142 Ga0075434_101032758 3300006871 Bacteria 836
143 Ga0075434_101035609 3300006871 Bacteria 834
144 Ga0068865_100004259 3300006881 Bacteria 8630
145 Ga0075436_100027834 3300006914 Bacteria 3891
146 Ga0075436_100123931 3300006914 Bacteria 1810
147 Ga0097620_100243086 3300006931 Bacteria 1889
148 Ga0097620_100303922 3300006931 Bacteria 1689
149 Ga0097620_100343198 3300006931 Bacteria 1588
150 Ga0097620_100590815 3300006931 Bacteria 1204
151 Ga0097620_101802273 3300006931 Bacteria 676
152 Ga0075435_100015544 3300007076 Bacteria 5725
153 Ga0075435_100088899 3300007076 Bacteria 2547
154 Ga0075435_100100490 3300007076 Bacteria 2396
155 Ga0075435_100452782 3300007076 Bacteria 1107
156 Ga0099794_10147261 3300007265 Bacteria 1194
157 Ga0099794_10395305 3300007265 Unclassified 722
158 Ga0099795_10204569 3300007788 Bacteria 834
159 Ga0105251_10071373 3300009011 Bacteria 1616
160 Ga0105240_10082662 3300009093 Bacteria 3943
161 Ga0105240_10262510 3300009093 Bacteria 1991
162 Ga0105240_10910413 3300009093 Bacteria 946
163 Ga0105240_11203398 3300009093 Bacteria 802
164 Ga0105240_11421528 3300009093 Bacteria 729
165 Ga0111539_10015763 3300009094 Bacteria 9389
166 Ga0111539_10142329 3300009094 Bacteria 2807
167 Ga0111539_10464620 3300009094 Bacteria 1474
168 Ga0105245_10047818 3300009098 Bacteria 3825
169 Ga0105245_10085933 3300009098 Bacteria 2884
170 Ga0105245_11503501 3300009098 Bacteria 724
171 Ga0105245_11539324 3300009098 Bacteria 716
172 Ga0105247_10036505 3300009101 Bacteria 2996
173 Ga0105247_10123252 3300009101 Bacteria 1682
174 Ga0114129_10001999 3300009147 Bacteria 27921
175 Ga0114129_10005981 3300009147 Bacteria 17235
176 Ga0114129_10186139 3300009147 Bacteria 2822
177 Ga0114129_10451071 3300009147 Bacteria 1687
178 Ga0114129_10531089 3300009147 Bacteria 1533
179 Ga0114129_11493074 3300009147 Bacteria 831
180 Ga0105243_11374216 3300009148 Bacteria 726
181 Ga0105243_11417417 3300009148 Bacteria 716
182 Ga0105243_11751665 3300009148 Bacteria 651
183 Ga0105241_10044194 3300009174 Bacteria 3375
184 Ga0105241_10893363 3300009174 Bacteria 825
185 Ga0105242_10068860 3300009176 Bacteria 2929
186 Ga0105242_10151075 3300009176 Bacteria 2025
187 Ga0105242_10307230 3300009176 Bacteria 1450
188 Ga0105242_10345463 3300009176 Bacteria 1373
189 Ga0105242_12111524 3300009176 Bacteria 607
190 Ga0105248_10016407 3300009177 Bacteria 8151
191 Ga0105248_10031932 3300009177 Bacteria 5884
192 Ga0105248_10229106 3300009177 Bacteria 2091
193 Ga0105248_10506691 3300009177 Bacteria 1361
194 Ga0105248_10705585 3300009177 Bacteria 1138
195 Ga0105248_10708477 3300009177 Bacteria 1136
196 Ga0105238_11251267 3300009551 Bacteria 767
197 Ga0105238_11356236 3300009551 Bacteria 738
198 Ga0105238_11876202 3300009551 Bacteria 632
199 Ga0105249_10664050 3300009553 Bacteria 1101
200 Ga0105249_11376049 3300009553 Bacteria 778
201 Ga0105246_10992200 3300011119 Bacteria 760
202 Ga0157369_10078224 3300013105 Bacteria 3544
203 Ga0157369_10382037 3300013105 Bacteria 1462
204 Ga0157374_10058135 3300013296 Bacteria 3613
205 Ga0157374_10215655 3300013296 Bacteria 1882
206 Ga0157374_10273161 3300013296 Bacteria 1667
207 Ga0157374_11060946 3300013296 Bacteria 830
208 Ga0157374_11725293 3300013296 Bacteria 651
209 Ga0157378_10116385 3300013297 Bacteria 2458
210 Ga0157378_11018405 3300013297 Bacteria 863
211 Ga0157378_11435345 3300013297 Bacteria 734
212 Ga0157378_11954373 3300013297 Bacteria 636
213 Ga0163162_10246188 3300013306 Bacteria 1919
214 Ga0163162_12392575 3300013306 Bacteria 607
215 Ga0157372_10445773 3300013307 Bacteria 1509
216 Ga0157372_11160957 3300013307 Bacteria 893
217 Ga0157375_10513020 3300013308 Bacteria 1362
218 Ga0157375_11149465 3300013308 Bacteria 910
219 Ga0157375_11326751 3300013308 Bacteria 846
220 Ga0157375_11857365 3300013308 Bacteria 715
221 Ga0157375_12551805 3300013308 Bacteria 610
222 Ga0157375_12658735 3300013308 Bacteria 598
223 Ga0163163_10048847 3300014325 Bacteria 4162
224 Ga0163163_10142132 3300014325 Bacteria 2443
225 Ga0163163_10624660 3300014325 Bacteria 1141
226 Ga0163163_11965393 3300014325 Unclassified 645
227 Ga0163163_12235161 3300014325 Bacteria 606
228 Ga0157380_10183410 3300014326 Bacteria 1841
229 Ga0157380_10410226 3300014326 Bacteria 1288
230 Ga0157380_11758832 3300014326 Bacteria 678
231 Ga0157377_10047247 3300014745 Bacteria 2411
232 Ga0157379_10053825 3300014968 Bacteria 3596
233 Ga0157379_10066745 3300014968 Bacteria 3217
234 Ga0157379_10998351 3300014968 Bacteria 798
235 Ga0157376_10069411 3300014969 Bacteria 2988
236 Ga0157376_10078451 3300014969 Bacteria 2828
237 Ga0157376_10116476 3300014969 Bacteria 2361
238 Ga0157376_10207918 3300014969 Bacteria 1805
239 Ga0157376_10351503 3300014969 Bacteria 1411
240 Ga0157376_11137234 3300014969 Unclassified 807
241 Ga0207713_1065883 3300025735 Bacteria 1358
242 Ga0207692_10489817 3300025898 Bacteria 779
243 Ga0207642_10227750 3300025899 Bacteria 1045
244 Ga0207710_10040087 3300025900 Bacteria 2075
245 Ga0207710_10372120 3300025900 Bacteria 730
246 Ga0207680_10303631 3300025903 Bacteria 1113
247 Ga0207647_10370174 3300025904 Bacteria 810
248 Ga0207685_10191501 3300025905 Bacteria 955
249 Ga0207699_10080846 3300025906 Bacteria 2014
250 Ga0207699_10237640 3300025906 Bacteria 1250
251 Ga0207645_10157686 3300025907 Bacteria 1484
252 Ga0207645_10369502 3300025907 Bacteria 961
253 Ga0207684_10732332 3300025910 Bacteria 839
254 Ga0207654_10013360 3300025911 Bacteria 4225
255 Ga0207654_10893419 3300025911 Bacteria 644
256 Ga0207707_10009543 3300025912 Bacteria 8418
257 Ga0207707_10160601 3300025912 Bacteria 1965
258 Ga0207695_10037196 3300025913 Bacteria 5253
259 Ga0207695_10403683 3300025913 Bacteria 1251
260 Ga0207671_10758482 3300025914 Bacteria 770
261 Ga0207663_10171619 3300025916 Bacteria 1541
262 Ga0207660_10036323 3300025917 Bacteria 3425
263 Ga0207662_10051310 3300025918 Bacteria 2454
264 Ga0207657_10026305 3300025919 Bacteria 5349
265 Ga0207649_10078192 3300025920 Bacteria 2134
266 Ga0207652_10206404 3300025921 Bacteria 1769
267 Ga0207652_10368096 3300025921 Bacteria 1297
268 Ga0207646_10115765 3300025922 Bacteria 2408
269 Ga0207646_10150426 3300025922 Bacteria 2099
270 Ga0207681_11163010 3300025923 Bacteria 648
271 Ga0207694_10446002 3300025924 Bacteria 1080
272 Ga0207650_10197821 3300025925 Bacteria 1609
273 Ga0207650_10210562 3300025925 Bacteria 1561
274 Ga0207659_10031788 3300025926 Bacteria 3617
275 Ga0207659_10102343 3300025926 Bacteria 2162
276 Ga0207659_11229077 3300025926 Bacteria 644
277 Ga0207687_10085267 3300025927 Bacteria 2291
278 Ga0207687_10111941 3300025927 Bacteria 2028
279 Ga0207687_10826371 3300025927 Bacteria 791
280 Ga0207700_10007165 3300025928 Bacteria 6798
281 Ga0207700_10272264 3300025928 Bacteria 1454
282 Ga0207706_10060479 3300025933 Bacteria 3336
283 Ga0207706_10269334 3300025933 Bacteria 1486
284 Ga0207686_10063902 3300025934 Bacteria 2342
285 Ga0207686_10213263 3300025934 Bacteria 1389
286 Ga0207709_10732520 3300025935 Bacteria 793
287 Ga0207670_10740778 3300025936 Bacteria 816
288 Ga0207704_10035796 3300025938 Bacteria 2849
289 Ga0207704_10180427 3300025938 Bacteria 1525
290 Ga0207704_10457631 3300025938 Bacteria 1020
291 Ga0207704_10469540 3300025938 Bacteria 1008
292 Ga0207665_10044879 3300025939 Bacteria 2958
293 Ga0207665_10800565 3300025939 Bacteria 745
294 Ga0207691_10100271 3300025940 Bacteria 2585
295 Ga0207711_10027108 3300025941 Bacteria 4811
296 Ga0207711_10149340 3300025941 Bacteria 2108
297 Ga0207711_10745157 3300025941 Bacteria 913
298 Ga0207711_10749040 3300025941 Bacteria 911
299 Ga0207689_10160699 3300025942 Bacteria 1851
300 Ga0207661_10021400 3300025944 Bacteria 4845
301 Ga0207661_10396246 3300025944 Bacteria 1251
302 Ga0207661_11090445 3300025944 Bacteria 735
303 Ga0207679_10255881 3300025945 Bacteria 1491
304 Ga0207667_10123461 3300025949 Bacteria 2668
305 Ga0207667_10761227 3300025949 Bacteria 967
306 Ga0207651_10034563 3300025960 Bacteria 3275
307 Ga0207651_10349678 3300025960 Bacteria 1244
308 Ga0207651_10512959 3300025960 Bacteria 1038
309 Ga0207651_11200802 3300025960 Bacteria 681
310 Ga0207640_10140916 3300025981 Bacteria 1757
311 Ga0207640_11215094 3300025981 Bacteria 671
312 Ga0207640_11574035 3300025981 Bacteria 592
313 Ga0207658_11638870 3300025986 Bacteria 588
314 Ga0207677_10032271 3300026023 Bacteria 3364
315 Ga0207677_10096519 3300026023 Bacteria 2163
316 Ga0207677_10370497 3300026023 Bacteria 1206
317 Ga0207677_10476634 3300026023 Bacteria 1074
318 Ga0207703_10026766 3300026035 Bacteria 4543
319 Ga0207703_10049464 3300026035 Bacteria 3399
320 Ga0207703_10075185 3300026035 Bacteria 2799
321 Ga0207703_10084869 3300026035 Bacteria 2649
322 Ga0207703_10431130 3300026035 Bacteria 1228
323 Ga0207703_10782940 3300026035 Bacteria 910
324 Ga0207639_10210074 3300026041 Bacteria 1675
325 Ga0207708_10276788 3300026075 Bacteria 1359
326 Ga0207702_10057395 3300026078 Bacteria 3308
327 Ga0207702_10616720 3300026078 Bacteria 1065
328 Ga0207702_10980140 3300026078 Bacteria 838
329 Ga0207641_10240936 3300026088 Bacteria 1685
330 Ga0207641_10438327 3300026088 Bacteria 1261
331 Ga0207648_11101923 3300026089 Bacteria 745
332 Ga0207648_11487654 3300026089 Bacteria 636
333 Ga0207676_10004611 3300026095 Bacteria 9760
334 Ga0207676_10184563 3300026095 Bacteria 1829
335 Ga0207676_10271713 3300026095 Bacteria 1535
336 Ga0207676_10772485 3300026095 Bacteria 936
337 Ga0207674_10352914 3300026116 Bacteria 1422
338 Ga0207674_10646809 3300026116 Bacteria 1021
339 Ga0207675_100426708 3300026118 Bacteria 1310
340 Ga0207675_100518386 3300026118 Bacteria 1188
341 Ga0207675_100660198 3300026118 Bacteria 1052
342 Ga0207675_101069621 3300026118 Bacteria 826
343 Ga0207683_10495479 3300026121 Bacteria 1128
344 Ga0207698_10566382 3300026142 Bacteria 1116
345 Ga0207428_10237312 3300027907 Bacteria 1363
346 Ga0268266_10011538 3300028379 Bacteria 7673
347 Ga0268266_10073230 3300028379 Bacteria 2972
348 Ga0268266_10156027 3300028379 Bacteria 2061
349 Ga0268266_10633799 3300028379 Bacteria 1028
350 Ga0268265_10169863 3300028380 Bacteria 1862
351 Ga0268265_10350060 3300028380 Bacteria 1349
352 Ga0268264_10068584 3300028381 Bacteria 2997
353 Ga0268264_10224471 3300028381 Bacteria 1731
354 Ga0268264_10311706 3300028381 Bacteria 1485
355 Ga0268264_10734404 3300028381 Bacteria 983
356 Ga0268264_11211509 3300028381 Bacteria 764
357 Ga0307517_10409676 3300028786 Bacteria 715
358 Ga0307511_10189348 3300030521 Bacteria 1091
359 Ga0265332_10029724 3300031238 Bacteria 2388
360 Ga0265314_10020461 3300031711 Bacteria 5108
361 Ga0307416_100074392 3300032002 Bacteria 2838
362 Ga0307411_10913830 3300032005 Bacteria 781
363 Ga0373934_0154710 3300035086 Bacteria 940
364 Ga0373923_0086914 3300035111 Bacteria 1363
365 Ga0373939_0133912 3300035114 Bacteria 887
366 Ga0373945_0131270 3300035116 Bacteria 1004
367 Ga0373953_0163261 3300035117 Bacteria 958
368 Ga0373954_0384351 3300035118 Bacteria 694
369 Ga0373956_0431409 3300035119 Bacteria 629
370 Ga0373957_0138003 3300035120 Bacteria 996
371 Ga0373943_0268606 3300035170 Bacteria 962
372 Ga0373943_0421959 3300035170 Bacteria 772
373 Ga0373946_0097462 3300035171 Bacteria 1313
374 Ga0373955_0024973 3300035172 Bacteria 3063
375 Ga0373955_0407677 3300035172 Bacteria 826
376 Ga0373931_0075790 3300035691 Bacteria 1846
377 Ga0373935_0269638 3300035692 Bacteria 1196
378 Ga0373935_0944348 3300035692 Bacteria 640
379 Ga0373927_0387615 3300035695 Bacteria 922
380 Ga0373933_0019021 3300035724 Bacteria 3872
381 Ga0373947_0218440 3300035725 Bacteria 1252
382 Ga0373937_0097668 3300036401 Bacteria 2725
383 Ga0373937_0128345 3300036401 Bacteria 2367
384 Ga0373937_0195383 3300036401 Bacteria 1902
385 Ga0373925_0538456 3300037068 Bacteria 960
386 Ga0373925_0614542 3300037068 Bacteria 895
387 Ga0451577_0433040 3300042876 Bacteria 1194
388 Ga0466963_0139462 3300044694 Bacteria 1679
389 Ga0466963_0350035 3300044694 Bacteria 1040
390 Ga0453684_0625784 3300044712 Bacteria 1177
391 Ga0453684_1217003 3300044712 Bacteria 790
392 Ga0451576_0108274 3300045051 Bacteria 2892
393 Ga0451576_0289767 3300045051 Bacteria 1712
394 Ga0466958_0268450 3300045836 Bacteria 1093
395 Ga0466967_0806126 3300045976 Bacteria 932
396 Ga0466967_0837221 3300045976 Bacteria 914
397 Ga0495603_0196964 3300046455 Bacteria 1164
398 Ga0495629_0318280 3300046459 Bacteria 1064
399 Ga0495629_0814114 3300046459 Bacteria 616
400 Ga0495651_0424771 3300046462 Bacteria 863
401 Ga0495582_0150531 3300046473 Bacteria 1321
402 Ga0495582_0252664 3300046473 Bacteria 1011
403 Ga0495639_0074664 3300046475 Bacteria 1571
404 Ga0495639_0385526 3300046475 Bacteria 707
405 Ga0495664_0445734 3300046477 Bacteria 775
406 Ga0495584_0419236 3300046491 Bacteria 681
407 Ga0495594_0615141 3300046499 Bacteria 616
408 Ga0495608_0010011 3300046511 Bacteria 6615
409 Ga0495608_0214042 3300046511 Bacteria 1211
410 Ga0495628_0460164 3300046516 Bacteria 923
411 Ga0495628_0835776 3300046516 Bacteria 642
412 Ga0495630_0003709 3300046517 Bacteria 10654
413 Ga0495630_0139377 3300046517 Bacteria 1844
414 Ga0495652_0473264 3300046529 Bacteria 873
415 Ga0495652_0777503 3300046529 Bacteria 639
416 Ga0495665_0495926 3300046531 Bacteria 615
417 Ga0495640_0472321 3300046533 Bacteria 765
418 Ga0495640_0512082 3300046533 Unclassified 730
419 Ga0495586_0193169 3300046535 Bacteria 1153
420 Ga0495587_0071516 3300046536 Bacteria 2018
421 Ga0495645_0008004 3300046543 Bacteria 7359
422 Ga0495645_0229428 3300046543 Bacteria 1244
423 Ga0495645_0402550 3300046543 Bacteria 872
424 Ga0495667_0077679 3300046559 Bacteria 2159
425 Ga0495667_0446528 3300046559 Bacteria 813
426 Ga0495635_0214694 3300046663 Bacteria 1302
427 Ga0495635_0383813 3300046663 Bacteria 935
428 Ga0495659_0100578 3300046664 Bacteria 1119
429 Ga0495659_0207428 3300046664 Bacteria 805
430 Ga0495599_0525663 3300046678 Bacteria 694
431 Ga0495623_0163839 3300046679 Bacteria 1305
432 Ga0495623_0281170 3300046679 Bacteria 926
433 Ga0495647_0155083 3300046681 Bacteria 984
434 Ga0495647_0209262 3300046681 Bacteria 858
435 Ga0495647_0348604 3300046681 Bacteria 674
436 Ga0495658_0029587 3300046683 Bacteria 2968
437 Ga0495658_0044725 3300046683 Bacteria 2482
438 Ga0495658_0104943 3300046683 Bacteria 1692
439 Ga0495658_0184797 3300046683 Bacteria 1294
440 Ga0495669_0127254 3300046684 Bacteria 1198
441 Ga0495669_0131550 3300046684 Bacteria 1178
442 Ga0495669_0529110 3300046684 Unclassified 573
443 Ga0495613_0011581 3300046689 Bacteria 6555
444 Ga0495670_0076215 3300046691 Bacteria 1704
445 Ga0495674_0011153 3300047319 Bacteria 8486
446 Ga0495674_0142769 3300047319 Bacteria 2012
447 Ga0495674_0248830 3300047319 Bacteria 1463
448 Ga0495674_0470023 3300047319 Bacteria 1009
449 Ga0495672_0059255 3300047320 Bacteria 2216
450 Ga0495680_0833928 3300047322 Bacteria 600
451 Ga0495684_0000048 3300047471 Bacteria 89243
452 Ga0495684_0168582 3300047471 Bacteria 1630
453 Ga0495684_0287821 3300047471 Bacteria 1184
454 Ga0495684_0592070 3300047471 Bacteria 749
455 Ga0495614_0391808 3300048089 Bacteria 652
456 Ga0496100_0008235 3300048903 Bacteria 5808
457 Ga0496101_0001786 3300048904 Bacteria 12936
458 Ga0496102_0034436 3300048905 Bacteria 4555
459 Ga0496102_0039204 3300048905 Bacteria 4280
460 Ga0496102_0103946 3300048905 Bacteria 2642
461 Ga0496103_0133514 3300048906 Bacteria 1586
462 Ga0496104_0020785 3300048907 Bacteria 6020
463 Ga0496104_0098756 3300048907 Bacteria 2795
464 Ga0496104_1126179 3300048907 Bacteria 688
465 Ga0496105_0205993 3300048908 Bacteria 1604
466 Ga0496105_0403564 3300048908 Bacteria 1085
467 Ga0496105_0945561 3300048908 Bacteria 647
468 Ga0496108_0113727 3300048911 Bacteria 2316
469 Ga0496108_0567024 3300048911 Bacteria 990
470 Ga0496108_0728112 3300048911 Bacteria 859
471 Ga0496108_1003919 3300048911 Bacteria 713
472 Ga0496109_0228636 3300048912 Bacteria 1750
473 Ga0496109_0749045 3300048912 Bacteria 915
474 Ga0496109_0754149 3300048912 Bacteria 911
475 Ga0496109_1310453 3300048912 Bacteria 660
476 Ga0496110_0048614 3300048913 Bacteria 3719
477 Ga0496112_0011751 3300048915 Bacteria 8016
478 Ga0496112_0245448 3300048915 Bacteria 1742
479 Ga0496112_1368255 3300048915 Bacteria 623
480 Ga0496112_1486392 3300048915 Bacteria 591
481 Ga0496113_0414743 3300048916 Bacteria 1081
482 Ga0496114_0000405 3300048917 Bacteria 31894
483 Ga0496114_0095008 3300048917 Bacteria 2536
484 Ga0496114_0121047 3300048917 Bacteria 2251
485 Ga0496114_0184320 3300048917 Bacteria 1824
486 Ga0496114_0412633 3300048917 Bacteria 1196
487 Ga0496115_0388982 3300048918 Bacteria 1133
488 Ga0501038_0747451 3300049574 Bacteria 730
489 Ga0501041_0774361 3300049577 Bacteria 615
490 Ga0501048_0182579 3300049582 Bacteria 1487
491 Ga0501071_0096668 3300049587 Bacteria 2174
492 Ga0501075_0205616 3300049591 Bacteria 1502
493 Ga0501076_0486213 3300049592 Bacteria 1017
494 Ga0501077_0480827 3300049593 Bacteria 796
495 Ga0501080_0492819 3300049742 Bacteria 1096
496 Ga0501080_0998606 3300049742 Bacteria 726
497 Ga0501083_0541880 3300049744 Bacteria 757
498 Ga0501035_0471196 3300049822 Bacteria 1037
499 Ga0501045_0590598 3300049824 Bacteria 823
500 nmdc:mga05p37_1210994_c1 3300050507 Bacteria 779
501 nmdc:mga05p37_1267569_c1 3300050507 Bacteria 755
502 nmdc:mga05p37_20945_c1 3300050507 Bacteria 7914
503 nmdc:mga05p37_21894_c1 3300050507 Bacteria 7745
504 nmdc:mga05p37_369172_c1 3300050507 Bacteria 1685
505 nmdc:mga05p37_494331_c1 3300050507 Bacteria 1406
506 nmdc:mga05p37_82386_c1 3300050507 Bacteria 3964
507 nmdc:mga09592_118486_c1 3300050508 Bacteria 2272
508 nmdc:mga06r32_149641_c1 3300050510 Bacteria 2312
509 nmdc:mga08y16_37472_c1 3300050511 Bacteria 5092
510 nmdc:mga08y16_406965_c1 3300050511 Bacteria 1392
511 nmdc:mga08y16_91889_c1 3300050511 Bacteria 3163
512 nmdc:mga0n895_1296248_c1 3300050512 Bacteria 699
513 nmdc:mga0n895_1435480_c1 3300050512 Bacteria 658
514 nmdc:mga0n895_315541_c1 3300050512 Bacteria 1584
515 nmdc:mga0n895_31706_c1 3300050512 Bacteria 5064
516 nmdc:mga0n895_384522_c1 3300050512 Bacteria 1420
517 nmdc:mga0n895_454964_c1 3300050512 Bacteria 1292
518 nmdc:mga0n895_72501_c1 3300050512 Bacteria 3417
519 nmdc:mga0rr50_561_c1 3300050513 Bacteria 19928
520 nmdc:mga08x19_239976_c1 3300050514 Bacteria 1249
521 nmdc:mga08x19_86247_c1 3300050514 Bacteria 2067
522 nmdc:mga0a205_1073831_c1 3300050515 Bacteria 652
523 nmdc:mga0a205_271681_c1 3300050515 Bacteria 1572
524 nmdc:mga0a205_393036_c1 3300050515 Bacteria 1251
525 nmdc:mga0a205_439270_c1 3300050515 Bacteria 1166
526 nmdc:mga0a205_500043_c1 3300050515 Bacteria 1073
527 nmdc:mga0a205_50087_c1 3300050515 Bacteria 4032
528 nmdc:mga0a205_74030_c1 3300050515 Bacteria 3290
529 Ga0495601_0127601 3300053077 Bacteria 1655
530 Ga0495601_0207447 3300053077 Bacteria 1280
531 Ga0495601_0309141 3300053077 Bacteria 1029
532 Ga0495601_0651164 3300053077 Bacteria 674
533 Ga0495595_0024150 3300053084 Bacteria 2683
534 Ga0495595_0222053 3300053084 Bacteria 943
535 Ga0495619_0004485 3300053085 Bacteria 8916
536 Ga0495619_0023416 3300053085 Bacteria 3959
537 Ga0495619_0058147 3300053085 Bacteria 2566
538 Ga0500566_0170413 3300053094 Bacteria 1126
539 Ga0500658_0045468 3300053134 Bacteria 1775
540 Ga0501084_0123822 3300054114 Bacteria 2174
541 Ga0501084_0413305 3300054114 Bacteria 1140
542 Ga0501082_0263664 3300060353 Bacteria 1499
543 Ga0501082_0369146 3300060353 Bacteria 1252

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048908 Ga0496105_0945561 Ga0496105_0945561_12_386 100
2 3300050512 nmdc:mga0n895_31706_c1 nmdc:mga0n895_31706_c1_29_451 107
3 3300035119 Ga0373956_0431409 Ga0373956_0431409_12_443 114
4 3300005339 Ga0070660_100281517 Ga0070660_1002815171 116
5 3300005339 Ga0070660_100009103 Ga0070660_1000091036 119
6 3300009093 Ga0105240_11203398 Ga0105240_112033981 119
7 3300025904 Ga0207647_10370174 Ga0207647_103701742 119
8 3300026078 Ga0207702_10616720 Ga0207702_106167201 119
9 3300005330 Ga0070690_100439114 Ga0070690_1004391142 120
10 3300005335 Ga0070666_10035550 Ga0070666_100355503 120
11 3300005343 Ga0070687_100087190 Ga0070687_1000871902 120
12 3300005366 Ga0070659_100594172 Ga0070659_1005941722 120
13 3300005457 Ga0070662_100326341 Ga0070662_1003263412 120
14 3300005544 Ga0070686_100003673 Ga0070686_1000036734 120
15 3300005563 Ga0068855_100454792 Ga0068855_1004547923 120
16 3300005616 Ga0068852_100617370 Ga0068852_1006173702 120
17 3300005843 Ga0068860_100765841 Ga0068860_1007658412 120
18 3300009174 Ga0105241_10044194 Ga0105241_100441943 120
19 3300025911 Ga0207654_10013360 Ga0207654_100133603 120
20 3300025913 Ga0207695_10403683 Ga0207695_104036832 120
21 3300025918 Ga0207662_10051310 Ga0207662_100513102 120
22 3300025933 Ga0207706_10269334 Ga0207706_102693342 120
23 3300026118 Ga0207675_101069621 Ga0207675_1010696212 120
24 3300028381 Ga0268264_10224471 Ga0268264_102244713 120
25 3300046473 Ga0495582_0150531 Ga0495582_0150531_17_391 120
26 3300048905 Ga0496102_0103946 Ga0496102_0103946_1729_2247 120
27 3300048906 Ga0496103_0133514 Ga0496103_0133514_233_751 120
28 3300005563 Ga0068855_100470338 Ga0068855_1004703382 121
29 3300013306 Ga0163162_12392575 Ga0163162_123925751 121
30 3300025919 Ga0207657_10026305 Ga0207657_100263051 121
31 3300025921 Ga0207652_10206404 Ga0207652_102064042 121
32 3300025949 Ga0207667_10761227 Ga0207667_107612271 121
33 3300025939 Ga0207665_10800565 Ga0207665_108005651 122
34 3300005336 Ga0070680_100332431 Ga0070680_1003324312 125
35 3300005458 Ga0070681_10173967 Ga0070681_101739673 125
36 3300013296 Ga0157374_11725293 Ga0157374_117252932 125
37 3300025912 Ga0207707_10160601 Ga0207707_101606011 125
38 3300007788 Ga0099795_10204569 Ga0099795_102045691 128
39 3300014326 Ga0157380_11758832 Ga0157380_117588322 129
40 3300031711 Ga0265314_10020461 Ga0265314_100204612 133
41 3300049577 Ga0501041_0774361 Ga0501041_0774361_47_559 133
42 3300049742 Ga0501080_0492819 Ga0501080_0492819_190_702 133
43 3300054114 Ga0501084_0413305 Ga0501084_0413305_218_730 133
44 3300060353 Ga0501082_0263664 Ga0501082_0263664_313_825 133
45 3300005334 Ga0068869_100598900 Ga0068869_1005989002 134
46 3300006852 Ga0075433_10219286 Ga0075433_102192862 134
47 3300006871 Ga0075434_100007600 Ga0075434_1000076004 134
48 3300006914 Ga0075436_100027834 Ga0075436_1000278344 134
49 3300007076 Ga0075435_100015544 Ga0075435_1000155443 134
50 3300009147 Ga0114129_10451071 Ga0114129_104510712 134
51 3300013308 Ga0157375_12658735 Ga0157375_126587351 134
52 3300025925 Ga0207650_10197821 Ga0207650_101978212 134
53 3300025942 Ga0207689_10160699 Ga0207689_101606992 134
54 3300025986 Ga0207658_11638870 Ga0207658_116388701 134
55 3300050507 nmdc:mga05p37_494331_c1 nmdc:mga05p37_494331_c1_880_1392 134
56 3300050513 nmdc:mga0rr50_561_c1 nmdc:mga0rr50_561_c1_6414_6926 134
57 3300050514 nmdc:mga08x19_86247_c1 nmdc:mga08x19_86247_c1_1025_1537 134
58 3300050515 nmdc:mga0a205_393036_c1 nmdc:mga0a205_393036_c1_88_600 134
59 3300005467 Ga0070706_100539969 Ga0070706_1005399692 135
60 3300007076 Ga0075435_100452782 Ga0075435_1004527823 135
61 3300025910 Ga0207684_10732332 Ga0207684_107323322 135
62 3300032005 Ga0307411_10913830 Ga0307411_109138302 135
63 3300035692 Ga0373935_0944348 Ga0373935_0944348_55_579 135
64 3300005564 Ga0070664_100669546 Ga0070664_1006695462 137
65 3300005842 Ga0068858_100454306 Ga0068858_1004543062 137
66 3300009101 Ga0105247_10123252 Ga0105247_101232523 137
67 3300014968 Ga0157379_10053825 Ga0157379_100538254 137
68 3300026035 Ga0207703_10084869 Ga0207703_100848692 137
69 3300026089 Ga0207648_11101923 Ga0207648_111019232 137
70 3300031238 Ga0265332_10029724 Ga0265332_100297242 137
71 3300045976 Ga0466967_0806126 Ga0466967_0806126_235_747 137
72 3300048905 Ga0496102_0034436 Ga0496102_0034436_548_1060 137
73 3300048911 Ga0496108_0567024 Ga0496108_0567024_229_741 137
74 3300048912 Ga0496109_0754149 Ga0496109_0754149_328_840 137
75 3300049574 Ga0501038_0747451 Ga0501038_0747451_191_712 137
76 3300049582 Ga0501048_0182579 Ga0501048_0182579_450_971 137
77 3300049587 Ga0501071_0096668 Ga0501071_0096668_1071_1592 137
78 3300049591 Ga0501075_0205616 Ga0501075_0205616_367_888 137
79 3300049592 Ga0501076_0486213 Ga0501076_0486213_385_906 137
80 3300049593 Ga0501077_0480827 Ga0501077_0480827_183_704 137
81 3300049742 Ga0501080_0998606 Ga0501080_0998606_136_657 137
82 3300049822 Ga0501035_0471196 Ga0501035_0471196_479_1000 137
83 3300049824 Ga0501045_0590598 Ga0501045_0590598_76_597 137
84 3300060353 Ga0501082_0369146 Ga0501082_0369146_135_656 137
85 3300005290 Ga0065712_10107098 Ga0065712_101070982 138
86 3300005338 Ga0068868_100558594 Ga0068868_1005585941 138
87 3300005347 Ga0070668_100714119 Ga0070668_1007141191 138
88 3300005535 Ga0070684_100859707 Ga0070684_1008597072 138
89 3300005564 Ga0070664_100575934 Ga0070664_1005759342 138
90 3300006237 Ga0097621_100101968 Ga0097621_1001019682 138
91 3300006358 Ga0068871_100302235 Ga0068871_1003022352 138
92 3300009148 Ga0105243_11417417 Ga0105243_114174171 138
93 3300009176 Ga0105242_12111524 Ga0105242_121115241 138
94 3300009177 Ga0105248_10016407 Ga0105248_100164078 138
95 3300013308 Ga0157375_11857365 Ga0157375_118573652 138
96 3300014968 Ga0157379_10998351 Ga0157379_109983512 138
97 3300025938 Ga0207704_10469540 Ga0207704_104695402 138
98 3300026089 Ga0207648_11487654 Ga0207648_114876542 138
99 3300026118 Ga0207675_100426708 Ga0207675_1004267082 138
100 3300045051 Ga0451576_0108274 Ga0451576_0108274_2244_2759 138
101 3300048908 Ga0496105_0403564 Ga0496105_0403564_116_628 138
102 3300049744 Ga0501083_0541880 Ga0501083_0541880_35_553 138
103 3300054114 Ga0501084_0123822 Ga0501084_0123822_1545_2054 138
104 3300005329 Ga0070683_100092730 Ga0070683_1000927303 139
105 3300005335 Ga0070666_10113025 Ga0070666_101130253 139
106 3300005458 Ga0070681_11003350 Ga0070681_110033502 139
107 3300005617 Ga0068859_100343187 Ga0068859_1003431872 139
108 3300005618 Ga0068864_100107404 Ga0068864_1001074042 139
109 3300005843 Ga0068860_100240255 Ga0068860_1002402553 139
110 3300005843 Ga0068860_100601573 Ga0068860_1006015732 139
111 3300005937 Ga0081455_10450736 Ga0081455_104507362 139
112 3300006237 Ga0097621_100002570 Ga0097621_1000025708 139
113 3300006237 Ga0097621_100006615 Ga0097621_1000066155 139
114 3300006237 Ga0097621_100133696 Ga0097621_1001336962 139
115 3300006358 Ga0068871_100001797 Ga0068871_1000017975 139
116 3300006358 Ga0068871_100341428 Ga0068871_1003414282 139
117 3300006844 Ga0075428_100299607 Ga0075428_1002996072 139
118 3300006852 Ga0075433_10310118 Ga0075433_103101182 139
119 3300006852 Ga0075433_10970186 Ga0075433_109701862 139
120 3300006931 Ga0097620_100343198 Ga0097620_1003431982 139
121 3300009094 Ga0111539_10142329 Ga0111539_101423292 139
122 3300009176 Ga0105242_10345463 Ga0105242_103454631 139
123 3300009177 Ga0105248_10031932 Ga0105248_100319324 139
124 3300013105 Ga0157369_10382037 Ga0157369_103820372 139
125 3300013296 Ga0157374_10273161 Ga0157374_102731612 139
126 3300013307 Ga0157372_11160957 Ga0157372_111609571 139
127 3300013308 Ga0157375_10513020 Ga0157375_105130201 139
128 3300014969 Ga0157376_10116476 Ga0157376_101164762 139
129 3300014969 Ga0157376_11137234 Ga0157376_111372343 139
130 3300025941 Ga0207711_10149340 Ga0207711_101493402 139
131 3300025944 Ga0207661_10021400 Ga0207661_100214004 139
132 3300025944 Ga0207661_11090445 Ga0207661_110904452 139
133 3300025960 Ga0207651_10512959 Ga0207651_105129592 139
134 3300026095 Ga0207676_10271713 Ga0207676_102717132 139
135 3300026142 Ga0207698_10566382 Ga0207698_105663822 139
136 3300028381 Ga0268264_10311706 Ga0268264_103117062 139
137 3300035086 Ga0373934_0154710 Ga0373934_0154710_213_725 139
138 3300035170 Ga0373943_0268606 Ga0373943_0268606_94_606 139
139 3300035172 Ga0373955_0024973 Ga0373955_0024973_2530_3039 139
140 3300037068 Ga0373925_0614542 Ga0373925_0614542_217_726 139
141 3300042876 Ga0451577_0433040 Ga0451577_0433040_586_1095 139
142 3300044694 Ga0466963_0139462 Ga0466963_0139462_591_1106 139
143 3300044694 Ga0466963_0350035 Ga0466963_0350035_473_982 139
144 3300044712 Ga0453684_0625784 Ga0453684_0625784_480_989 139
145 3300044712 Ga0453684_1217003 Ga0453684_1217003_207_725 139
146 3300046459 Ga0495629_0318280 Ga0495629_0318280_88_597 139
147 3300046459 Ga0495629_0814114 Ga0495629_0814114_48_569 139
148 3300046473 Ga0495582_0252664 Ga0495582_0252664_357_866 139
149 3300046475 Ga0495639_0074664 Ga0495639_0074664_151_666 139
150 3300046477 Ga0495664_0445734 Ga0495664_0445734_21_533 139
151 3300046517 Ga0495630_0139377 Ga0495630_0139377_660_1172 139
152 3300046533 Ga0495640_0472321 Ga0495640_0472321_217_726 139
153 3300046535 Ga0495586_0193169 Ga0495586_0193169_214_726 139
154 3300046543 Ga0495645_0402550 Ga0495645_0402550_229_741 139
155 3300046559 Ga0495667_0446528 Ga0495667_0446528_49_561 139
156 3300046681 Ga0495647_0209262 Ga0495647_0209262_285_797 139
157 3300046681 Ga0495647_0348604 Ga0495647_0348604_79_594 139
158 3300046683 Ga0495658_0044725 Ga0495658_0044725_1062_1574 139
159 3300046684 Ga0495669_0529110 Ga0495669_0529110_28_540 139
160 3300047319 Ga0495674_0248830 Ga0495674_0248830_866_1387 139
161 3300047319 Ga0495674_0470023 Ga0495674_0470023_463_975 139
162 3300047322 Ga0495680_0833928 Ga0495680_0833928_47_559 139
163 3300047471 Ga0495684_0168582 Ga0495684_0168582_1027_1539 139
164 3300048089 Ga0495614_0391808 Ga0495614_0391808_102_614 139
165 3300048903 Ga0496100_0008235 Ga0496100_0008235_240_749 139
166 3300048904 Ga0496101_0001786 Ga0496101_0001786_7276_7785 139
167 3300048905 Ga0496102_0039204 Ga0496102_0039204_1031_1540 139
168 3300048907 Ga0496104_0020785 Ga0496104_0020785_67_576 139
169 3300048908 Ga0496105_0205993 Ga0496105_0205993_914_1423 139
170 3300048917 Ga0496114_0000405 Ga0496114_0000405_11986_12495 139
171 3300048917 Ga0496114_0095008 Ga0496114_0095008_1278_1790 139
172 3300050507 nmdc:mga05p37_1210994_c1 nmdc:mga05p37_1210994_c1_122_634 139
173 3300050507 nmdc:mga05p37_21894_c1 nmdc:mga05p37_21894_c1_6133_6651 139
174 3300050510 nmdc:mga06r32_149641_c1 nmdc:mga06r32_149641_c1_190_702 139
175 3300050511 nmdc:mga08y16_91889_c1 nmdc:mga08y16_91889_c1_344_856 139
176 3300050515 nmdc:mga0a205_271681_c1 nmdc:mga0a205_271681_c1_1021_1533 139
177 3300050515 nmdc:mga0a205_74030_c1 nmdc:mga0a205_74030_c1_512_1030 139
178 3300053084 Ga0495595_0222053 Ga0495595_0222053_41_550 139
179 3300005331 Ga0070670_100590021 Ga0070670_1005900211 140
180 3300005335 Ga0070666_10725120 Ga0070666_107251201 140
181 3300005336 Ga0070680_101156447 Ga0070680_1011564471 140
182 3300005336 Ga0070680_101223292 Ga0070680_1012232921 140
183 3300005338 Ga0068868_100183765 Ga0068868_1001837651 140
184 3300005338 Ga0068868_101210718 Ga0068868_1012107181 140
185 3300005367 Ga0070667_101064053 Ga0070667_1010640532 140
186 3300005440 Ga0070705_100637798 Ga0070705_1006377982 140
187 3300005441 Ga0070700_100586120 Ga0070700_1005861202 140
188 3300005444 Ga0070694_100146589 Ga0070694_1001465893 140
189 3300005444 Ga0070694_100767138 Ga0070694_1007671381 140
190 3300005467 Ga0070706_100462233 Ga0070706_1004622332 140
191 3300005471 Ga0070698_100690312 Ga0070698_1006903122 140
192 3300005471 Ga0070698_101225675 Ga0070698_1012256751 140
193 3300005536 Ga0070697_100044984 Ga0070697_1000449844 140
194 3300005543 Ga0070672_100200723 Ga0070672_1002007232 140
195 3300005545 Ga0070695_100052287 Ga0070695_1000522873 140
196 3300005546 Ga0070696_100042402 Ga0070696_1000424023 140
197 3300005546 Ga0070696_100385540 Ga0070696_1003855401 140
198 3300005548 Ga0070665_100045395 Ga0070665_1000453954 140
199 3300005548 Ga0070665_100103394 Ga0070665_1001033944 140
200 3300005548 Ga0070665_100427959 Ga0070665_1004279592 140
201 3300005549 Ga0070704_100275094 Ga0070704_1002750942 140
202 3300005615 Ga0070702_100195069 Ga0070702_1001950691 140
203 3300005617 Ga0068859_101802213 Ga0068859_1018022131 140
204 3300005618 Ga0068864_100047073 Ga0068864_1000470733 140
205 3300005718 Ga0068866_10254657 Ga0068866_102546572 140
206 3300005834 Ga0068851_10484545 Ga0068851_104845452 140
207 3300005841 Ga0068863_100923722 Ga0068863_1009237222 140
208 3300005842 Ga0068858_100000616 Ga0068858_10000061613 140
209 3300005842 Ga0068858_100125210 Ga0068858_1001252101 140
210 3300005842 Ga0068858_100149427 Ga0068858_1001494273 140
211 3300005844 Ga0068862_100460409 Ga0068862_1004604092 140
212 3300005844 Ga0068862_100696995 Ga0068862_1006969952 140
213 3300005985 Ga0081539_10063795 Ga0081539_100637953 140
214 3300006237 Ga0097621_100028285 Ga0097621_1000282853 140
215 3300006237 Ga0097621_100354397 Ga0097621_1003543972 140
216 3300006237 Ga0097621_100472189 Ga0097621_1004721893 140
217 3300006358 Ga0068871_100000646 Ga0068871_1000006466 140
218 3300006358 Ga0068871_100547587 Ga0068871_1005475872 140
219 3300006852 Ga0075433_10080717 Ga0075433_100807172 140
220 3300006852 Ga0075433_10105351 Ga0075433_101053513 140
221 3300006871 Ga0075434_100917221 Ga0075434_1009172212 140
222 3300006871 Ga0075434_101032758 Ga0075434_1010327582 140
223 3300006881 Ga0068865_100004259 Ga0068865_1000042597 140
224 3300006931 Ga0097620_101802273 Ga0097620_1018022731 140
225 3300007265 Ga0099794_10147261 Ga0099794_101472612 140
226 3300009011 Ga0105251_10071373 Ga0105251_100713732 140
227 3300009093 Ga0105240_10262510 Ga0105240_102625103 140
228 3300009093 Ga0105240_10910413 Ga0105240_109104132 140
229 3300009094 Ga0111539_10015763 Ga0111539_100157631 140
230 3300009094 Ga0111539_10464620 Ga0111539_104646202 140
231 3300009098 Ga0105245_10085933 Ga0105245_100859332 140
232 3300009098 Ga0105245_11503501 Ga0105245_115035011 140
233 3300009101 Ga0105247_10036505 Ga0105247_100365053 140
234 3300009147 Ga0114129_10001999 Ga0114129_100019993 140
235 3300009147 Ga0114129_10005981 Ga0114129_1000598114 140
236 3300009147 Ga0114129_10186139 Ga0114129_101861392 140
237 3300009147 Ga0114129_10531089 Ga0114129_105310892 140
238 3300009147 Ga0114129_11493074 Ga0114129_114930742 140
239 3300009148 Ga0105243_11374216 Ga0105243_113742162 140
240 3300009148 Ga0105243_11751665 Ga0105243_117516652 140
241 3300009174 Ga0105241_10893363 Ga0105241_108933632 140
242 3300009176 Ga0105242_10068860 Ga0105242_100688602 140
243 3300009176 Ga0105242_10151075 Ga0105242_101510752 140
244 3300009177 Ga0105248_10708477 Ga0105248_107084772 140
245 3300009551 Ga0105238_11251267 Ga0105238_112512671 140
246 3300011119 Ga0105246_10992200 Ga0105246_109922002 140
247 3300013296 Ga0157374_10058135 Ga0157374_100581354 140
248 3300013297 Ga0157378_10116385 Ga0157378_101163852 140
249 3300013297 Ga0157378_11018405 Ga0157378_110184052 140
250 3300013308 Ga0157375_11326751 Ga0157375_113267512 140
251 3300014325 Ga0163163_10048847 Ga0163163_100488474 140
252 3300014325 Ga0163163_10142132 Ga0163163_101421323 140
253 3300014326 Ga0157380_10183410 Ga0157380_101834102 140
254 3300014968 Ga0157379_10066745 Ga0157379_100667453 140
255 3300014969 Ga0157376_10069411 Ga0157376_100694113 140
256 3300014969 Ga0157376_10078451 Ga0157376_100784513 140
257 3300014969 Ga0157376_10207918 Ga0157376_102079183 140
258 3300014969 Ga0157376_10351503 Ga0157376_103515032 140
259 3300025735 Ga0207713_1065883 Ga0207713_10658832 140
260 3300025900 Ga0207710_10040087 Ga0207710_100400872 140
261 3300025900 Ga0207710_10372120 Ga0207710_103721201 140
262 3300025903 Ga0207680_10303631 Ga0207680_103036312 140
263 3300025905 Ga0207685_10191501 Ga0207685_101915012 140
264 3300025907 Ga0207645_10369502 Ga0207645_103695022 140
265 3300025911 Ga0207654_10893419 Ga0207654_108934191 140
266 3300025922 Ga0207646_10115765 Ga0207646_101157653 140
267 3300025923 Ga0207681_11163010 Ga0207681_111630102 140
268 3300025926 Ga0207659_11229077 Ga0207659_112290771 140
269 3300025927 Ga0207687_10826371 Ga0207687_108263712 140
270 3300025933 Ga0207706_10060479 Ga0207706_100604793 140
271 3300025934 Ga0207686_10063902 Ga0207686_100639022 140
272 3300025934 Ga0207686_10213263 Ga0207686_102132632 140
273 3300025935 Ga0207709_10732520 Ga0207709_107325202 140
274 3300025938 Ga0207704_10035796 Ga0207704_100357963 140
275 3300025941 Ga0207711_10027108 Ga0207711_100271083 140
276 3300025960 Ga0207651_11200802 Ga0207651_112008021 140
277 3300026023 Ga0207677_10370497 Ga0207677_103704972 140
278 3300026023 Ga0207677_10476634 Ga0207677_104766342 140
279 3300026035 Ga0207703_10026766 Ga0207703_100267664 140
280 3300026035 Ga0207703_10049464 Ga0207703_100494643 140
281 3300026035 Ga0207703_10431130 Ga0207703_104311302 140
282 3300026095 Ga0207676_10184563 Ga0207676_101845632 140
283 3300026095 Ga0207676_10772485 Ga0207676_107724851 140
284 3300026116 Ga0207674_10352914 Ga0207674_103529142 140
285 3300027907 Ga0207428_10237312 Ga0207428_102373122 140
286 3300028379 Ga0268266_10073230 Ga0268266_100732305 140
287 3300028379 Ga0268266_10156027 Ga0268266_101560272 140
288 3300028379 Ga0268266_10633799 Ga0268266_106337992 140
289 3300028380 Ga0268265_10169863 Ga0268265_101698632 140
290 3300028380 Ga0268265_10350060 Ga0268265_103500602 140
291 3300028381 Ga0268264_10734404 Ga0268264_107344042 140
292 3300028381 Ga0268264_11211509 Ga0268264_112115091 140
293 3300028786 Ga0307517_10409676 Ga0307517_104096762 140
294 3300030521 Ga0307511_10189348 Ga0307511_101893481 140
295 3300032002 Ga0307416_100074392 Ga0307416_1000743923 140
296 3300035114 Ga0373939_0133912 Ga0373939_0133912_238_753 140
297 3300035117 Ga0373953_0163261 Ga0373953_0163261_274_786 140
298 3300035118 Ga0373954_0384351 Ga0373954_0384351_142_654 140
299 3300035120 Ga0373957_0138003 Ga0373957_0138003_221_733 140
300 3300035171 Ga0373946_0097462 Ga0373946_0097462_122_634 140
301 3300035691 Ga0373931_0075790 Ga0373931_0075790_595_1113 140
302 3300035692 Ga0373935_0269638 Ga0373935_0269638_58_567 140
303 3300035695 Ga0373927_0387615 Ga0373927_0387615_313_825 140
304 3300035724 Ga0373933_0019021 Ga0373933_0019021_820_1332 140
305 3300035725 Ga0373947_0218440 Ga0373947_0218440_582_1094 140
306 3300036401 Ga0373937_0097668 Ga0373937_0097668_1454_1975 140
307 3300036401 Ga0373937_0195383 Ga0373937_0195383_646_1158 140
308 3300037068 Ga0373925_0538456 Ga0373925_0538456_398_910 140
309 3300045051 Ga0451576_0289767 Ga0451576_0289767_780_1292 140
310 3300046455 Ga0495603_0196964 Ga0495603_0196964_461_973 140
311 3300046475 Ga0495639_0385526 Ga0495639_0385526_161_673 140
312 3300046491 Ga0495584_0419236 Ga0495584_0419236_40_552 140
313 3300046499 Ga0495594_0615141 Ga0495594_0615141_33_554 140
314 3300046511 Ga0495608_0214042 Ga0495608_0214042_664_1176 140
315 3300046529 Ga0495652_0777503 Ga0495652_0777503_109_621 140
316 3300046533 Ga0495640_0512082 Ga0495640_0512082_20_532 140
317 3300046536 Ga0495587_0071516 Ga0495587_0071516_1307_1819 140
318 3300046543 Ga0495645_0008004 Ga0495645_0008004_2372_2884 140
319 3300046663 Ga0495635_0214694 Ga0495635_0214694_133_645 140
320 3300046664 Ga0495659_0100578 Ga0495659_0100578_533_1051 140
321 3300046664 Ga0495659_0207428 Ga0495659_0207428_259_771 140
322 3300046678 Ga0495599_0525663 Ga0495599_0525663_138_650 140
323 3300046679 Ga0495623_0281170 Ga0495623_0281170_285_797 140
324 3300046681 Ga0495647_0155083 Ga0495647_0155083_73_585 140
325 3300046683 Ga0495658_0029587 Ga0495658_0029587_564_1076 140
326 3300046683 Ga0495658_0104943 Ga0495658_0104943_173_685 140
327 3300046683 Ga0495658_0184797 Ga0495658_0184797_289_801 140
328 3300046684 Ga0495669_0127254 Ga0495669_0127254_125_637 140
329 3300047319 Ga0495674_0142769 Ga0495674_0142769_70_582 140
330 3300047320 Ga0495672_0059255 Ga0495672_0059255_1321_1833 140
331 3300047471 Ga0495684_0592070 Ga0495684_0592070_159_671 140
332 3300048907 Ga0496104_0098756 Ga0496104_0098756_277_789 140
333 3300048907 Ga0496104_1126179 Ga0496104_1126179_63_575 140
334 3300048911 Ga0496108_0113727 Ga0496108_0113727_946_1458 140
335 3300048912 Ga0496109_0228636 Ga0496109_0228636_364_876 140
336 3300048912 Ga0496109_0749045 Ga0496109_0749045_200_712 140
337 3300048915 Ga0496112_0011751 Ga0496112_0011751_1794_2306 140
338 3300048916 Ga0496113_0414743 Ga0496113_0414743_541_1053 140
339 3300048917 Ga0496114_0121047 Ga0496114_0121047_1514_2026 140
340 3300048917 Ga0496114_0184320 Ga0496114_0184320_40_561 140
341 3300048917 Ga0496114_0412633 Ga0496114_0412633_346_858 140
342 3300048918 Ga0496115_0388982 Ga0496115_0388982_93_605 140
343 3300050507 nmdc:mga05p37_1267569_c1 nmdc:mga05p37_1267569_c1_143_661 140
344 3300050507 nmdc:mga05p37_20945_c1 nmdc:mga05p37_20945_c1_6705_7223 140
345 3300050507 nmdc:mga05p37_369172_c1 nmdc:mga05p37_369172_c1_318_833 140
346 3300050507 nmdc:mga05p37_82386_c1 nmdc:mga05p37_82386_c1_232_753 140
347 3300050508 nmdc:mga09592_118486_c1 nmdc:mga09592_118486_c1_989_1501 140
348 3300050511 nmdc:mga08y16_37472_c1 nmdc:mga08y16_37472_c1_4260_4772 140
349 3300050511 nmdc:mga08y16_406965_c1 nmdc:mga08y16_406965_c1_336_848 140
350 3300050512 nmdc:mga0n895_1296248_c1 nmdc:mga0n895_1296248_c1_39_557 140
351 3300050512 nmdc:mga0n895_1435480_c1 nmdc:mga0n895_1435480_c1_115_633 140
352 3300050512 nmdc:mga0n895_384522_c1 nmdc:mga0n895_384522_c1_58_579 140
353 3300050512 nmdc:mga0n895_454964_c1 nmdc:mga0n895_454964_c1_177_689 140
354 3300050515 nmdc:mga0a205_1073831_c1 nmdc:mga0a205_1073831_c1_72_584 140
355 3300050515 nmdc:mga0a205_500043_c1 nmdc:mga0a205_500043_c1_186_707 140
356 3300050515 nmdc:mga0a205_50087_c1 nmdc:mga0a205_50087_c1_2248_2763 140
357 3300053077 Ga0495601_0127601 Ga0495601_0127601_837_1349 140
358 3300053077 Ga0495601_0651164 Ga0495601_0651164_116_628 140
359 3300053085 Ga0495619_0058147 Ga0495619_0058147_205_717 140
360 3300053094 Ga0500566_0170413 Ga0500566_0170413_500_1009 140
361 3300053134 Ga0500658_0045468 Ga0500658_0045468_1009_1521 140
362 3300005293 Ga0065715_10604915 Ga0065715_106049151 141
363 3300005328 Ga0070676_10127053 Ga0070676_101270533 141
364 3300005334 Ga0068869_100547186 Ga0068869_1005471862 141
365 3300005334 Ga0068869_100914677 Ga0068869_1009146772 141
366 3300005338 Ga0068868_100358476 Ga0068868_1003584762 141
367 3300005344 Ga0070661_100081651 Ga0070661_1000816512 141
368 3300005354 Ga0070675_100000896 Ga0070675_1000008962 141
369 3300005364 Ga0070673_100074095 Ga0070673_1000740952 141
370 3300005434 Ga0070709_10239361 Ga0070709_102393613 141
371 3300005436 Ga0070713_100023631 Ga0070713_1000236313 141
372 3300005439 Ga0070711_100290895 Ga0070711_1002908952 141
373 3300005440 Ga0070705_100614482 Ga0070705_1006144821 141
374 3300005441 Ga0070700_100174780 Ga0070700_1001747803 141
375 3300005445 Ga0070708_100147914 Ga0070708_1001479143 141
376 3300005456 Ga0070678_100459192 Ga0070678_1004591921 141
377 3300005459 Ga0068867_100107713 Ga0068867_1001077131 141
378 3300005468 Ga0070707_100188117 Ga0070707_1001881172 141
379 3300005518 Ga0070699_100190490 Ga0070699_1001904901 141
380 3300005539 Ga0068853_100344066 Ga0068853_1003440663 141
381 3300005544 Ga0070686_101202523 Ga0070686_1012025231 141
382 3300005545 Ga0070695_100380768 Ga0070695_1003807682 141
383 3300005549 Ga0070704_100109082 Ga0070704_1001090823 141
384 3300005563 Ga0068855_100142552 Ga0068855_1001425523 141
385 3300005564 Ga0070664_100357348 Ga0070664_1003573482 141
386 3300005617 Ga0068859_100303885 Ga0068859_1003038852 141
387 3300005718 Ga0068866_10103331 Ga0068866_101033313 141
388 3300005843 Ga0068860_100160046 Ga0068860_1001600463 141
389 3300005843 Ga0068860_100426076 Ga0068860_1004260763 141
390 3300005844 Ga0068862_101534483 Ga0068862_1015344831 141
391 3300006237 Ga0097621_100424109 Ga0097621_1004241092 141
392 3300006931 Ga0097620_100303922 Ga0097620_1003039222 141
393 3300007076 Ga0075435_100088899 Ga0075435_1000888993 141
394 3300009093 Ga0105240_10082662 Ga0105240_100826623 141
395 3300009093 Ga0105240_11421528 Ga0105240_114215281 141
396 3300009098 Ga0105245_10047818 Ga0105245_100478183 141
397 3300009177 Ga0105248_10229106 Ga0105248_102291062 141
398 3300009177 Ga0105248_10506691 Ga0105248_105066912 141
399 3300009551 Ga0105238_11356236 Ga0105238_113562362 141
400 3300009553 Ga0105249_11376049 Ga0105249_113760492 141
401 3300013105 Ga0157369_10078224 Ga0157369_100782243 141
402 3300013296 Ga0157374_10215655 Ga0157374_102156552 141
403 3300013296 Ga0157374_11060946 Ga0157374_110609461 141
404 3300013297 Ga0157378_11435345 Ga0157378_114353451 141
405 3300013297 Ga0157378_11954373 Ga0157378_119543731 141
406 3300013306 Ga0163162_10246188 Ga0163162_102461883 141
407 3300013307 Ga0157372_10445773 Ga0157372_104457732 141
408 3300013308 Ga0157375_11149465 Ga0157375_111494651 141
409 3300014325 Ga0163163_11965393 Ga0163163_119653932 141
410 3300014326 Ga0157380_10410226 Ga0157380_104102262 141
411 3300014745 Ga0157377_10047247 Ga0157377_100472473 141
412 3300025898 Ga0207692_10489817 Ga0207692_104898172 141
413 3300025899 Ga0207642_10227750 Ga0207642_102277503 141
414 3300025906 Ga0207699_10080846 Ga0207699_100808462 141
415 3300025907 Ga0207645_10157686 Ga0207645_101576862 141
416 3300025913 Ga0207695_10037196 Ga0207695_100371966 141
417 3300025916 Ga0207663_10171619 Ga0207663_101716193 141
418 3300025920 Ga0207649_10078192 Ga0207649_100781923 141
419 3300025922 Ga0207646_10150426 Ga0207646_101504263 141
420 3300025926 Ga0207659_10031788 Ga0207659_100317881 141
421 3300025926 Ga0207659_10102343 Ga0207659_101023433 141
422 3300025927 Ga0207687_10111941 Ga0207687_101119412 141
423 3300025928 Ga0207700_10007165 Ga0207700_100071652 141
424 3300025928 Ga0207700_10272264 Ga0207700_102722642 141
425 3300025938 Ga0207704_10180427 Ga0207704_101804272 141
426 3300025938 Ga0207704_10457631 Ga0207704_104576311 141
427 3300025940 Ga0207691_10100271 Ga0207691_101002712 141
428 3300025941 Ga0207711_10745157 Ga0207711_107451572 141
429 3300025944 Ga0207661_10396246 Ga0207661_103962462 141
430 3300025945 Ga0207679_10255881 Ga0207679_102558812 141
431 3300025949 Ga0207667_10123461 Ga0207667_101234613 141
432 3300025960 Ga0207651_10349678 Ga0207651_103496782 141
433 3300025981 Ga0207640_11574035 Ga0207640_115740351 141
434 3300026023 Ga0207677_10032271 Ga0207677_100322713 141
435 3300026035 Ga0207703_10075185 Ga0207703_100751853 141
436 3300026041 Ga0207639_10210074 Ga0207639_102100743 141
437 3300026075 Ga0207708_10276788 Ga0207708_102767883 141
438 3300026078 Ga0207702_10057395 Ga0207702_100573953 141
439 3300026088 Ga0207641_10240936 Ga0207641_102409362 141
440 3300026118 Ga0207675_100660198 Ga0207675_1006601983 141
441 3300026121 Ga0207683_10495479 Ga0207683_104954792 141
442 3300028379 Ga0268266_10011538 Ga0268266_100115383 141
443 3300028381 Ga0268264_10068584 Ga0268264_100685843 141
444 3300035111 Ga0373923_0086914 Ga0373923_0086914_549_1061 141
445 3300035116 Ga0373945_0131270 Ga0373945_0131270_367_879 141
446 3300035172 Ga0373955_0407677 Ga0373955_0407677_282_794 141
447 3300036401 Ga0373937_0128345 Ga0373937_0128345_1839_2351 141
448 3300046511 Ga0495608_0010011 Ga0495608_0010011_3032_3544 141
449 3300046516 Ga0495628_0835776 Ga0495628_0835776_20_532 141
450 3300046517 Ga0495630_0003709 Ga0495630_0003709_3051_3563 141
451 3300046529 Ga0495652_0473264 Ga0495652_0473264_142_654 141
452 3300046531 Ga0495665_0495926 Ga0495665_0495926_73_585 141
453 3300046543 Ga0495645_0229428 Ga0495645_0229428_523_1035 141
454 3300046559 Ga0495667_0077679 Ga0495667_0077679_1080_1592 141
455 3300046663 Ga0495635_0383813 Ga0495635_0383813_339_851 141
456 3300046679 Ga0495623_0163839 Ga0495623_0163839_561_1073 141
457 3300046684 Ga0495669_0131550 Ga0495669_0131550_504_1022 141
458 3300046689 Ga0495613_0011581 Ga0495613_0011581_1699_2211 141
459 3300046691 Ga0495670_0076215 Ga0495670_0076215_779_1291 141
460 3300047319 Ga0495674_0011153 Ga0495674_0011153_7012_7524 141
461 3300047471 Ga0495684_0000048 Ga0495684_0000048_7188_7700 141
462 3300048912 Ga0496109_1310453 Ga0496109_1310453_59_571 141
463 3300048915 Ga0496112_1368255 Ga0496112_1368255_73_591 141
464 3300053077 Ga0495601_0207447 Ga0495601_0207447_619_1131 141
465 3300053084 Ga0495595_0024150 Ga0495595_0024150_783_1295 141
466 3300053085 Ga0495619_0004485 Ga0495619_0004485_1485_1997 141
467 3300005293 Ga0065715_10264523 Ga0065715_102645231 142
468 3300005334 Ga0068869_100237153 Ga0068869_1002371532 142
469 3300005337 Ga0070682_100668414 Ga0070682_1006684141 142
470 3300005338 Ga0068868_100316879 Ga0068868_1003168792 142
471 3300005339 Ga0070660_100089402 Ga0070660_1000894022 142
472 3300005345 Ga0070692_10462865 Ga0070692_104628651 142
473 3300005364 Ga0070673_100021840 Ga0070673_1000218402 142
474 3300005434 Ga0070709_10182931 Ga0070709_101829312 142
475 3300005435 Ga0070714_100006151 Ga0070714_1000061513 142
476 3300005458 Ga0070681_10001072 Ga0070681_1000107212 142
477 3300005530 Ga0070679_100191850 Ga0070679_1001918503 142
478 3300005564 Ga0070664_100369754 Ga0070664_1003697542 142
479 3300005577 Ga0068857_100764389 Ga0068857_1007643892 142
480 3300005578 Ga0068854_100056641 Ga0068854_1000566413 142
481 3300005614 Ga0068856_100824703 Ga0068856_1008247032 142
482 3300005617 Ga0068859_100243084 Ga0068859_1002430842 142
483 3300005843 Ga0068860_100367210 Ga0068860_1003672102 142
484 3300006852 Ga0075433_10127896 Ga0075433_101278963 142
485 3300006852 Ga0075433_10270472 Ga0075433_102704723 142
486 3300006871 Ga0075434_101035609 Ga0075434_1010356091 142
487 3300006914 Ga0075436_100123931 Ga0075436_1001239313 142
488 3300006931 Ga0097620_100243086 Ga0097620_1002430862 142
489 3300007076 Ga0075435_100100490 Ga0075435_1001004902 142
490 3300009098 Ga0105245_11539324 Ga0105245_115393241 142
491 3300009176 Ga0105242_10307230 Ga0105242_103072301 142
492 3300009177 Ga0105248_10705585 Ga0105248_107055852 142
493 3300009551 Ga0105238_11876202 Ga0105238_118762021 142
494 3300009553 Ga0105249_10664050 Ga0105249_106640501 142
495 3300014325 Ga0163163_12235161 Ga0163163_122351611 142
496 3300025906 Ga0207699_10237640 Ga0207699_102376402 142
497 3300025912 Ga0207707_10009543 Ga0207707_100095434 142
498 3300025914 Ga0207671_10758482 Ga0207671_107584822 142
499 3300025917 Ga0207660_10036323 Ga0207660_100363233 142
500 3300025921 Ga0207652_10368096 Ga0207652_103680962 142
501 3300025924 Ga0207694_10446002 Ga0207694_104460022 142
502 3300025927 Ga0207687_10085267 Ga0207687_100852671 142
503 3300025941 Ga0207711_10749040 Ga0207711_107490402 142
504 3300025960 Ga0207651_10034563 Ga0207651_100345634 142
505 3300025981 Ga0207640_10140916 Ga0207640_101409163 142
506 3300025981 Ga0207640_11215094 Ga0207640_112150942 142
507 3300026023 Ga0207677_10096519 Ga0207677_100965193 142
508 3300026035 Ga0207703_10782940 Ga0207703_107829402 142
509 3300026078 Ga0207702_10980140 Ga0207702_109801401 142
510 3300026118 Ga0207675_100518386 Ga0207675_1005183862 142
511 3300045836 Ga0466958_0268450 Ga0466958_0268450_236_754 142
512 3300045976 Ga0466967_0837221 Ga0466967_0837221_263_781 142
513 3300048911 Ga0496108_0728112 Ga0496108_0728112_300_815 142
514 3300048915 Ga0496112_0245448 Ga0496112_0245448_349_864 142
515 3300048915 Ga0496112_1486392 Ga0496112_1486392_43_564 142
516 3300050512 nmdc:mga0n895_72501_c1 nmdc:mga0n895_72501_c1_1648_2166 142
517 3300050514 nmdc:mga08x19_239976_c1 nmdc:mga08x19_239976_c1_582_1100 142
518 3300050515 nmdc:mga0a205_439270_c1 nmdc:mga0a205_439270_c1_60_578 142
519 3300002459 JGI24751J29686_10003181 JGI24751J29686_100031811 143
520 3300005331 Ga0070670_100256084 Ga0070670_1002560843 143
521 3300005577 Ga0068857_100722002 Ga0068857_1007220022 143
522 3300005617 Ga0068859_100590821 Ga0068859_1005908212 143
523 3300005618 Ga0068864_100004916 Ga0068864_1000049169 143
524 3300006871 Ga0075434_100088908 Ga0075434_1000889083 143
525 3300006931 Ga0097620_100590815 Ga0097620_1005908152 143
526 3300007265 Ga0099794_10395305 Ga0099794_103953051 143
527 3300013308 Ga0157375_12551805 Ga0157375_125518051 143
528 3300014325 Ga0163163_10624660 Ga0163163_106246601 143
529 3300025925 Ga0207650_10210562 Ga0207650_102105622 143
530 3300025936 Ga0207670_10740778 Ga0207670_107407782 143
531 3300025939 Ga0207665_10044879 Ga0207665_100448792 143
532 3300026088 Ga0207641_10438327 Ga0207641_104383272 143
533 3300026095 Ga0207676_10004611 Ga0207676_100046115 143
534 3300026116 Ga0207674_10646809 Ga0207674_106468092 143
535 3300035170 Ga0373943_0421959 Ga0373943_0421959_58_576 143
536 3300046462 Ga0495651_0424771 Ga0495651_0424771_193_711 143
537 3300046516 Ga0495628_0460164 Ga0495628_0460164_310_828 143
538 3300047471 Ga0495684_0287821 Ga0495684_0287821_201_719 143
539 3300048911 Ga0496108_1003919 Ga0496108_1003919_169_687 143
540 3300048913 Ga0496110_0048614 Ga0496110_0048614_2908_3426 143
541 3300050512 nmdc:mga0n895_315541_c1 nmdc:mga0n895_315541_c1_286_804 143
542 3300053077 Ga0495601_0309141 Ga0495601_0309141_372_890 143
543 3300053085 Ga0495619_0023416 Ga0495619_0023416_901_1419 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00499

Oxidored_q3

NADH-ubiquinone/plastoquinone oxidoreductase chain 6

17

167

0.84

Feature Viewer

pLDDT pTM Quality
72.32 0.25 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map