F461503
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 542 | 236 | 542 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300031995|Ga0307409_100371342|Ga0307409_1003713422 |
| Length | 278 |
| Sequence | MTGAGAASGESDPHRDDAHHTRDAYDPDARAPGHLSRDATPPALRPRDDGMRNVGVVIVAAGAGSRAGSAELKQFRWIAGKPMLLHSVQTFQLRQDVAMVVCVIPKSFAGDPPPWLFQCDVDRLLLAVGGRDRGESVMNGLEDLPDDVEYVLVHDAARPLATSETIERVVREVRRGHGAVAAIPVVDTLKEVDDDGRIVRTVDRRALWRAQTPQGFPRDMIERAYVDARTARITATDDAALCERLGLPVVVVRGSERAMKITDESDFERAEALYGLAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 53 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 78 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 84 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 136 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 137 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 138 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 139 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 140 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 141 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 142 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 143 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 144 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 145 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 146 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 147 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 148 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 149 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 150 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 151 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 152 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 153 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 154 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 156 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 157 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 158 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 159 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 160 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 161 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 162 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 163 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 164 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 204 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 205 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 207 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 208 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 209 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 222 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 226 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.63 |
| Metatranscriptomes | 0.37 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.03 |
| Rhizosphere | 97.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10010637 | 3300005327 | Bacteria | 7374 |
| 2 | Ga0070658_10021716 | 3300005327 | Bacteria | 5145 |
| 3 | Ga0070658_10085533 | 3300005327 | Bacteria | 2593 |
| 4 | Ga0070658_10216962 | 3300005327 | Bacteria | 1617 |
| 5 | Ga0070658_10338297 | 3300005327 | Archaea | 1287 |
| 6 | Ga0070676_10029249 | 3300005328 | Bacteria | 3133 |
| 7 | Ga0070676_10245083 | 3300005328 | Bacteria | 1194 |
| 8 | Ga0070683_100019956 | 3300005329 | Bacteria | 5957 |
| 9 | Ga0070683_100021893 | 3300005329 | Bacteria | 5707 |
| 10 | Ga0070683_100033236 | 3300005329 | Bacteria | 4703 |
| 11 | Ga0070683_100056412 | 3300005329 | Bacteria | 3648 |
| 12 | Ga0070683_100193019 | 3300005329 | Bacteria | 1934 |
| 13 | Ga0070683_100433634 | 3300005329 | Bacteria | 1254 |
| 14 | Ga0070683_100462258 | 3300005329 | Bacteria | 1211 |
| 15 | Ga0070680_100007216 | 3300005336 | Bacteria | 8472 |
| 16 | Ga0070680_100012380 | 3300005336 | Bacteria | 6624 |
| 17 | Ga0070680_100020001 | 3300005336 | Bacteria | 5307 |
| 18 | Ga0070680_100020872 | 3300005336 | Bacteria | 5200 |
| 19 | Ga0070680_100030342 | 3300005336 | Bacteria | 4344 |
| 20 | Ga0070680_100324151 | 3300005336 | Bacteria | 1308 |
| 21 | Ga0070680_100360891 | 3300005336 | Bacteria | 1236 |
| 22 | Ga0070682_100523393 | 3300005337 | Bacteria | 923 |
| 23 | Ga0068868_100302523 | 3300005338 | Unclassified | 1359 |
| 24 | Ga0070660_100027478 | 3300005339 | Bacteria | 4246 |
| 25 | Ga0070660_100028943 | 3300005339 | Bacteria | 4149 |
| 26 | Ga0070660_100255466 | 3300005339 | Bacteria | 1430 |
| 27 | Ga0070660_100574027 | 3300005339 | Bacteria | 942 |
| 28 | Ga0070689_100017373 | 3300005340 | Bacteria | 5282 |
| 29 | Ga0070691_10002925 | 3300005341 | Bacteria | 7660 |
| 30 | Ga0070691_10165939 | 3300005341 | Bacteria | 1141 |
| 31 | Ga0070661_100025402 | 3300005344 | Bacteria | 4256 |
| 32 | Ga0070661_100034765 | 3300005344 | Bacteria | 3656 |
| 33 | Ga0070661_100039113 | 3300005344 | Bacteria | 3455 |
| 34 | Ga0070661_100070396 | 3300005344 | Bacteria | 2572 |
| 35 | Ga0070661_100153466 | 3300005344 | Bacteria | 1742 |
| 36 | Ga0070661_100201783 | 3300005344 | Bacteria | 1520 |
| 37 | Ga0070661_100215421 | 3300005344 | Bacteria | 1471 |
| 38 | Ga0070661_100240049 | 3300005344 | Bacteria | 1395 |
| 39 | Ga0070661_100329490 | 3300005344 | Bacteria | 1194 |
| 40 | Ga0070692_10195547 | 3300005345 | Unclassified | 1181 |
| 41 | Ga0070668_100010325 | 3300005347 | Bacteria | 6932 |
| 42 | Ga0070668_100052116 | 3300005347 | Bacteria | 3154 |
| 43 | Ga0070668_100082570 | 3300005347 | Bacteria | 2521 |
| 44 | Ga0070668_100234516 | 3300005347 | Unclassified | 1518 |
| 45 | Ga0070669_100009190 | 3300005353 | Bacteria | 7041 |
| 46 | Ga0070675_100007808 | 3300005354 | Bacteria | 8290 |
| 47 | Ga0070675_100030937 | 3300005354 | Bacteria | 4323 |
| 48 | Ga0070671_100043066 | 3300005355 | Bacteria | 3753 |
| 49 | Ga0070671_100240416 | 3300005355 | Unclassified | 1537 |
| 50 | Ga0070671_100813311 | 3300005355 | Unclassified | 814 |
| 51 | Ga0070673_100058044 | 3300005364 | Bacteria | 3059 |
| 52 | Ga0070673_100385644 | 3300005364 | Unclassified | 1250 |
| 53 | Ga0070673_100428441 | 3300005364 | Bacteria | 1187 |
| 54 | Ga0070673_100477571 | 3300005364 | Unclassified | 1125 |
| 55 | Ga0070688_100019852 | 3300005365 | Bacteria | 3898 |
| 56 | Ga0070688_100046098 | 3300005365 | Bacteria | 2698 |
| 57 | Ga0070659_100015438 | 3300005366 | Bacteria | 5720 |
| 58 | Ga0070659_100035705 | 3300005366 | Bacteria | 3872 |
| 59 | Ga0070659_100433969 | 3300005366 | Bacteria | 1112 |
| 60 | Ga0070667_100067569 | 3300005367 | Bacteria | 3039 |
| 61 | Ga0070667_100375065 | 3300005367 | Bacteria | 1291 |
| 62 | Ga0070709_10007406 | 3300005434 | Bacteria | 6015 |
| 63 | Ga0070714_100007479 | 3300005435 | Bacteria | 8503 |
| 64 | Ga0070714_100071359 | 3300005435 | Bacteria | 3003 |
| 65 | Ga0070713_100127675 | 3300005436 | Bacteria | 2239 |
| 66 | Ga0070713_100499072 | 3300005436 | Bacteria | 1148 |
| 67 | Ga0070710_10024779 | 3300005437 | Bacteria | 3169 |
| 68 | Ga0070701_10203397 | 3300005438 | Bacteria | 1172 |
| 69 | Ga0070711_100242343 | 3300005439 | Unclassified | 1410 |
| 70 | Ga0070694_100362838 | 3300005444 | Bacteria | 1125 |
| 71 | Ga0070663_100104486 | 3300005455 | Bacteria | 2119 |
| 72 | Ga0070663_100228598 | 3300005455 | Bacteria | 1464 |
| 73 | Ga0070681_10000631 | 3300005458 | Bacteria | 28933 |
| 74 | Ga0070681_10001027 | 3300005458 | Bacteria | 23667 |
| 75 | Ga0070681_10006014 | 3300005458 | Bacteria | 11759 |
| 76 | Ga0070681_10009065 | 3300005458 | Bacteria | 9782 |
| 77 | Ga0070681_10019285 | 3300005458 | Bacteria | 6824 |
| 78 | Ga0070681_10025940 | 3300005458 | Bacteria | 5892 |
| 79 | Ga0070681_10116754 | 3300005458 | Bacteria | 2605 |
| 80 | Ga0070681_10212643 | 3300005458 | Bacteria | 1850 |
| 81 | Ga0070681_10434431 | 3300005458 | Bacteria | 1225 |
| 82 | Ga0070685_10023937 | 3300005466 | Bacteria | 3349 |
| 83 | Ga0070706_100117976 | 3300005467 | Bacteria | 2472 |
| 84 | Ga0070698_100009181 | 3300005471 | Bacteria | 10614 |
| 85 | Ga0070699_100020660 | 3300005518 | Bacteria | 5682 |
| 86 | Ga0070699_100742498 | 3300005518 | Bacteria | 897 |
| 87 | Ga0070679_100002378 | 3300005530 | Bacteria | 17053 |
| 88 | Ga0070679_100003980 | 3300005530 | Bacteria | 13610 |
| 89 | Ga0070679_100004645 | 3300005530 | Bacteria | 12678 |
| 90 | Ga0070679_100026050 | 3300005530 | Bacteria | 5740 |
| 91 | Ga0070679_100045465 | 3300005530 | Bacteria | 4375 |
| 92 | Ga0070679_100050251 | 3300005530 | Bacteria | 4153 |
| 93 | Ga0070679_100250616 | 3300005530 | Bacteria | 1727 |
| 94 | Ga0070679_100270846 | 3300005530 | Bacteria | 1652 |
| 95 | Ga0070679_100610638 | 3300005530 | Unclassified | 1034 |
| 96 | Ga0070679_100757466 | 3300005530 | Unclassified | 914 |
| 97 | Ga0070684_100004275 | 3300005535 | Bacteria | 10832 |
| 98 | Ga0070684_100006282 | 3300005535 | Bacteria | 9178 |
| 99 | Ga0070684_100006841 | 3300005535 | Bacteria | 8848 |
| 100 | Ga0070684_100140878 | 3300005535 | Bacteria | 2181 |
| 101 | Ga0070684_100180074 | 3300005535 | Bacteria | 1922 |
| 102 | Ga0070684_100300108 | 3300005535 | Bacteria | 1474 |
| 103 | Ga0070684_100553232 | 3300005535 | Bacteria | 1068 |
| 104 | Ga0070684_100794150 | 3300005535 | Bacteria | 885 |
| 105 | Ga0070672_100070714 | 3300005543 | Bacteria | 2774 |
| 106 | Ga0070672_100203913 | 3300005543 | Bacteria | 1654 |
| 107 | Ga0070672_100234283 | 3300005543 | Bacteria | 1543 |
| 108 | Ga0070695_100013296 | 3300005545 | Bacteria | 4946 |
| 109 | Ga0070695_100043750 | 3300005545 | Bacteria | 2849 |
| 110 | Ga0070696_100552414 | 3300005546 | Unclassified | 923 |
| 111 | Ga0070693_100054815 | 3300005547 | Unclassified | 2294 |
| 112 | Ga0070693_100066908 | 3300005547 | Bacteria | 2104 |
| 113 | Ga0070704_100213982 | 3300005549 | Unclassified | 1563 |
| 114 | Ga0068855_100001981 | 3300005563 | Bacteria | 25451 |
| 115 | Ga0068855_100020328 | 3300005563 | Bacteria | 7965 |
| 116 | Ga0068855_100055481 | 3300005563 | Bacteria | 4654 |
| 117 | Ga0068855_100082035 | 3300005563 | Bacteria | 3737 |
| 118 | Ga0068855_100176673 | 3300005563 | Bacteria | 2416 |
| 119 | Ga0068855_100207547 | 3300005563 | Unclassified | 2203 |
| 120 | Ga0068855_100210345 | 3300005563 | Bacteria | 2186 |
| 121 | Ga0068855_100220896 | 3300005563 | Bacteria | 2125 |
| 122 | Ga0070664_100005637 | 3300005564 | Bacteria | 10079 |
| 123 | Ga0070664_100025323 | 3300005564 | Bacteria | 4917 |
| 124 | Ga0070664_100051515 | 3300005564 | Bacteria | 3486 |
| 125 | Ga0070664_100119931 | 3300005564 | Bacteria | 2302 |
| 126 | Ga0070664_100178802 | 3300005564 | Bacteria | 1885 |
| 127 | Ga0070664_100353951 | 3300005564 | Bacteria | 1336 |
| 128 | Ga0068857_100039271 | 3300005577 | Bacteria | 4192 |
| 129 | Ga0068857_100092038 | 3300005577 | Bacteria | 2715 |
| 130 | Ga0068857_100321505 | 3300005577 | Bacteria | 1429 |
| 131 | Ga0068854_100020094 | 3300005578 | Bacteria | 4511 |
| 132 | Ga0068854_100051140 | 3300005578 | Bacteria | 2959 |
| 133 | Ga0068854_100395699 | 3300005578 | Bacteria | 1142 |
| 134 | Ga0068856_100096514 | 3300005614 | Bacteria | 2944 |
| 135 | Ga0068852_100006758 | 3300005616 | Bacteria | 8324 |
| 136 | Ga0068852_100044902 | 3300005616 | Bacteria | 3756 |
| 137 | Ga0068852_100091962 | 3300005616 | Bacteria | 2716 |
| 138 | Ga0068864_100229898 | 3300005618 | Bacteria | 1715 |
| 139 | Ga0068864_100663703 | 3300005618 | Bacteria | 1016 |
| 140 | Ga0068870_10008889 | 3300005840 | Bacteria | 4538 |
| 141 | Ga0068860_100702612 | 3300005843 | Unclassified | 1021 |
| 142 | Ga0081455_10005471 | 3300005937 | Bacteria | 13923 |
| 143 | Ga0081539_10052432 | 3300005985 | Bacteria | 2291 |
| 144 | Ga0070717_10263902 | 3300006028 | Bacteria | 1524 |
| 145 | Ga0075428_100700177 | 3300006844 | Bacteria | 1079 |
| 146 | Ga0075431_100507193 | 3300006847 | Bacteria | 1197 |
| 147 | Ga0075434_100040261 | 3300006871 | Bacteria | 4628 |
| 148 | Ga0075434_100103806 | 3300006871 | Bacteria | 2851 |
| 149 | Ga0068865_100027987 | 3300006881 | Bacteria | 3729 |
| 150 | Ga0105240_10003569 | 3300009093 | Bacteria | 24134 |
| 151 | Ga0105240_10006327 | 3300009093 | Bacteria | 17434 |
| 152 | Ga0105240_10106246 | 3300009093 | Bacteria | 3406 |
| 153 | Ga0105240_10407501 | 3300009093 | Bacteria | 1530 |
| 154 | Ga0105240_10426661 | 3300009093 | Bacteria | 1488 |
| 155 | Ga0105240_10698665 | 3300009093 | Bacteria | 1107 |
| 156 | Ga0105245_10087206 | 3300009098 | Bacteria | 2865 |
| 157 | Ga0105245_10413853 | 3300009098 | Bacteria | 1350 |
| 158 | Ga0114129_10719300 | 3300009147 | Bacteria | 1281 |
| 159 | Ga0105243_10138049 | 3300009148 | Bacteria | 2077 |
| 160 | Ga0105241_10000025 | 3300009174 | Bacteria | 132929 |
| 161 | Ga0105241_10152133 | 3300009174 | Bacteria | 1894 |
| 162 | Ga0105241_10498870 | 3300009174 | Bacteria | 1085 |
| 163 | Ga0105241_10595049 | 3300009174 | Bacteria | 998 |
| 164 | Ga0105242_10043077 | 3300009176 | Bacteria | 3649 |
| 165 | Ga0105248_10068273 | 3300009177 | Bacteria | 3992 |
| 166 | Ga0105248_10619839 | 3300009177 | Bacteria | 1221 |
| 167 | Ga0105248_10690162 | 3300009177 | Unclassified | 1152 |
| 168 | Ga0105248_10919636 | 3300009177 | Bacteria | 988 |
| 169 | Ga0105237_10473675 | 3300009545 | Bacteria | 1258 |
| 170 | Ga0105238_10004780 | 3300009551 | Bacteria | 13407 |
| 171 | Ga0105238_10537240 | 3300009551 | Unclassified | 1173 |
| 172 | Ga0105238_10839742 | 3300009551 | Unclassified | 935 |
| 173 | Ga0105249_10000078 | 3300009553 | Bacteria | 140030 |
| 174 | Ga0105239_10308482 | 3300010375 | Unclassified | 1783 |
| 175 | Ga0157373_10029156 | 3300013100 | Bacteria | 3978 |
| 176 | Ga0157373_10038315 | 3300013100 | Bacteria | 3436 |
| 177 | Ga0157371_10004747 | 3300013102 | Bacteria | 11725 |
| 178 | Ga0157371_10224890 | 3300013102 | Bacteria | 1348 |
| 179 | Ga0157370_10001847 | 3300013104 | Bacteria | 26111 |
| 180 | Ga0157370_10021404 | 3300013104 | Bacteria | 6444 |
| 181 | Ga0157370_10119209 | 3300013104 | Bacteria | 2464 |
| 182 | Ga0157370_10138889 | 3300013104 | Bacteria | 2264 |
| 183 | Ga0157370_10323261 | 3300013104 | Bacteria | 1423 |
| 184 | Ga0157369_10028472 | 3300013105 | Bacteria | 6184 |
| 185 | Ga0157369_10033903 | 3300013105 | Bacteria | 5606 |
| 186 | Ga0157369_10036846 | 3300013105 | Bacteria | 5357 |
| 187 | Ga0157369_10102589 | 3300013105 | Bacteria | 3048 |
| 188 | Ga0157369_10117744 | 3300013105 | Bacteria | 2820 |
| 189 | Ga0157369_10206332 | 3300013105 | Bacteria | 2061 |
| 190 | Ga0157374_10116363 | 3300013296 | Bacteria | 2576 |
| 191 | Ga0157374_10685553 | 3300013296 | Bacteria | 1037 |
| 192 | Ga0157374_10714115 | 3300013296 | Bacteria | 1016 |
| 193 | Ga0157378_10959352 | 3300013297 | Unclassified | 888 |
| 194 | Ga0157372_10002084 | 3300013307 | Bacteria | 21727 |
| 195 | Ga0157372_10003298 | 3300013307 | Bacteria | 17437 |
| 196 | Ga0157372_10011056 | 3300013307 | Bacteria | 9604 |
| 197 | Ga0157372_10017343 | 3300013307 | Bacteria | 7730 |
| 198 | Ga0157372_10030167 | 3300013307 | Bacteria | 5929 |
| 199 | Ga0157372_10039692 | 3300013307 | Bacteria | 5197 |
| 200 | Ga0157372_10043975 | 3300013307 | Bacteria | 4947 |
| 201 | Ga0157372_10076385 | 3300013307 | Bacteria | 3782 |
| 202 | Ga0157372_10114009 | 3300013307 | Bacteria | 3098 |
| 203 | Ga0157372_10174298 | 3300013307 | Bacteria | 2489 |
| 204 | Ga0157372_10275780 | 3300013307 | Bacteria | 1955 |
| 205 | Ga0157375_10018916 | 3300013308 | Bacteria | 6254 |
| 206 | Ga0157375_10066196 | 3300013308 | Bacteria | 3606 |
| 207 | Ga0157375_10068237 | 3300013308 | Bacteria | 3557 |
| 208 | Ga0157375_10422428 | 3300013308 | Bacteria | 1499 |
| 209 | Ga0157375_10698125 | 3300013308 | Bacteria | 1168 |
| 210 | Ga0163163_10427828 | 3300014325 | Unclassified | 1383 |
| 211 | Ga0163163_10764526 | 3300014325 | Bacteria | 1029 |
| 212 | Ga0157380_10159673 | 3300014326 | Bacteria | 1958 |
| 213 | Ga0182008_10005605 | 3300014497 | Bacteria | 7117 |
| 214 | Ga0157377_10162183 | 3300014745 | Bacteria | 1391 |
| 215 | Ga0157379_10676853 | 3300014968 | Bacteria | 967 |
| 216 | Ga0157376_10179820 | 3300014969 | Bacteria | 1932 |
| 217 | Ga0197907_11188549 | 3300020069 | Unclassified | 2432 |
| 218 | Ga0206354_11678005 | 3300020081 | Bacteria | 839 |
| 219 | Ga0213876_10010396 | 3300021384 | Bacteria | 4997 |
| 220 | Ga0207697_10060832 | 3300025315 | Bacteria | 1571 |
| 221 | Ga0207656_10010840 | 3300025321 | Bacteria | 3428 |
| 222 | Ga0207692_10130290 | 3300025898 | Unclassified | 1420 |
| 223 | Ga0207680_10494042 | 3300025903 | Bacteria | 871 |
| 224 | Ga0207645_10019731 | 3300025907 | Bacteria | 4417 |
| 225 | Ga0207645_10133121 | 3300025907 | Bacteria | 1619 |
| 226 | Ga0207645_10249535 | 3300025907 | Bacteria | 1174 |
| 227 | Ga0207705_10016916 | 3300025909 | Bacteria | 5224 |
| 228 | Ga0207705_10019742 | 3300025909 | Bacteria | 4819 |
| 229 | Ga0207705_10024091 | 3300025909 | Bacteria | 4343 |
| 230 | Ga0207705_10045257 | 3300025909 | Bacteria | 3163 |
| 231 | Ga0207705_10217378 | 3300025909 | Bacteria | 1451 |
| 232 | Ga0207705_10259981 | 3300025909 | Bacteria | 1325 |
| 233 | Ga0207654_10000492 | 3300025911 | Bacteria | 22614 |
| 234 | Ga0207654_10076372 | 3300025911 | Bacteria | 2005 |
| 235 | Ga0207707_10000322 | 3300025912 | Bacteria | 50600 |
| 236 | Ga0207707_10003416 | 3300025912 | Bacteria | 14075 |
| 237 | Ga0207707_10003644 | 3300025912 | Bacteria | 13662 |
| 238 | Ga0207707_10005438 | 3300025912 | Bacteria | 11136 |
| 239 | Ga0207707_10009065 | 3300025912 | Bacteria | 8642 |
| 240 | Ga0207707_10015989 | 3300025912 | Bacteria | 6544 |
| 241 | Ga0207707_10155470 | 3300025912 | Bacteria | 2000 |
| 242 | Ga0207707_10270919 | 3300025912 | Unclassified | 1471 |
| 243 | Ga0207707_10479794 | 3300025912 | Bacteria | 1062 |
| 244 | Ga0207707_10667255 | 3300025912 | Unclassified | 875 |
| 245 | Ga0207695_10002468 | 3300025913 | Bacteria | 27266 |
| 246 | Ga0207695_10005733 | 3300025913 | Bacteria | 16362 |
| 247 | Ga0207695_10011715 | 3300025913 | Bacteria | 10595 |
| 248 | Ga0207695_10060635 | 3300025913 | Bacteria | 3915 |
| 249 | Ga0207695_10065117 | 3300025913 | Bacteria | 3748 |
| 250 | Ga0207695_10104379 | 3300025913 | Bacteria | 2824 |
| 251 | Ga0207695_10637951 | 3300025913 | Bacteria | 946 |
| 252 | Ga0207663_10378413 | 3300025916 | Bacteria | 1078 |
| 253 | Ga0207660_10041782 | 3300025917 | Bacteria | 3215 |
| 254 | Ga0207660_10057137 | 3300025917 | Unclassified | 2794 |
| 255 | Ga0207660_10060780 | 3300025917 | Bacteria | 2718 |
| 256 | Ga0207660_10063778 | 3300025917 | Bacteria | 2658 |
| 257 | Ga0207660_10080514 | 3300025917 | Bacteria | 2392 |
| 258 | Ga0207660_10100050 | 3300025917 | Bacteria | 2164 |
| 259 | Ga0207660_10143950 | 3300025917 | Bacteria | 1825 |
| 260 | Ga0207662_10002925 | 3300025918 | Bacteria | 8666 |
| 261 | Ga0207657_10010260 | 3300025919 | Bacteria | 9350 |
| 262 | Ga0207657_10018154 | 3300025919 | Bacteria | 6729 |
| 263 | Ga0207657_10351805 | 3300025919 | Bacteria | 1162 |
| 264 | Ga0207649_10032369 | 3300025920 | Bacteria | 3117 |
| 265 | Ga0207649_10114033 | 3300025920 | Bacteria | 1811 |
| 266 | Ga0207649_10115150 | 3300025920 | Bacteria | 1803 |
| 267 | Ga0207649_10155453 | 3300025920 | Unclassified | 1579 |
| 268 | Ga0207649_10454141 | 3300025920 | Bacteria | 968 |
| 269 | Ga0207652_10006464 | 3300025921 | Bacteria | 9451 |
| 270 | Ga0207652_10010695 | 3300025921 | Bacteria | 7388 |
| 271 | Ga0207652_10011127 | 3300025921 | Bacteria | 7252 |
| 272 | Ga0207652_10024692 | 3300025921 | Bacteria | 4988 |
| 273 | Ga0207652_10044981 | 3300025921 | Bacteria | 3763 |
| 274 | Ga0207652_10050197 | 3300025921 | Bacteria | 3574 |
| 275 | Ga0207652_10062448 | 3300025921 | Bacteria | 3219 |
| 276 | Ga0207652_10068825 | 3300025921 | Bacteria | 3072 |
| 277 | Ga0207652_10097260 | 3300025921 | Bacteria | 2594 |
| 278 | Ga0207652_10102470 | 3300025921 | Unclassified | 2530 |
| 279 | Ga0207652_10103519 | 3300025921 | Bacteria | 2517 |
| 280 | Ga0207652_10220810 | 3300025921 | Bacteria | 1708 |
| 281 | Ga0207652_10227067 | 3300025921 | Bacteria | 1683 |
| 282 | Ga0207652_10288821 | 3300025921 | Bacteria | 1480 |
| 283 | Ga0207646_10444510 | 3300025922 | Bacteria | 1170 |
| 284 | Ga0207681_10004225 | 3300025923 | Bacteria | 8870 |
| 285 | Ga0207694_10091178 | 3300025924 | Bacteria | 2405 |
| 286 | Ga0207694_10558747 | 3300025924 | Unclassified | 961 |
| 287 | Ga0207650_10068273 | 3300025925 | Bacteria | 2669 |
| 288 | Ga0207700_10479805 | 3300025928 | Bacteria | 1099 |
| 289 | Ga0207664_10043146 | 3300025929 | Bacteria | 3526 |
| 290 | Ga0207664_10086321 | 3300025929 | Bacteria | 2563 |
| 291 | Ga0207664_10135002 | 3300025929 | Bacteria | 2081 |
| 292 | Ga0207664_10310789 | 3300025929 | Bacteria | 1388 |
| 293 | Ga0207644_10074807 | 3300025931 | Bacteria | 2487 |
| 294 | Ga0207690_10088478 | 3300025932 | Bacteria | 2182 |
| 295 | Ga0207690_10166985 | 3300025932 | Unclassified | 1646 |
| 296 | Ga0207690_10354349 | 3300025932 | Unclassified | 1161 |
| 297 | Ga0207690_10851634 | 3300025932 | Unclassified | 755 |
| 298 | Ga0207706_10135684 | 3300025933 | Bacteria | 2165 |
| 299 | Ga0207686_10037389 | 3300025934 | Bacteria | 2929 |
| 300 | Ga0207670_10098450 | 3300025936 | Bacteria | 2084 |
| 301 | Ga0207669_10324465 | 3300025937 | Bacteria | 1180 |
| 302 | Ga0207704_10034858 | 3300025938 | Bacteria | 2876 |
| 303 | Ga0207665_10000198 | 3300025939 | Bacteria | 40191 |
| 304 | Ga0207691_10013294 | 3300025940 | Bacteria | 7886 |
| 305 | Ga0207691_10022054 | 3300025940 | Bacteria | 6008 |
| 306 | Ga0207691_10077436 | 3300025940 | Bacteria | 2996 |
| 307 | Ga0207691_10153147 | 3300025940 | Bacteria | 2026 |
| 308 | Ga0207689_10094631 | 3300025942 | Bacteria | 2453 |
| 309 | Ga0207661_10000396 | 3300025944 | Bacteria | 28141 |
| 310 | Ga0207661_10003118 | 3300025944 | Bacteria | 11481 |
| 311 | Ga0207661_10027519 | 3300025944 | Bacteria | 4344 |
| 312 | Ga0207661_10053848 | 3300025944 | Bacteria | 3222 |
| 313 | Ga0207661_10055595 | 3300025944 | Bacteria | 3175 |
| 314 | Ga0207661_10066838 | 3300025944 | Bacteria | 2921 |
| 315 | Ga0207661_10080070 | 3300025944 | Bacteria | 2694 |
| 316 | Ga0207661_10092143 | 3300025944 | Bacteria | 2526 |
| 317 | Ga0207661_10234674 | 3300025944 | Unclassified | 1626 |
| 318 | Ga0207661_10439603 | 3300025944 | Bacteria | 1187 |
| 319 | Ga0207661_10648665 | 3300025944 | Bacteria | 970 |
| 320 | Ga0207679_10043078 | 3300025945 | Bacteria | 3248 |
| 321 | Ga0207679_10049674 | 3300025945 | Bacteria | 3062 |
| 322 | Ga0207679_10053749 | 3300025945 | Bacteria | 2961 |
| 323 | Ga0207679_10076991 | 3300025945 | Bacteria | 2536 |
| 324 | Ga0207679_10079509 | 3300025945 | Bacteria | 2501 |
| 325 | Ga0207679_10149467 | 3300025945 | Bacteria | 1899 |
| 326 | Ga0207679_10176164 | 3300025945 | Bacteria | 1765 |
| 327 | Ga0207679_10281061 | 3300025945 | Bacteria | 1427 |
| 328 | Ga0207679_10364579 | 3300025945 | Bacteria | 1263 |
| 329 | Ga0207667_10002650 | 3300025949 | Bacteria | 22117 |
| 330 | Ga0207667_10027226 | 3300025949 | Bacteria | 6228 |
| 331 | Ga0207667_10091232 | 3300025949 | Bacteria | 3148 |
| 332 | Ga0207667_10167022 | 3300025949 | Bacteria | 2262 |
| 333 | Ga0207651_10124061 | 3300025960 | Bacteria | 1964 |
| 334 | Ga0207651_10616280 | 3300025960 | Unclassified | 950 |
| 335 | Ga0207712_10000079 | 3300025961 | Bacteria | 115164 |
| 336 | Ga0207668_10058640 | 3300025972 | Bacteria | 2692 |
| 337 | Ga0207668_10104619 | 3300025972 | Bacteria | 2111 |
| 338 | Ga0207668_10378464 | 3300025972 | Unclassified | 1191 |
| 339 | Ga0207640_10007497 | 3300025981 | Bacteria | 6027 |
| 340 | Ga0207640_10326602 | 3300025981 | Bacteria | 1223 |
| 341 | Ga0207640_10424799 | 3300025981 | Unclassified | 1089 |
| 342 | Ga0207658_10112598 | 3300025986 | Bacteria | 2154 |
| 343 | Ga0207677_10352035 | 3300026023 | Unclassified | 1234 |
| 344 | Ga0207677_10448449 | 3300026023 | Unclassified | 1105 |
| 345 | Ga0207703_10150019 | 3300026035 | Bacteria | 2032 |
| 346 | Ga0207639_10126350 | 3300026041 | Unclassified | 2110 |
| 347 | Ga0207639_10302099 | 3300026041 | Bacteria | 1415 |
| 348 | Ga0207639_10387897 | 3300026041 | Bacteria | 1256 |
| 349 | Ga0207639_10485504 | 3300026041 | Unclassified | 1127 |
| 350 | Ga0207678_10001695 | 3300026067 | Bacteria | 20205 |
| 351 | Ga0207678_10033009 | 3300026067 | Bacteria | 4511 |
| 352 | Ga0207702_10051697 | 3300026078 | Bacteria | 3474 |
| 353 | Ga0207702_10355702 | 3300026078 | Bacteria | 1402 |
| 354 | Ga0207648_10299950 | 3300026089 | Bacteria | 1441 |
| 355 | Ga0207674_10016913 | 3300026116 | Bacteria | 7968 |
| 356 | Ga0207674_10018642 | 3300026116 | Bacteria | 7537 |
| 357 | Ga0207674_10335055 | 3300026116 | Bacteria | 1463 |
| 358 | Ga0207674_10413491 | 3300026116 | Bacteria | 1303 |
| 359 | Ga0207698_10004633 | 3300026142 | Bacteria | 8399 |
| 360 | Ga0207698_10021125 | 3300026142 | Bacteria | 4496 |
| 361 | Ga0207698_10023939 | 3300026142 | Bacteria | 4276 |
| 362 | Ga0207698_10282852 | 3300026142 | Bacteria | 1535 |
| 363 | Ga0207698_10714412 | 3300026142 | Bacteria | 998 |
| 364 | Ga0209998_10011661 | 3300027717 | Bacteria | 1822 |
| 365 | Ga0209974_10057740 | 3300027876 | Bacteria | 1311 |
| 366 | Ga0268266_10479380 | 3300028379 | Unclassified | 1186 |
| 367 | Ga0268264_10150212 | 3300028381 | Bacteria | 2088 |
| 368 | Ga0307408_100010153 | 3300031548 | Bacteria | 6211 |
| 369 | Ga0307408_100168691 | 3300031548 | Unclassified | 1746 |
| 370 | Ga0307408_100247394 | 3300031548 | Bacteria | 1469 |
| 371 | Ga0307408_100455392 | 3300031548 | Unclassified | 1111 |
| 372 | Ga0307405_10000086 | 3300031731 | Bacteria | 39376 |
| 373 | Ga0307405_10018983 | 3300031731 | Bacteria | 3808 |
| 374 | Ga0307405_10239465 | 3300031731 | Bacteria | 1343 |
| 375 | Ga0307405_10419185 | 3300031731 | Bacteria | 1053 |
| 376 | Ga0307405_10630474 | 3300031731 | Bacteria | 879 |
| 377 | Ga0307410_10000638 | 3300031852 | Bacteria | 14477 |
| 378 | Ga0307410_10015895 | 3300031852 | Bacteria | 4473 |
| 379 | Ga0307410_10027010 | 3300031852 | Bacteria | 3623 |
| 380 | Ga0307410_10079816 | 3300031852 | Bacteria | 2294 |
| 381 | Ga0307410_10100501 | 3300031852 | Bacteria | 2072 |
| 382 | Ga0307410_10165506 | 3300031852 | Bacteria | 1661 |
| 383 | Ga0307406_10000581 | 3300031901 | Bacteria | 21084 |
| 384 | Ga0307406_10014298 | 3300031901 | Bacteria | 4564 |
| 385 | Ga0307406_10091223 | 3300031901 | Bacteria | 2052 |
| 386 | Ga0307406_10120095 | 3300031901 | Bacteria | 1826 |
| 387 | Ga0307407_10000133 | 3300031903 | Bacteria | 22779 |
| 388 | Ga0307407_10007413 | 3300031903 | Bacteria | 4968 |
| 389 | Ga0307407_10079094 | 3300031903 | Bacteria | 1983 |
| 390 | Ga0307407_10112876 | 3300031903 | Bacteria | 1709 |
| 391 | Ga0307407_10204886 | 3300031903 | Unclassified | 1324 |
| 392 | Ga0307412_10011207 | 3300031911 | Bacteria | 5187 |
| 393 | Ga0307412_10295987 | 3300031911 | Unclassified | 1277 |
| 394 | Ga0307409_100000277 | 3300031995 | Bacteria | 20763 |
| 395 | Ga0307409_100008908 | 3300031995 | Bacteria | 6128 |
| 396 | Ga0307409_100045955 | 3300031995 | Bacteria | 3301 |
| 397 | Ga0307409_100269100 | 3300031995 | Bacteria | 1568 |
| 398 | Ga0307409_100371342 | 3300031995 | Unclassified | 1357 |
| 399 | Ga0307416_100001149 | 3300032002 | Bacteria | 14224 |
| 400 | Ga0307416_100034188 | 3300032002 | Bacteria | 3865 |
| 401 | Ga0307416_100077096 | 3300032002 | Bacteria | 2798 |
| 402 | Ga0307414_10012313 | 3300032004 | Bacteria | 5052 |
| 403 | Ga0307414_10477417 | 3300032004 | Archaea | 1099 |
| 404 | Ga0307411_10040426 | 3300032005 | Bacteria | 2958 |
| 405 | Ga0307411_10056691 | 3300032005 | Bacteria | 2584 |
| 406 | Ga0307411_10157443 | 3300032005 | Bacteria | 1696 |
| 407 | Ga0307411_10258392 | 3300032005 | Unclassified | 1374 |
| 408 | Ga0307411_10453040 | 3300032005 | Bacteria | 1074 |
| 409 | Ga0307411_10648487 | 3300032005 | Unclassified | 914 |
| 410 | Ga0307415_100001402 | 3300032126 | Bacteria | 11511 |
| 411 | Ga0307415_100013088 | 3300032126 | Bacteria | 4827 |
| 412 | Ga0307415_100033395 | 3300032126 | Bacteria | 3340 |
| 413 | Ga0307415_100222247 | 3300032126 | Unclassified | 1515 |
| 414 | Ga0373934_0000531 | 3300035086 | Bacteria | 13482 |
| 415 | Ga0373923_0003955 | 3300035111 | Bacteria | 4841 |
| 416 | Ga0373953_0001218 | 3300035117 | Bacteria | 7332 |
| 417 | Ga0373956_0084675 | 3300035119 | Bacteria | 1457 |
| 418 | Ga0373946_0083739 | 3300035171 | Unclassified | 1401 |
| 419 | Ga0373955_0000269 | 3300035172 | Bacteria | 21687 |
| 420 | Ga0373935_0285752 | 3300035692 | Bacteria | 1162 |
| 421 | Ga0373933_0000055 | 3300035724 | Bacteria | 67484 |
| 422 | Ga0373937_0000420 | 3300036401 | Bacteria | 39552 |
| 423 | Ga0373937_0133184 | 3300036401 | Bacteria | 2323 |
| 424 | Ga0373937_0588843 | 3300036401 | Bacteria | 1056 |
| 425 | Ga0395899_0037444 | 3300037312 | Bacteria | 3636 |
| 426 | Ga0395900_0080139 | 3300037418 | Bacteria | 3355 |
| 427 | Ga0395905_0004043 | 3300037471 | Bacteria | 15393 |
| 428 | Ga0395905_0108035 | 3300037471 | Bacteria | 2612 |
| 429 | Ga0395901_0002608 | 3300038443 | Bacteria | 18254 |
| 430 | Ga0436365_0815860 | 3300039437 | Bacteria | 13587 |
| 431 | Ga0436365_0880704 | 3300039437 | Bacteria | 1047 |
| 432 | Ga0466966_0026042 | 3300044684 | Bacteria | 3819 |
| 433 | Ga0466959_0067918 | 3300045049 | Bacteria | 2583 |
| 434 | Ga0451576_0025000 | 3300045051 | Bacteria | 6441 |
| 435 | Ga0466967_0911658 | 3300045976 | Bacteria | 874 |
| 436 | Ga0495592_0000395 | 3300046454 | Bacteria | 33972 |
| 437 | Ga0495629_0024246 | 3300046459 | Bacteria | 4319 |
| 438 | Ga0495651_0000287 | 3300046462 | Bacteria | 39077 |
| 439 | Ga0495653_0000232 | 3300046463 | Bacteria | 45432 |
| 440 | Ga0495653_0019392 | 3300046463 | Bacteria | 5516 |
| 441 | Ga0495653_0160843 | 3300046463 | Bacteria | 1559 |
| 442 | Ga0495662_0028572 | 3300046476 | Bacteria | 2692 |
| 443 | Ga0495664_0131602 | 3300046477 | Bacteria | 1515 |
| 444 | Ga0495594_0046600 | 3300046499 | Bacteria | 2381 |
| 445 | Ga0495608_0000085 | 3300046511 | Bacteria | 68124 |
| 446 | Ga0495608_0023173 | 3300046511 | Bacteria | 4256 |
| 447 | Ga0495618_0261465 | 3300046514 | Bacteria | 1084 |
| 448 | Ga0495628_0000154 | 3300046516 | Bacteria | 59770 |
| 449 | Ga0495628_0106170 | 3300046516 | Bacteria | 2163 |
| 450 | Ga0495630_0002303 | 3300046517 | Bacteria | 13287 |
| 451 | Ga0495630_0016436 | 3300046517 | Bacteria | 5407 |
| 452 | Ga0495643_0149651 | 3300046522 | Unclassified | 1157 |
| 453 | Ga0495652_0066322 | 3300046529 | Bacteria | 3030 |
| 454 | Ga0495652_0083037 | 3300046529 | Bacteria | 2638 |
| 455 | Ga0495652_0109755 | 3300046529 | Bacteria | 2220 |
| 456 | Ga0495665_0029677 | 3300046531 | Bacteria | 2930 |
| 457 | Ga0495665_0228155 | 3300046531 | Bacteria | 962 |
| 458 | Ga0495640_0019289 | 3300046533 | Bacteria | 5036 |
| 459 | Ga0495586_0061427 | 3300046535 | Bacteria | 2045 |
| 460 | Ga0495586_0075232 | 3300046535 | Unclassified | 1849 |
| 461 | Ga0495586_0138057 | 3300046535 | Unclassified | 1367 |
| 462 | Ga0495587_0000678 | 3300046536 | Bacteria | 22835 |
| 463 | Ga0495598_0042834 | 3300046537 | Bacteria | 1331 |
| 464 | Ga0495645_0000763 | 3300046543 | Bacteria | 21977 |
| 465 | Ga0495645_0075387 | 3300046543 | Bacteria | 2428 |
| 466 | Ga0495645_0217604 | 3300046543 | Bacteria | 1286 |
| 467 | Ga0495667_0006064 | 3300046559 | Bacteria | 8179 |
| 468 | Ga0495667_0053080 | 3300046559 | Bacteria | 2670 |
| 469 | Ga0495634_0101898 | 3300046642 | Bacteria | 1854 |
| 470 | Ga0495635_0000219 | 3300046663 | Bacteria | 36123 |
| 471 | Ga0495657_0001169 | 3300046675 | Bacteria | 22972 |
| 472 | Ga0495599_0000320 | 3300046678 | Bacteria | 28749 |
| 473 | Ga0495599_0124369 | 3300046678 | Bacteria | 1603 |
| 474 | Ga0495623_0000750 | 3300046679 | Bacteria | 21746 |
| 475 | Ga0495623_0155241 | 3300046679 | Bacteria | 1349 |
| 476 | Ga0495623_0172514 | 3300046679 | Bacteria | 1262 |
| 477 | Ga0495646_0033128 | 3300046680 | Bacteria | 3213 |
| 478 | Ga0495669_0045989 | 3300046684 | Bacteria | 1947 |
| 479 | Ga0495613_0005521 | 3300046689 | Bacteria | 9495 |
| 480 | Ga0495613_0155337 | 3300046689 | Bacteria | 1630 |
| 481 | Ga0495613_0155426 | 3300046689 | Bacteria | 1630 |
| 482 | Ga0495624_0019553 | 3300046690 | Bacteria | 4518 |
| 483 | Ga0495600_0000023 | 3300046809 | Bacteria | 94401 |
| 484 | Ga0495600_0025717 | 3300046809 | Bacteria | 3794 |
| 485 | Ga0495600_0163616 | 3300046809 | Bacteria | 1438 |
| 486 | Ga0495604_0013275 | 3300047317 | Bacteria | 6559 |
| 487 | Ga0495604_0024747 | 3300047317 | Bacteria | 4790 |
| 488 | Ga0495604_0049782 | 3300047317 | Bacteria | 3253 |
| 489 | Ga0495604_0089057 | 3300047317 | Bacteria | 2295 |
| 490 | Ga0495636_0148244 | 3300047318 | Bacteria | 1051 |
| 491 | Ga0495674_0002240 | 3300047319 | Bacteria | 19005 |
| 492 | Ga0495674_0072646 | 3300047319 | Bacteria | 2967 |
| 493 | Ga0495680_0005182 | 3300047322 | Bacteria | 12300 |
| 494 | Ga0495680_0007752 | 3300047322 | Bacteria | 9805 |
| 495 | Ga0495684_0000037 | 3300047471 | Bacteria | 106933 |
| 496 | Ga0495684_0018749 | 3300047471 | Bacteria | 5330 |
| 497 | Ga0495684_0102052 | 3300047471 | Bacteria | 2168 |
| 498 | Ga0495593_0201456 | 3300047673 | Bacteria | 1000 |
| 499 | Ga0495602_0000290 | 3300048088 | Bacteria | 46018 |
| 500 | Ga0496100_0267906 | 3300048903 | Bacteria | 1269 |
| 501 | Ga0496101_0017130 | 3300048904 | Bacteria | 4910 |
| 502 | Ga0496101_0196815 | 3300048904 | Bacteria | 1557 |
| 503 | Ga0496104_0204952 | 3300048907 | Bacteria | 1884 |
| 504 | Ga0496107_0384916 | 3300048910 | Bacteria | 1043 |
| 505 | Ga0496109_0240208 | 3300048912 | Bacteria | 1705 |
| 506 | Ga0496112_0160171 | 3300048915 | Unclassified | 2217 |
| 507 | Ga0496112_0195710 | 3300048915 | Bacteria | 1982 |
| 508 | Ga0496112_0575124 | 3300048915 | Bacteria | 1059 |
| 509 | Ga0496113_0390944 | 3300048916 | Bacteria | 1116 |
| 510 | Ga0496114_0086057 | 3300048917 | Bacteria | 2663 |
| 511 | Ga0501033_0045560 | 3300049570 | Bacteria | 3264 |
| 512 | Ga0501034_0056683 | 3300049571 | Bacteria | 3942 |
| 513 | Ga0501038_0376991 | 3300049574 | Bacteria | 1101 |
| 514 | Ga0501040_0124653 | 3300049576 | Bacteria | 1809 |
| 515 | Ga0501042_0100797 | 3300049578 | Bacteria | 2076 |
| 516 | Ga0501043_0059360 | 3300049579 | Bacteria | 3002 |
| 517 | Ga0501046_0219822 | 3300049580 | Bacteria | 1407 |
| 518 | Ga0501046_0348756 | 3300049580 | Bacteria | 1075 |
| 519 | Ga0501047_0015612 | 3300049581 | Bacteria | 7237 |
| 520 | Ga0501047_0220257 | 3300049581 | Bacteria | 1754 |
| 521 | Ga0501070_0026560 | 3300049586 | Bacteria | 4858 |
| 522 | Ga0501073_0042080 | 3300049589 | Bacteria | 3226 |
| 523 | Ga0501075_0030063 | 3300049591 | Bacteria | 4021 |
| 524 | Ga0501076_0756068 | 3300049592 | Bacteria | 802 |
| 525 | Ga0501225_0003383 | 3300049705 | Bacteria | 4843 |
| 526 | Ga0501079_0041662 | 3300049741 | Bacteria | 3546 |
| 527 | Ga0501080_0117637 | 3300049742 | Bacteria | 2464 |
| 528 | Ga0501081_0121629 | 3300049743 | Bacteria | 1860 |
| 529 | Ga0501268_008688 | 3300049765 | Bacteria | 1545 |
| 530 | Ga0501035_0212432 | 3300049822 | Bacteria | 1655 |
| 531 | Ga0501044_0388546 | 3300049823 | Bacteria | 1310 |
| 532 | Ga0501044_0880528 | 3300049823 | Unclassified | 771 |
| 533 | nmdc:mga05p37_30138_c1 | 3300050507 | Bacteria | 6620 |
| 534 | nmdc:mga0qj67_164398_c1 | 3300050509 | Bacteria | 1801 |
| 535 | nmdc:mga06r32_114706_c1 | 3300050510 | Unclassified | 2652 |
| 536 | nmdc:mga0n895_156084_c1 | 3300050512 | Bacteria | 2313 |
| 537 | nmdc:mga0n895_396329_c1 | 3300050512 | Bacteria | 1396 |
| 538 | nmdc:mga08x19_33339_c1 | 3300050514 | Bacteria | 3250 |
| 539 | Ga0495601_0014940 | 3300053077 | Bacteria | 4687 |
| 540 | Ga0495612_0000437 | 3300053078 | Bacteria | 16652 |
| 541 | Ga0495619_0003858 | 3300053085 | Bacteria | 9647 |
| 542 | Ga0501082_0229146 | 3300060353 | Bacteria | 1617 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031852 | Ga0307410_10015895 | Ga0307410_100158954 | 222 |
| 2 | 3300031903 | Ga0307407_10007413 | Ga0307407_100074132 | 222 |
| 3 | 3300032002 | Ga0307416_100034188 | Ga0307416_1000341882 | 222 |
| 4 | 3300032004 | Ga0307414_10012313 | Ga0307414_100123134 | 222 |
| 5 | 3300032126 | Ga0307415_100033395 | Ga0307415_1000333953 | 222 |
| 6 | 3300031903 | Ga0307407_10204886 | Ga0307407_102048862 | 223 |
| 7 | 3300032005 | Ga0307411_10258392 | Ga0307411_102583922 | 223 |
| 8 | 3300032126 | Ga0307415_100222247 | Ga0307415_1002222472 | 223 |
| 9 | 3300036401 | Ga0373937_0133184 | Ga0373937_0133184_75_770 | 223 |
| 10 | 3300039437 | Ga0436365_0880704 | Ga0436365_0880704_355_1035 | 223 |
| 11 | 3300048912 | Ga0496109_0240208 | Ga0496109_0240208_950_1621 | 223 |
| 12 | 3300005336 | Ga0070680_100324151 | Ga0070680_1003241512 | 225 |
| 13 | 3300013104 | Ga0157370_10323261 | Ga0157370_103232612 | 225 |
| 14 | 3300049592 | Ga0501076_0756068 | Ga0501076_0756068_76_753 | 225 |
| 15 | 3300049765 | Ga0501268_008688 | Ga0501268_008688_22_699 | 225 |
| 16 | 3300005327 | Ga0070658_10085533 | Ga0070658_100855332 | 227 |
| 17 | 3300005329 | Ga0070683_100433634 | Ga0070683_1004336341 | 227 |
| 18 | 3300005530 | Ga0070679_100270846 | Ga0070679_1002708462 | 227 |
| 19 | 3300005563 | Ga0068855_100207547 | Ga0068855_1002075472 | 227 |
| 20 | 3300005578 | Ga0068854_100020094 | Ga0068854_1000200944 | 227 |
| 21 | 3300005616 | Ga0068852_100006758 | Ga0068852_1000067582 | 227 |
| 22 | 3300005616 | Ga0068852_100091962 | Ga0068852_1000919624 | 227 |
| 23 | 3300009093 | Ga0105240_10106246 | Ga0105240_101062464 | 227 |
| 24 | 3300009174 | Ga0105241_10595049 | Ga0105241_105950492 | 227 |
| 25 | 3300013102 | Ga0157371_10004747 | Ga0157371_100047472 | 227 |
| 26 | 3300013105 | Ga0157369_10036846 | Ga0157369_100368466 | 227 |
| 27 | 3300013105 | Ga0157369_10206332 | Ga0157369_102063322 | 227 |
| 28 | 3300013307 | Ga0157372_10011056 | Ga0157372_100110562 | 227 |
| 29 | 3300025909 | Ga0207705_10024091 | Ga0207705_100240912 | 227 |
| 30 | 3300025909 | Ga0207705_10259981 | Ga0207705_102599812 | 227 |
| 31 | 3300025912 | Ga0207707_10479794 | Ga0207707_104797941 | 227 |
| 32 | 3300025913 | Ga0207695_10065117 | Ga0207695_100651172 | 227 |
| 33 | 3300025917 | Ga0207660_10063778 | Ga0207660_100637783 | 227 |
| 34 | 3300025919 | Ga0207657_10010260 | Ga0207657_100102605 | 227 |
| 35 | 3300025921 | Ga0207652_10044981 | Ga0207652_100449812 | 227 |
| 36 | 3300025921 | Ga0207652_10227067 | Ga0207652_102270672 | 227 |
| 37 | 3300025949 | Ga0207667_10002650 | Ga0207667_1000265020 | 227 |
| 38 | 3300025949 | Ga0207667_10167022 | Ga0207667_101670224 | 227 |
| 39 | 3300026067 | Ga0207678_10001695 | Ga0207678_100016955 | 227 |
| 40 | 3300026078 | Ga0207702_10355702 | Ga0207702_103557021 | 227 |
| 41 | 3300026142 | Ga0207698_10004633 | Ga0207698_1000463310 | 227 |
| 42 | 3300026142 | Ga0207698_10021125 | Ga0207698_100211253 | 227 |
| 43 | 3300046463 | Ga0495653_0160843 | Ga0495653_0160843_864_1547 | 227 |
| 44 | 3300046535 | Ga0495586_0075232 | Ga0495586_0075232_77_766 | 227 |
| 45 | 3300046809 | Ga0495600_0025717 | Ga0495600_0025717_2350_3039 | 227 |
| 46 | 3300005344 | Ga0070661_100201783 | Ga0070661_1002017832 | 228 |
| 47 | 3300005535 | Ga0070684_100180074 | Ga0070684_1001800742 | 228 |
| 48 | 3300005547 | Ga0070693_100066908 | Ga0070693_1000669082 | 228 |
| 49 | 3300005549 | Ga0070704_100213982 | Ga0070704_1002139822 | 228 |
| 50 | 3300005563 | Ga0068855_100176673 | Ga0068855_1001766732 | 228 |
| 51 | 3300006871 | Ga0075434_100040261 | Ga0075434_1000402614 | 228 |
| 52 | 3300013296 | Ga0157374_10714115 | Ga0157374_107141152 | 228 |
| 53 | 3300013307 | Ga0157372_10114009 | Ga0157372_101140093 | 228 |
| 54 | 3300013308 | Ga0157375_10698125 | Ga0157375_106981252 | 228 |
| 55 | 3300025921 | Ga0207652_10288821 | Ga0207652_102888211 | 228 |
| 56 | 3300025932 | Ga0207690_10354349 | Ga0207690_103543492 | 228 |
| 57 | 3300025940 | Ga0207691_10022054 | Ga0207691_100220547 | 228 |
| 58 | 3300025940 | Ga0207691_10153147 | Ga0207691_101531472 | 228 |
| 59 | 3300026041 | Ga0207639_10485504 | Ga0207639_104855042 | 228 |
| 60 | 3300044684 | Ga0466966_0026042 | Ga0466966_0026042_1932_2630 | 228 |
| 61 | 3300045049 | Ga0466959_0067918 | Ga0466959_0067918_1705_2403 | 228 |
| 62 | 3300046463 | Ga0495653_0019392 | Ga0495653_0019392_2446_3141 | 228 |
| 63 | 3300046476 | Ga0495662_0028572 | Ga0495662_0028572_1811_2506 | 228 |
| 64 | 3300046511 | Ga0495608_0023173 | Ga0495608_0023173_260_955 | 228 |
| 65 | 3300046517 | Ga0495630_0016436 | Ga0495630_0016436_2672_3367 | 228 |
| 66 | 3300046529 | Ga0495652_0066322 | Ga0495652_0066322_1975_2670 | 228 |
| 67 | 3300046533 | Ga0495640_0019289 | Ga0495640_0019289_939_1634 | 228 |
| 68 | 3300046535 | Ga0495586_0138057 | Ga0495586_0138057_600_1295 | 228 |
| 69 | 3300046543 | Ga0495645_0075387 | Ga0495645_0075387_1647_2342 | 228 |
| 70 | 3300046559 | Ga0495667_0006064 | Ga0495667_0006064_2570_3265 | 228 |
| 71 | 3300046679 | Ga0495623_0155241 | Ga0495623_0155241_448_1143 | 228 |
| 72 | 3300046689 | Ga0495613_0005521 | Ga0495613_0005521_351_1046 | 228 |
| 73 | 3300046690 | Ga0495624_0019553 | Ga0495624_0019553_1853_2548 | 228 |
| 74 | 3300047317 | Ga0495604_0049782 | Ga0495604_0049782_2448_3143 | 228 |
| 75 | 3300047322 | Ga0495680_0007752 | Ga0495680_0007752_2555_3250 | 228 |
| 76 | 3300047471 | Ga0495684_0102052 | Ga0495684_0102052_214_909 | 228 |
| 77 | 3300005329 | Ga0070683_100033236 | Ga0070683_1000332366 | 229 |
| 78 | 3300005329 | Ga0070683_100193019 | Ga0070683_1001930193 | 229 |
| 79 | 3300005329 | Ga0070683_100462258 | Ga0070683_1004622581 | 229 |
| 80 | 3300005336 | Ga0070680_100012380 | Ga0070680_1000123805 | 229 |
| 81 | 3300005336 | Ga0070680_100360891 | Ga0070680_1003608912 | 229 |
| 82 | 3300005339 | Ga0070660_100027478 | Ga0070660_1000274784 | 229 |
| 83 | 3300005344 | Ga0070661_100039113 | Ga0070661_1000391132 | 229 |
| 84 | 3300005344 | Ga0070661_100240049 | Ga0070661_1002400492 | 229 |
| 85 | 3300005347 | Ga0070668_100052116 | Ga0070668_1000521162 | 229 |
| 86 | 3300005435 | Ga0070714_100071359 | Ga0070714_1000713592 | 229 |
| 87 | 3300005436 | Ga0070713_100499072 | Ga0070713_1004990722 | 229 |
| 88 | 3300005455 | Ga0070663_100104486 | Ga0070663_1001044861 | 229 |
| 89 | 3300005458 | Ga0070681_10009065 | Ga0070681_100090658 | 229 |
| 90 | 3300005458 | Ga0070681_10019285 | Ga0070681_100192857 | 229 |
| 91 | 3300005458 | Ga0070681_10116754 | Ga0070681_101167542 | 229 |
| 92 | 3300005467 | Ga0070706_100117976 | Ga0070706_1001179762 | 229 |
| 93 | 3300005471 | Ga0070698_100009181 | Ga0070698_1000091819 | 229 |
| 94 | 3300005530 | Ga0070679_100050251 | Ga0070679_1000502515 | 229 |
| 95 | 3300005545 | Ga0070695_100013296 | Ga0070695_1000132963 | 229 |
| 96 | 3300005545 | Ga0070695_100043750 | Ga0070695_1000437504 | 229 |
| 97 | 3300005563 | Ga0068855_100001981 | Ga0068855_10000198111 | 229 |
| 98 | 3300005563 | Ga0068855_100020328 | Ga0068855_1000203283 | 229 |
| 99 | 3300005564 | Ga0070664_100051515 | Ga0070664_1000515152 | 229 |
| 100 | 3300005564 | Ga0070664_100178802 | Ga0070664_1001788022 | 229 |
| 101 | 3300005564 | Ga0070664_100353951 | Ga0070664_1003539512 | 229 |
| 102 | 3300005578 | Ga0068854_100051140 | Ga0068854_1000511403 | 229 |
| 103 | 3300005614 | Ga0068856_100096514 | Ga0068856_1000965142 | 229 |
| 104 | 3300005937 | Ga0081455_10005471 | Ga0081455_100054712 | 229 |
| 105 | 3300005985 | Ga0081539_10052432 | Ga0081539_100524322 | 229 |
| 106 | 3300006028 | Ga0070717_10263902 | Ga0070717_102639022 | 229 |
| 107 | 3300006871 | Ga0075434_100103806 | Ga0075434_1001038062 | 229 |
| 108 | 3300009093 | Ga0105240_10426661 | Ga0105240_104266612 | 229 |
| 109 | 3300009551 | Ga0105238_10004780 | Ga0105238_100047809 | 229 |
| 110 | 3300009551 | Ga0105238_10839742 | Ga0105238_108397421 | 229 |
| 111 | 3300009553 | Ga0105249_10000078 | Ga0105249_1000007888 | 229 |
| 112 | 3300010375 | Ga0105239_10308482 | Ga0105239_103084822 | 229 |
| 113 | 3300013105 | Ga0157369_10102589 | Ga0157369_101025892 | 229 |
| 114 | 3300013105 | Ga0157369_10117744 | Ga0157369_101177444 | 229 |
| 115 | 3300013296 | Ga0157374_10685553 | Ga0157374_106855532 | 229 |
| 116 | 3300013307 | Ga0157372_10017343 | Ga0157372_100173434 | 229 |
| 117 | 3300014497 | Ga0182008_10005605 | Ga0182008_100056058 | 229 |
| 118 | 3300025912 | Ga0207707_10000322 | Ga0207707_1000032233 | 229 |
| 119 | 3300025912 | Ga0207707_10015989 | Ga0207707_100159892 | 229 |
| 120 | 3300025912 | Ga0207707_10667255 | Ga0207707_106672552 | 229 |
| 121 | 3300025917 | Ga0207660_10080514 | Ga0207660_100805143 | 229 |
| 122 | 3300025917 | Ga0207660_10100050 | Ga0207660_101000502 | 229 |
| 123 | 3300025917 | Ga0207660_10143950 | Ga0207660_101439502 | 229 |
| 124 | 3300025919 | Ga0207657_10018154 | Ga0207657_100181542 | 229 |
| 125 | 3300025920 | Ga0207649_10155453 | Ga0207649_101554532 | 229 |
| 126 | 3300025921 | Ga0207652_10097260 | Ga0207652_100972602 | 229 |
| 127 | 3300025921 | Ga0207652_10103519 | Ga0207652_101035194 | 229 |
| 128 | 3300025922 | Ga0207646_10444510 | Ga0207646_104445102 | 229 |
| 129 | 3300025924 | Ga0207694_10558747 | Ga0207694_105587471 | 229 |
| 130 | 3300025929 | Ga0207664_10135002 | Ga0207664_101350022 | 229 |
| 131 | 3300025929 | Ga0207664_10310789 | Ga0207664_103107892 | 229 |
| 132 | 3300025944 | Ga0207661_10439603 | Ga0207661_104396032 | 229 |
| 133 | 3300025944 | Ga0207661_10648665 | Ga0207661_106486652 | 229 |
| 134 | 3300025945 | Ga0207679_10043078 | Ga0207679_100430784 | 229 |
| 135 | 3300025945 | Ga0207679_10149467 | Ga0207679_101494672 | 229 |
| 136 | 3300025945 | Ga0207679_10281061 | Ga0207679_102810612 | 229 |
| 137 | 3300025949 | Ga0207667_10027226 | Ga0207667_100272262 | 229 |
| 138 | 3300025961 | Ga0207712_10000079 | Ga0207712_1000007919 | 229 |
| 139 | 3300025981 | Ga0207640_10326602 | Ga0207640_103266022 | 229 |
| 140 | 3300025981 | Ga0207640_10424799 | Ga0207640_104247992 | 229 |
| 141 | 3300026041 | Ga0207639_10126350 | Ga0207639_101263502 | 229 |
| 142 | 3300026067 | Ga0207678_10033009 | Ga0207678_100330092 | 229 |
| 143 | 3300026078 | Ga0207702_10051697 | Ga0207702_100516972 | 229 |
| 144 | 3300026142 | Ga0207698_10282852 | Ga0207698_102828522 | 229 |
| 145 | 3300027717 | Ga0209998_10011661 | Ga0209998_100116612 | 229 |
| 146 | 3300027876 | Ga0209974_10057740 | Ga0209974_100577402 | 229 |
| 147 | 3300031548 | Ga0307408_100168691 | Ga0307408_1001686912 | 229 |
| 148 | 3300031852 | Ga0307410_10027010 | Ga0307410_100270102 | 229 |
| 149 | 3300031911 | Ga0307412_10295987 | Ga0307412_102959872 | 229 |
| 150 | 3300032005 | Ga0307411_10157443 | Ga0307411_101574432 | 229 |
| 151 | 3300032005 | Ga0307411_10648487 | Ga0307411_106484872 | 229 |
| 152 | 3300035171 | Ga0373946_0083739 | Ga0373946_0083739_29_718 | 229 |
| 153 | 3300035692 | Ga0373935_0285752 | Ga0373935_0285752_297_986 | 229 |
| 154 | 3300045051 | Ga0451576_0025000 | Ga0451576_0025000_4435_5136 | 229 |
| 155 | 3300045976 | Ga0466967_0911658 | Ga0466967_0911658_102_800 | 229 |
| 156 | 3300046477 | Ga0495664_0131602 | Ga0495664_0131602_768_1466 | 229 |
| 157 | 3300046516 | Ga0495628_0106170 | Ga0495628_0106170_1435_2133 | 229 |
| 158 | 3300046522 | Ga0495643_0149651 | Ga0495643_0149651_435_1124 | 229 |
| 159 | 3300046529 | Ga0495652_0109755 | Ga0495652_0109755_468_1166 | 229 |
| 160 | 3300046531 | Ga0495665_0228155 | Ga0495665_0228155_198_896 | 229 |
| 161 | 3300046543 | Ga0495645_0217604 | Ga0495645_0217604_333_1031 | 229 |
| 162 | 3300046559 | Ga0495667_0053080 | Ga0495667_0053080_344_1042 | 229 |
| 163 | 3300046678 | Ga0495599_0124369 | Ga0495599_0124369_127_825 | 229 |
| 164 | 3300046689 | Ga0495613_0155426 | Ga0495613_0155426_106_804 | 229 |
| 165 | 3300047317 | Ga0495604_0089057 | Ga0495604_0089057_862_1560 | 229 |
| 166 | 3300047318 | Ga0495636_0148244 | Ga0495636_0148244_46_738 | 229 |
| 167 | 3300047319 | Ga0495674_0072646 | Ga0495674_0072646_1085_1783 | 229 |
| 168 | 3300047471 | Ga0495684_0018749 | Ga0495684_0018749_962_1660 | 229 |
| 169 | 3300048915 | Ga0496112_0160171 | Ga0496112_0160171_106_795 | 229 |
| 170 | 3300048915 | Ga0496112_0575124 | Ga0496112_0575124_321_1010 | 229 |
| 171 | 3300049705 | Ga0501225_0003383 | Ga0501225_0003383_89_778 | 229 |
| 172 | 3300050512 | nmdc:mga0n895_156084_c1 | nmdc:mga0n895_156084_c1_839_1540 | 229 |
| 173 | 3300005327 | Ga0070658_10021716 | Ga0070658_100217163 | 230 |
| 174 | 3300005327 | Ga0070658_10216962 | Ga0070658_102169622 | 230 |
| 175 | 3300005328 | Ga0070676_10029249 | Ga0070676_100292492 | 230 |
| 176 | 3300005328 | Ga0070676_10245083 | Ga0070676_102450832 | 230 |
| 177 | 3300005329 | Ga0070683_100019956 | Ga0070683_1000199564 | 230 |
| 178 | 3300005329 | Ga0070683_100021893 | Ga0070683_1000218935 | 230 |
| 179 | 3300005329 | Ga0070683_100056412 | Ga0070683_1000564122 | 230 |
| 180 | 3300005336 | Ga0070680_100007216 | Ga0070680_1000072169 | 230 |
| 181 | 3300005336 | Ga0070680_100020001 | Ga0070680_1000200014 | 230 |
| 182 | 3300005336 | Ga0070680_100020872 | Ga0070680_1000208724 | 230 |
| 183 | 3300005336 | Ga0070680_100030342 | Ga0070680_1000303422 | 230 |
| 184 | 3300005337 | Ga0070682_100523393 | Ga0070682_1005233931 | 230 |
| 185 | 3300005338 | Ga0068868_100302523 | Ga0068868_1003025232 | 230 |
| 186 | 3300005339 | Ga0070660_100255466 | Ga0070660_1002554662 | 230 |
| 187 | 3300005339 | Ga0070660_100574027 | Ga0070660_1005740272 | 230 |
| 188 | 3300005340 | Ga0070689_100017373 | Ga0070689_1000173735 | 230 |
| 189 | 3300005341 | Ga0070691_10165939 | Ga0070691_101659392 | 230 |
| 190 | 3300005344 | Ga0070661_100025402 | Ga0070661_1000254024 | 230 |
| 191 | 3300005344 | Ga0070661_100034765 | Ga0070661_1000347654 | 230 |
| 192 | 3300005344 | Ga0070661_100070396 | Ga0070661_1000703962 | 230 |
| 193 | 3300005344 | Ga0070661_100153466 | Ga0070661_1001534662 | 230 |
| 194 | 3300005344 | Ga0070661_100215421 | Ga0070661_1002154212 | 230 |
| 195 | 3300005344 | Ga0070661_100329490 | Ga0070661_1003294902 | 230 |
| 196 | 3300005345 | Ga0070692_10195547 | Ga0070692_101955472 | 230 |
| 197 | 3300005347 | Ga0070668_100010325 | Ga0070668_1000103253 | 230 |
| 198 | 3300005347 | Ga0070668_100082570 | Ga0070668_1000825702 | 230 |
| 199 | 3300005347 | Ga0070668_100234516 | Ga0070668_1002345162 | 230 |
| 200 | 3300005353 | Ga0070669_100009190 | Ga0070669_1000091907 | 230 |
| 201 | 3300005354 | Ga0070675_100007808 | Ga0070675_1000078082 | 230 |
| 202 | 3300005354 | Ga0070675_100030937 | Ga0070675_1000309373 | 230 |
| 203 | 3300005355 | Ga0070671_100043066 | Ga0070671_1000430663 | 230 |
| 204 | 3300005355 | Ga0070671_100240416 | Ga0070671_1002404162 | 230 |
| 205 | 3300005355 | Ga0070671_100813311 | Ga0070671_1008133111 | 230 |
| 206 | 3300005364 | Ga0070673_100058044 | Ga0070673_1000580443 | 230 |
| 207 | 3300005364 | Ga0070673_100385644 | Ga0070673_1003856443 | 230 |
| 208 | 3300005364 | Ga0070673_100428441 | Ga0070673_1004284411 | 230 |
| 209 | 3300005364 | Ga0070673_100477571 | Ga0070673_1004775712 | 230 |
| 210 | 3300005365 | Ga0070688_100019852 | Ga0070688_1000198522 | 230 |
| 211 | 3300005365 | Ga0070688_100046098 | Ga0070688_1000460982 | 230 |
| 212 | 3300005366 | Ga0070659_100035705 | Ga0070659_1000357054 | 230 |
| 213 | 3300005366 | Ga0070659_100433969 | Ga0070659_1004339691 | 230 |
| 214 | 3300005367 | Ga0070667_100067569 | Ga0070667_1000675693 | 230 |
| 215 | 3300005367 | Ga0070667_100375065 | Ga0070667_1003750652 | 230 |
| 216 | 3300005434 | Ga0070709_10007406 | Ga0070709_100074062 | 230 |
| 217 | 3300005435 | Ga0070714_100007479 | Ga0070714_1000074794 | 230 |
| 218 | 3300005437 | Ga0070710_10024779 | Ga0070710_100247792 | 230 |
| 219 | 3300005438 | Ga0070701_10203397 | Ga0070701_102033971 | 230 |
| 220 | 3300005439 | Ga0070711_100242343 | Ga0070711_1002423432 | 230 |
| 221 | 3300005444 | Ga0070694_100362838 | Ga0070694_1003628382 | 230 |
| 222 | 3300005455 | Ga0070663_100228598 | Ga0070663_1002285982 | 230 |
| 223 | 3300005458 | Ga0070681_10000631 | Ga0070681_1000063117 | 230 |
| 224 | 3300005458 | Ga0070681_10001027 | Ga0070681_1000102725 | 230 |
| 225 | 3300005458 | Ga0070681_10006014 | Ga0070681_100060147 | 230 |
| 226 | 3300005458 | Ga0070681_10025940 | Ga0070681_100259403 | 230 |
| 227 | 3300005458 | Ga0070681_10212643 | Ga0070681_102126432 | 230 |
| 228 | 3300005458 | Ga0070681_10434431 | Ga0070681_104344312 | 230 |
| 229 | 3300005466 | Ga0070685_10023937 | Ga0070685_100239373 | 230 |
| 230 | 3300005518 | Ga0070699_100020660 | Ga0070699_1000206602 | 230 |
| 231 | 3300005518 | Ga0070699_100742498 | Ga0070699_1007424982 | 230 |
| 232 | 3300005530 | Ga0070679_100002378 | Ga0070679_1000023783 | 230 |
| 233 | 3300005530 | Ga0070679_100003980 | Ga0070679_1000039802 | 230 |
| 234 | 3300005530 | Ga0070679_100004645 | Ga0070679_1000046459 | 230 |
| 235 | 3300005530 | Ga0070679_100026050 | Ga0070679_1000260507 | 230 |
| 236 | 3300005535 | Ga0070684_100004275 | Ga0070684_1000042755 | 230 |
| 237 | 3300005535 | Ga0070684_100006282 | Ga0070684_1000062827 | 230 |
| 238 | 3300005535 | Ga0070684_100006841 | Ga0070684_1000068417 | 230 |
| 239 | 3300005535 | Ga0070684_100140878 | Ga0070684_1001408782 | 230 |
| 240 | 3300005535 | Ga0070684_100300108 | Ga0070684_1003001081 | 230 |
| 241 | 3300005535 | Ga0070684_100553232 | Ga0070684_1005532322 | 230 |
| 242 | 3300005535 | Ga0070684_100794150 | Ga0070684_1007941501 | 230 |
| 243 | 3300005543 | Ga0070672_100070714 | Ga0070672_1000707141 | 230 |
| 244 | 3300005543 | Ga0070672_100203913 | Ga0070672_1002039132 | 230 |
| 245 | 3300005543 | Ga0070672_100234283 | Ga0070672_1002342832 | 230 |
| 246 | 3300005546 | Ga0070696_100552414 | Ga0070696_1005524141 | 230 |
| 247 | 3300005547 | Ga0070693_100054815 | Ga0070693_1000548152 | 230 |
| 248 | 3300005563 | Ga0068855_100055481 | Ga0068855_1000554812 | 230 |
| 249 | 3300005563 | Ga0068855_100082035 | Ga0068855_1000820352 | 230 |
| 250 | 3300005563 | Ga0068855_100210345 | Ga0068855_1002103452 | 230 |
| 251 | 3300005564 | Ga0070664_100005637 | Ga0070664_10000563713 | 230 |
| 252 | 3300005564 | Ga0070664_100025323 | Ga0070664_1000253233 | 230 |
| 253 | 3300005564 | Ga0070664_100119931 | Ga0070664_1001199312 | 230 |
| 254 | 3300005577 | Ga0068857_100039271 | Ga0068857_1000392712 | 230 |
| 255 | 3300005577 | Ga0068857_100092038 | Ga0068857_1000920384 | 230 |
| 256 | 3300005577 | Ga0068857_100321505 | Ga0068857_1003215052 | 230 |
| 257 | 3300005578 | Ga0068854_100395699 | Ga0068854_1003956991 | 230 |
| 258 | 3300005616 | Ga0068852_100044902 | Ga0068852_1000449022 | 230 |
| 259 | 3300005618 | Ga0068864_100229898 | Ga0068864_1002298982 | 230 |
| 260 | 3300005618 | Ga0068864_100663703 | Ga0068864_1006637032 | 230 |
| 261 | 3300005840 | Ga0068870_10008889 | Ga0068870_100088895 | 230 |
| 262 | 3300005843 | Ga0068860_100702612 | Ga0068860_1007026121 | 230 |
| 263 | 3300006844 | Ga0075428_100700177 | Ga0075428_1007001772 | 230 |
| 264 | 3300006847 | Ga0075431_100507193 | Ga0075431_1005071932 | 230 |
| 265 | 3300006881 | Ga0068865_100027987 | Ga0068865_1000279872 | 230 |
| 266 | 3300009093 | Ga0105240_10003569 | Ga0105240_1000356917 | 230 |
| 267 | 3300009093 | Ga0105240_10006327 | Ga0105240_1000632711 | 230 |
| 268 | 3300009093 | Ga0105240_10407501 | Ga0105240_104075012 | 230 |
| 269 | 3300009093 | Ga0105240_10698665 | Ga0105240_106986652 | 230 |
| 270 | 3300009098 | Ga0105245_10087206 | Ga0105245_100872062 | 230 |
| 271 | 3300009098 | Ga0105245_10413853 | Ga0105245_104138531 | 230 |
| 272 | 3300009147 | Ga0114129_10719300 | Ga0114129_107193002 | 230 |
| 273 | 3300009148 | Ga0105243_10138049 | Ga0105243_101380492 | 230 |
| 274 | 3300009174 | Ga0105241_10000025 | Ga0105241_1000002592 | 230 |
| 275 | 3300009174 | Ga0105241_10152133 | Ga0105241_101521332 | 230 |
| 276 | 3300009174 | Ga0105241_10498870 | Ga0105241_104988702 | 230 |
| 277 | 3300009176 | Ga0105242_10043077 | Ga0105242_100430775 | 230 |
| 278 | 3300009177 | Ga0105248_10068273 | Ga0105248_100682732 | 230 |
| 279 | 3300009177 | Ga0105248_10619839 | Ga0105248_106198392 | 230 |
| 280 | 3300009177 | Ga0105248_10690162 | Ga0105248_106901621 | 230 |
| 281 | 3300009177 | Ga0105248_10919636 | Ga0105248_109196362 | 230 |
| 282 | 3300009545 | Ga0105237_10473675 | Ga0105237_104736752 | 230 |
| 283 | 3300009551 | Ga0105238_10537240 | Ga0105238_105372402 | 230 |
| 284 | 3300013100 | Ga0157373_10029156 | Ga0157373_100291564 | 230 |
| 285 | 3300013102 | Ga0157371_10224890 | Ga0157371_102248902 | 230 |
| 286 | 3300013104 | Ga0157370_10001847 | Ga0157370_1000184715 | 230 |
| 287 | 3300013104 | Ga0157370_10021404 | Ga0157370_100214043 | 230 |
| 288 | 3300013104 | Ga0157370_10119209 | Ga0157370_101192093 | 230 |
| 289 | 3300013104 | Ga0157370_10138889 | Ga0157370_101388892 | 230 |
| 290 | 3300013105 | Ga0157369_10033903 | Ga0157369_100339036 | 230 |
| 291 | 3300013296 | Ga0157374_10116363 | Ga0157374_101163634 | 230 |
| 292 | 3300013297 | Ga0157378_10959352 | Ga0157378_109593521 | 230 |
| 293 | 3300013307 | Ga0157372_10002084 | Ga0157372_1000208415 | 230 |
| 294 | 3300013307 | Ga0157372_10030167 | Ga0157372_100301675 | 230 |
| 295 | 3300013307 | Ga0157372_10039692 | Ga0157372_100396922 | 230 |
| 296 | 3300013307 | Ga0157372_10043975 | Ga0157372_100439752 | 230 |
| 297 | 3300013307 | Ga0157372_10076385 | Ga0157372_100763854 | 230 |
| 298 | 3300013307 | Ga0157372_10174298 | Ga0157372_101742982 | 230 |
| 299 | 3300013307 | Ga0157372_10275780 | Ga0157372_102757802 | 230 |
| 300 | 3300013308 | Ga0157375_10018916 | Ga0157375_100189163 | 230 |
| 301 | 3300013308 | Ga0157375_10066196 | Ga0157375_100661962 | 230 |
| 302 | 3300013308 | Ga0157375_10068237 | Ga0157375_100682374 | 230 |
| 303 | 3300013308 | Ga0157375_10422428 | Ga0157375_104224282 | 230 |
| 304 | 3300014325 | Ga0163163_10427828 | Ga0163163_104278282 | 230 |
| 305 | 3300014325 | Ga0163163_10764526 | Ga0163163_107645262 | 230 |
| 306 | 3300014326 | Ga0157380_10159673 | Ga0157380_101596733 | 230 |
| 307 | 3300014745 | Ga0157377_10162183 | Ga0157377_101621832 | 230 |
| 308 | 3300014968 | Ga0157379_10676853 | Ga0157379_106768532 | 230 |
| 309 | 3300014969 | Ga0157376_10179820 | Ga0157376_101798202 | 230 |
| 310 | 3300020069 | Ga0197907_11188549 | Ga0197907_111885494 | 230 |
| 311 | 3300020081 | Ga0206354_11678005 | Ga0206354_116780052 | 230 |
| 312 | 3300021384 | Ga0213876_10010396 | Ga0213876_100103962 | 230 |
| 313 | 3300025315 | Ga0207697_10060832 | Ga0207697_100608322 | 230 |
| 314 | 3300025321 | Ga0207656_10010840 | Ga0207656_100108405 | 230 |
| 315 | 3300025898 | Ga0207692_10130290 | Ga0207692_101302902 | 230 |
| 316 | 3300025903 | Ga0207680_10494042 | Ga0207680_104940422 | 230 |
| 317 | 3300025907 | Ga0207645_10019731 | Ga0207645_100197314 | 230 |
| 318 | 3300025907 | Ga0207645_10133121 | Ga0207645_101331212 | 230 |
| 319 | 3300025907 | Ga0207645_10249535 | Ga0207645_102495352 | 230 |
| 320 | 3300025909 | Ga0207705_10016916 | Ga0207705_100169168 | 230 |
| 321 | 3300025909 | Ga0207705_10019742 | Ga0207705_100197423 | 230 |
| 322 | 3300025909 | Ga0207705_10217378 | Ga0207705_102173782 | 230 |
| 323 | 3300025911 | Ga0207654_10000492 | Ga0207654_1000049214 | 230 |
| 324 | 3300025911 | Ga0207654_10076372 | Ga0207654_100763723 | 230 |
| 325 | 3300025912 | Ga0207707_10003416 | Ga0207707_1000341613 | 230 |
| 326 | 3300025912 | Ga0207707_10003644 | Ga0207707_100036447 | 230 |
| 327 | 3300025912 | Ga0207707_10005438 | Ga0207707_100054389 | 230 |
| 328 | 3300025912 | Ga0207707_10009065 | Ga0207707_100090656 | 230 |
| 329 | 3300025912 | Ga0207707_10155470 | Ga0207707_101554702 | 230 |
| 330 | 3300025912 | Ga0207707_10270919 | Ga0207707_102709192 | 230 |
| 331 | 3300025913 | Ga0207695_10002468 | Ga0207695_1000246826 | 230 |
| 332 | 3300025913 | Ga0207695_10005733 | Ga0207695_100057333 | 230 |
| 333 | 3300025913 | Ga0207695_10011715 | Ga0207695_100117157 | 230 |
| 334 | 3300025913 | Ga0207695_10060635 | Ga0207695_100606352 | 230 |
| 335 | 3300025913 | Ga0207695_10104379 | Ga0207695_101043793 | 230 |
| 336 | 3300025913 | Ga0207695_10637951 | Ga0207695_106379512 | 230 |
| 337 | 3300025916 | Ga0207663_10378413 | Ga0207663_103784132 | 230 |
| 338 | 3300025917 | Ga0207660_10041782 | Ga0207660_100417823 | 230 |
| 339 | 3300025917 | Ga0207660_10057137 | Ga0207660_100571372 | 230 |
| 340 | 3300025917 | Ga0207660_10060780 | Ga0207660_100607802 | 230 |
| 341 | 3300025918 | Ga0207662_10002925 | Ga0207662_100029253 | 230 |
| 342 | 3300025919 | Ga0207657_10351805 | Ga0207657_103518052 | 230 |
| 343 | 3300025920 | Ga0207649_10032369 | Ga0207649_100323695 | 230 |
| 344 | 3300025920 | Ga0207649_10114033 | Ga0207649_101140332 | 230 |
| 345 | 3300025920 | Ga0207649_10115150 | Ga0207649_101151502 | 230 |
| 346 | 3300025920 | Ga0207649_10454141 | Ga0207649_104541412 | 230 |
| 347 | 3300025921 | Ga0207652_10006464 | Ga0207652_100064645 | 230 |
| 348 | 3300025921 | Ga0207652_10010695 | Ga0207652_100106952 | 230 |
| 349 | 3300025921 | Ga0207652_10011127 | Ga0207652_100111272 | 230 |
| 350 | 3300025921 | Ga0207652_10024692 | Ga0207652_100246922 | 230 |
| 351 | 3300025921 | Ga0207652_10050197 | Ga0207652_100501974 | 230 |
| 352 | 3300025921 | Ga0207652_10062448 | Ga0207652_100624483 | 230 |
| 353 | 3300025921 | Ga0207652_10068825 | Ga0207652_100688253 | 230 |
| 354 | 3300025921 | Ga0207652_10102470 | Ga0207652_101024703 | 230 |
| 355 | 3300025923 | Ga0207681_10004225 | Ga0207681_100042257 | 230 |
| 356 | 3300025924 | Ga0207694_10091178 | Ga0207694_100911784 | 230 |
| 357 | 3300025925 | Ga0207650_10068273 | Ga0207650_100682731 | 230 |
| 358 | 3300025929 | Ga0207664_10043146 | Ga0207664_100431463 | 230 |
| 359 | 3300025931 | Ga0207644_10074807 | Ga0207644_100748072 | 230 |
| 360 | 3300025932 | Ga0207690_10088478 | Ga0207690_100884782 | 230 |
| 361 | 3300025932 | Ga0207690_10166985 | Ga0207690_101669852 | 230 |
| 362 | 3300025932 | Ga0207690_10851634 | Ga0207690_108516341 | 230 |
| 363 | 3300025933 | Ga0207706_10135684 | Ga0207706_101356842 | 230 |
| 364 | 3300025934 | Ga0207686_10037389 | Ga0207686_100373892 | 230 |
| 365 | 3300025936 | Ga0207670_10098450 | Ga0207670_100984503 | 230 |
| 366 | 3300025937 | Ga0207669_10324465 | Ga0207669_103244652 | 230 |
| 367 | 3300025938 | Ga0207704_10034858 | Ga0207704_100348582 | 230 |
| 368 | 3300025939 | Ga0207665_10000198 | Ga0207665_100001982 | 230 |
| 369 | 3300025940 | Ga0207691_10013294 | Ga0207691_100132949 | 230 |
| 370 | 3300025940 | Ga0207691_10077436 | Ga0207691_100774363 | 230 |
| 371 | 3300025942 | Ga0207689_10094631 | Ga0207689_100946312 | 230 |
| 372 | 3300025944 | Ga0207661_10000396 | Ga0207661_1000039618 | 230 |
| 373 | 3300025944 | Ga0207661_10003118 | Ga0207661_100031184 | 230 |
| 374 | 3300025944 | Ga0207661_10027519 | Ga0207661_100275192 | 230 |
| 375 | 3300025944 | Ga0207661_10053848 | Ga0207661_100538482 | 230 |
| 376 | 3300025944 | Ga0207661_10055595 | Ga0207661_100555952 | 230 |
| 377 | 3300025944 | Ga0207661_10066838 | Ga0207661_100668383 | 230 |
| 378 | 3300025944 | Ga0207661_10080070 | Ga0207661_100800702 | 230 |
| 379 | 3300025944 | Ga0207661_10092143 | Ga0207661_100921432 | 230 |
| 380 | 3300025944 | Ga0207661_10234674 | Ga0207661_102346742 | 230 |
| 381 | 3300025945 | Ga0207679_10049674 | Ga0207679_100496742 | 230 |
| 382 | 3300025945 | Ga0207679_10053749 | Ga0207679_100537492 | 230 |
| 383 | 3300025945 | Ga0207679_10076991 | Ga0207679_100769914 | 230 |
| 384 | 3300025945 | Ga0207679_10079509 | Ga0207679_100795093 | 230 |
| 385 | 3300025945 | Ga0207679_10176164 | Ga0207679_101761642 | 230 |
| 386 | 3300025945 | Ga0207679_10364579 | Ga0207679_103645792 | 230 |
| 387 | 3300025949 | Ga0207667_10091232 | Ga0207667_100912322 | 230 |
| 388 | 3300025960 | Ga0207651_10124061 | Ga0207651_101240611 | 230 |
| 389 | 3300025960 | Ga0207651_10616280 | Ga0207651_106162802 | 230 |
| 390 | 3300025972 | Ga0207668_10058640 | Ga0207668_100586402 | 230 |
| 391 | 3300025972 | Ga0207668_10104619 | Ga0207668_101046192 | 230 |
| 392 | 3300025972 | Ga0207668_10378464 | Ga0207668_103784642 | 230 |
| 393 | 3300025981 | Ga0207640_10007497 | Ga0207640_100074974 | 230 |
| 394 | 3300025986 | Ga0207658_10112598 | Ga0207658_101125982 | 230 |
| 395 | 3300026023 | Ga0207677_10352035 | Ga0207677_103520351 | 230 |
| 396 | 3300026023 | Ga0207677_10448449 | Ga0207677_104484492 | 230 |
| 397 | 3300026035 | Ga0207703_10150019 | Ga0207703_101500192 | 230 |
| 398 | 3300026041 | Ga0207639_10302099 | Ga0207639_103020992 | 230 |
| 399 | 3300026041 | Ga0207639_10387897 | Ga0207639_103878972 | 230 |
| 400 | 3300026089 | Ga0207648_10299950 | Ga0207648_102999502 | 230 |
| 401 | 3300026116 | Ga0207674_10016913 | Ga0207674_100169137 | 230 |
| 402 | 3300026116 | Ga0207674_10018642 | Ga0207674_100186424 | 230 |
| 403 | 3300026116 | Ga0207674_10335055 | Ga0207674_103350552 | 230 |
| 404 | 3300026116 | Ga0207674_10413491 | Ga0207674_104134912 | 230 |
| 405 | 3300026142 | Ga0207698_10023939 | Ga0207698_100239393 | 230 |
| 406 | 3300026142 | Ga0207698_10714412 | Ga0207698_107144122 | 230 |
| 407 | 3300028379 | Ga0268266_10479380 | Ga0268266_104793802 | 230 |
| 408 | 3300028381 | Ga0268264_10150212 | Ga0268264_101502122 | 230 |
| 409 | 3300031548 | Ga0307408_100010153 | Ga0307408_1000101533 | 230 |
| 410 | 3300031548 | Ga0307408_100247394 | Ga0307408_1002473942 | 230 |
| 411 | 3300031548 | Ga0307408_100455392 | Ga0307408_1004553922 | 230 |
| 412 | 3300031731 | Ga0307405_10000086 | Ga0307405_100000865 | 230 |
| 413 | 3300031731 | Ga0307405_10018983 | Ga0307405_100189834 | 230 |
| 414 | 3300031731 | Ga0307405_10239465 | Ga0307405_102394652 | 230 |
| 415 | 3300031731 | Ga0307405_10419185 | Ga0307405_104191852 | 230 |
| 416 | 3300031731 | Ga0307405_10630474 | Ga0307405_106304742 | 230 |
| 417 | 3300031852 | Ga0307410_10000638 | Ga0307410_1000063811 | 230 |
| 418 | 3300031852 | Ga0307410_10079816 | Ga0307410_100798162 | 230 |
| 419 | 3300031852 | Ga0307410_10100501 | Ga0307410_101005012 | 230 |
| 420 | 3300031852 | Ga0307410_10165506 | Ga0307410_101655062 | 230 |
| 421 | 3300031901 | Ga0307406_10000581 | Ga0307406_1000058123 | 230 |
| 422 | 3300031901 | Ga0307406_10014298 | Ga0307406_100142982 | 230 |
| 423 | 3300031901 | Ga0307406_10091223 | Ga0307406_100912232 | 230 |
| 424 | 3300031901 | Ga0307406_10120095 | Ga0307406_101200953 | 230 |
| 425 | 3300031903 | Ga0307407_10000133 | Ga0307407_1000013313 | 230 |
| 426 | 3300031903 | Ga0307407_10079094 | Ga0307407_100790942 | 230 |
| 427 | 3300031903 | Ga0307407_10112876 | Ga0307407_101128762 | 230 |
| 428 | 3300031911 | Ga0307412_10011207 | Ga0307412_100112074 | 230 |
| 429 | 3300031995 | Ga0307409_100000277 | Ga0307409_1000002775 | 230 |
| 430 | 3300031995 | Ga0307409_100008908 | Ga0307409_1000089087 | 230 |
| 431 | 3300031995 | Ga0307409_100045955 | Ga0307409_1000459552 | 230 |
| 432 | 3300031995 | Ga0307409_100269100 | Ga0307409_1002691002 | 230 |
| 433 | 3300031995 | Ga0307409_100371342 | Ga0307409_1003713422 | 230 |
| 434 | 3300032002 | Ga0307416_100001149 | Ga0307416_1000011497 | 230 |
| 435 | 3300032002 | Ga0307416_100077096 | Ga0307416_1000770963 | 230 |
| 436 | 3300032004 | Ga0307414_10477417 | Ga0307414_104774172 | 230 |
| 437 | 3300032005 | Ga0307411_10040426 | Ga0307411_100404264 | 230 |
| 438 | 3300032005 | Ga0307411_10056691 | Ga0307411_100566912 | 230 |
| 439 | 3300032005 | Ga0307411_10453040 | Ga0307411_104530402 | 230 |
| 440 | 3300032126 | Ga0307415_100001402 | Ga0307415_1000014027 | 230 |
| 441 | 3300032126 | Ga0307415_100013088 | Ga0307415_1000130882 | 230 |
| 442 | 3300035086 | Ga0373934_0000531 | Ga0373934_0000531_6105_6833 | 230 |
| 443 | 3300035111 | Ga0373923_0003955 | Ga0373923_0003955_1944_2672 | 230 |
| 444 | 3300035117 | Ga0373953_0001218 | Ga0373953_0001218_570_1298 | 230 |
| 445 | 3300035119 | Ga0373956_0084675 | Ga0373956_0084675_243_971 | 230 |
| 446 | 3300035172 | Ga0373955_0000269 | Ga0373955_0000269_9322_10050 | 230 |
| 447 | 3300035724 | Ga0373933_0000055 | Ga0373933_0000055_36223_36951 | 230 |
| 448 | 3300036401 | Ga0373937_0000420 | Ga0373937_0000420_16955_17683 | 230 |
| 449 | 3300036401 | Ga0373937_0588843 | Ga0373937_0588843_60_764 | 230 |
| 450 | 3300037312 | Ga0395899_0037444 | Ga0395899_0037444_1527_2312 | 230 |
| 451 | 3300037418 | Ga0395900_0080139 | Ga0395900_0080139_1029_1814 | 230 |
| 452 | 3300037471 | Ga0395905_0004043 | Ga0395905_0004043_1157_1942 | 230 |
| 453 | 3300037471 | Ga0395905_0108035 | Ga0395905_0108035_134_922 | 230 |
| 454 | 3300038443 | Ga0395901_0002608 | Ga0395901_0002608_1510_2295 | 230 |
| 455 | 3300039437 | Ga0436365_0815860 | Ga0436365_0815860_102_893 | 230 |
| 456 | 3300046454 | Ga0495592_0000395 | Ga0495592_0000395_18239_18967 | 230 |
| 457 | 3300046459 | Ga0495629_0024246 | Ga0495629_0024246_1567_2295 | 230 |
| 458 | 3300046462 | Ga0495651_0000287 | Ga0495651_0000287_30760_31488 | 230 |
| 459 | 3300046463 | Ga0495653_0000232 | Ga0495653_0000232_3549_4277 | 230 |
| 460 | 3300046499 | Ga0495594_0046600 | Ga0495594_0046600_407_1108 | 230 |
| 461 | 3300046511 | Ga0495608_0000085 | Ga0495608_0000085_36158_36886 | 230 |
| 462 | 3300046514 | Ga0495618_0261465 | Ga0495618_0261465_187_915 | 230 |
| 463 | 3300046516 | Ga0495628_0000154 | Ga0495628_0000154_38530_39258 | 230 |
| 464 | 3300046517 | Ga0495630_0002303 | Ga0495630_0002303_9011_9739 | 230 |
| 465 | 3300046529 | Ga0495652_0083037 | Ga0495652_0083037_766_1494 | 230 |
| 466 | 3300046531 | Ga0495665_0029677 | Ga0495665_0029677_372_1100 | 230 |
| 467 | 3300046535 | Ga0495586_0061427 | Ga0495586_0061427_176_904 | 230 |
| 468 | 3300046536 | Ga0495587_0000678 | Ga0495587_0000678_14094_14822 | 230 |
| 469 | 3300046537 | Ga0495598_0042834 | Ga0495598_0042834_127_831 | 230 |
| 470 | 3300046543 | Ga0495645_0000763 | Ga0495645_0000763_15632_16360 | 230 |
| 471 | 3300046642 | Ga0495634_0101898 | Ga0495634_0101898_950_1678 | 230 |
| 472 | 3300046663 | Ga0495635_0000219 | Ga0495635_0000219_31622_32350 | 230 |
| 473 | 3300046675 | Ga0495657_0001169 | Ga0495657_0001169_849_1577 | 230 |
| 474 | 3300046678 | Ga0495599_0000320 | Ga0495599_0000320_7777_8505 | 230 |
| 475 | 3300046679 | Ga0495623_0000750 | Ga0495623_0000750_15416_16144 | 230 |
| 476 | 3300046679 | Ga0495623_0172514 | Ga0495623_0172514_474_1178 | 230 |
| 477 | 3300046680 | Ga0495646_0033128 | Ga0495646_0033128_1704_2432 | 230 |
| 478 | 3300046684 | Ga0495669_0045989 | Ga0495669_0045989_560_1264 | 230 |
| 479 | 3300046689 | Ga0495613_0155337 | Ga0495613_0155337_30_758 | 230 |
| 480 | 3300046809 | Ga0495600_0000023 | Ga0495600_0000023_32620_33348 | 230 |
| 481 | 3300046809 | Ga0495600_0163616 | Ga0495600_0163616_71_775 | 230 |
| 482 | 3300047317 | Ga0495604_0013275 | Ga0495604_0013275_5767_6495 | 230 |
| 483 | 3300047317 | Ga0495604_0024747 | Ga0495604_0024747_3793_4497 | 230 |
| 484 | 3300047319 | Ga0495674_0002240 | Ga0495674_0002240_9143_9871 | 230 |
| 485 | 3300047322 | Ga0495680_0005182 | Ga0495680_0005182_10085_10813 | 230 |
| 486 | 3300047471 | Ga0495684_0000037 | Ga0495684_0000037_48141_48869 | 230 |
| 487 | 3300047673 | Ga0495593_0201456 | Ga0495593_0201456_90_818 | 230 |
| 488 | 3300048088 | Ga0495602_0000290 | Ga0495602_0000290_12218_12946 | 230 |
| 489 | 3300048903 | Ga0496100_0267906 | Ga0496100_0267906_178_882 | 230 |
| 490 | 3300048904 | Ga0496101_0017130 | Ga0496101_0017130_645_1349 | 230 |
| 491 | 3300048904 | Ga0496101_0196815 | Ga0496101_0196815_39_761 | 230 |
| 492 | 3300048907 | Ga0496104_0204952 | Ga0496104_0204952_51_755 | 230 |
| 493 | 3300048910 | Ga0496107_0384916 | Ga0496107_0384916_179_883 | 230 |
| 494 | 3300048915 | Ga0496112_0195710 | Ga0496112_0195710_138_842 | 230 |
| 495 | 3300048916 | Ga0496113_0390944 | Ga0496113_0390944_161_865 | 230 |
| 496 | 3300048917 | Ga0496114_0086057 | Ga0496114_0086057_1249_1971 | 230 |
| 497 | 3300049570 | Ga0501033_0045560 | Ga0501033_0045560_1967_2677 | 230 |
| 498 | 3300049571 | Ga0501034_0056683 | Ga0501034_0056683_2566_3276 | 230 |
| 499 | 3300049574 | Ga0501038_0376991 | Ga0501038_0376991_312_1007 | 230 |
| 500 | 3300049576 | Ga0501040_0124653 | Ga0501040_0124653_581_1276 | 230 |
| 501 | 3300049578 | Ga0501042_0100797 | Ga0501042_0100797_816_1511 | 230 |
| 502 | 3300049580 | Ga0501046_0219822 | Ga0501046_0219822_498_1193 | 230 |
| 503 | 3300049580 | Ga0501046_0348756 | Ga0501046_0348756_166_858 | 230 |
| 504 | 3300049581 | Ga0501047_0220257 | Ga0501047_0220257_713_1423 | 230 |
| 505 | 3300049589 | Ga0501073_0042080 | Ga0501073_0042080_1070_1780 | 230 |
| 506 | 3300049591 | Ga0501075_0030063 | Ga0501075_0030063_1553_2248 | 230 |
| 507 | 3300049741 | Ga0501079_0041662 | Ga0501079_0041662_2036_2731 | 230 |
| 508 | 3300049742 | Ga0501080_0117637 | Ga0501080_0117637_868_1563 | 230 |
| 509 | 3300049743 | Ga0501081_0121629 | Ga0501081_0121629_784_1479 | 230 |
| 510 | 3300049823 | Ga0501044_0880528 | Ga0501044_0880528_38_736 | 230 |
| 511 | 3300050507 | nmdc:mga05p37_30138_c1 | nmdc:mga05p37_30138_c1_1459_2157 | 230 |
| 512 | 3300050509 | nmdc:mga0qj67_164398_c1 | nmdc:mga0qj67_164398_c1_856_1554 | 230 |
| 513 | 3300050510 | nmdc:mga06r32_114706_c1 | nmdc:mga06r32_114706_c1_578_1276 | 230 |
| 514 | 3300050512 | nmdc:mga0n895_396329_c1 | nmdc:mga0n895_396329_c1_191_919 | 230 |
| 515 | 3300050514 | nmdc:mga08x19_33339_c1 | nmdc:mga08x19_33339_c1_1220_1996 | 230 |
| 516 | 3300053077 | Ga0495601_0014940 | Ga0495601_0014940_372_1100 | 230 |
| 517 | 3300053078 | Ga0495612_0000437 | Ga0495612_0000437_857_1585 | 230 |
| 518 | 3300053085 | Ga0495619_0003858 | Ga0495619_0003858_3296_4024 | 230 |
| 519 | 3300060353 | Ga0501082_0229146 | Ga0501082_0229146_506_1201 | 230 |
| 520 | 3300005341 | Ga0070691_10002925 | Ga0070691_100029259 | 231 |
| 521 | 3300005327 | Ga0070658_10010637 | Ga0070658_100106375 | 232 |
| 522 | 3300005327 | Ga0070658_10338297 | Ga0070658_103382972 | 232 |
| 523 | 3300005339 | Ga0070660_100028943 | Ga0070660_1000289434 | 232 |
| 524 | 3300005366 | Ga0070659_100015438 | Ga0070659_1000154387 | 232 |
| 525 | 3300005436 | Ga0070713_100127675 | Ga0070713_1001276751 | 232 |
| 526 | 3300005530 | Ga0070679_100045465 | Ga0070679_1000454652 | 232 |
| 527 | 3300005530 | Ga0070679_100250616 | Ga0070679_1002506162 | 232 |
| 528 | 3300005530 | Ga0070679_100610638 | Ga0070679_1006106382 | 232 |
| 529 | 3300005530 | Ga0070679_100757466 | Ga0070679_1007574661 | 232 |
| 530 | 3300005563 | Ga0068855_100220896 | Ga0068855_1002208962 | 232 |
| 531 | 3300013100 | Ga0157373_10038315 | Ga0157373_100383155 | 232 |
| 532 | 3300013105 | Ga0157369_10028472 | Ga0157369_100284726 | 232 |
| 533 | 3300013307 | Ga0157372_10003298 | Ga0157372_100032982 | 232 |
| 534 | 3300025909 | Ga0207705_10045257 | Ga0207705_100452572 | 232 |
| 535 | 3300025921 | Ga0207652_10220810 | Ga0207652_102208102 | 232 |
| 536 | 3300025928 | Ga0207700_10479805 | Ga0207700_104798052 | 232 |
| 537 | 3300025929 | Ga0207664_10086321 | Ga0207664_100863212 | 232 |
| 538 | 3300049579 | Ga0501043_0059360 | Ga0501043_0059360_302_1000 | 232 |
| 539 | 3300049581 | Ga0501047_0015612 | Ga0501047_0015612_2773_3471 | 232 |
| 540 | 3300049586 | Ga0501070_0026560 | Ga0501070_0026560_3753_4451 | 232 |
| 541 | 3300049822 | Ga0501035_0212432 | Ga0501035_0212432_321_1019 | 232 |
| 542 | 3300049823 | Ga0501044_0388546 | Ga0501044_0388546_457_1155 | 232 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2px7-assembly1.cif.gz_A | crystal structure of 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase from thermus thermophilus hb8 | 0.9293 | 5 | 230 |
| 5hs2-assembly1.cif.gz_B | crystal structure of ispd complexed with ctp and mg2+ from bacillus subtilis at 1.90 angstroms resolution | 0.9212 | 5 | 231 |
| 2px7-assembly1.cif.gz_A | crystal structure of 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase from thermus thermophilus hb8 | 0.9206 | 5 | 230 |
| 5ddv-assembly1.cif.gz_A-2 | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9197 | 5 | 230 |
| 5hs2-assembly1.cif.gz_A | crystal structure of ispd complexed with ctp and mg2+ from bacillus subtilis at 1.90 angstroms resolution | 0.918 | 5 | 231 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ddvA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9197 | 5 | 230 | 3.90.550.10 |
| af_B4FP01_68_298_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9161 | 1 | 229 | 3.90.550.10 |
| 1vpaB00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9158 | 5 | 229 | 3.90.550.10 |
| 2px7B00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9144 | 9 | 230 | 3.90.550.10 |
| 5ddvA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9118 | 5 | 230 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838QC08-F1-model_v4 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT) | 0.984 | 3 | 232 |
GO:0019288
GO:0050518 |
| AF-A0A838QC08-F1-model_v4 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT) | 0.9755 | 3 | 232 |
GO:0019288
GO:0050518 |
| AF-A0A2V6C5P0-F1-model_v4 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | 0.9729 | 81 | 229 |
GO:0050518
|
| AF-A0A5Q4DF95-F1-model_v4 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT) | 0.9688 | 1 | 228 |
GO:0004725
GO:0019288 GO:0050518 |
| AF-A0A7Y2U7A7-F1-model_v4 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | 0.9668 | 83 | 231 |
GO:0050518
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar