F461503

General Info

Members Datasets Scaffolds Average Seq Length
542 236 542 235

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100371342|Ga0307409_1003713422
Length 278
Sequence MTGAGAASGESDPHRDDAHHTRDAYDPDARAPGHLSRDATPPALRPRDDGMRNVGVVIVAAGAGSRAGSAELKQFRWIAGKPMLLHSVQTFQLRQDVAMVVCVIPKSFAGDPPPWLFQCDVDRLLLAVGGRDRGESVMNGLEDLPDDVEYVLVHDAARPLATSETIERVVREVRRGHGAVAAIPVVDTLKEVDDDGRIVRTVDRRALWRAQTPQGFPRDMIERAYVDARTARITATDDAALCERLGLPVVVVRGSERAMKITDESDFERAEALYGLAE

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
147 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
188 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
189 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
190 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
196 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
197 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.03
Rhizosphere 97.42
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10010637 3300005327 Bacteria 7374
2 Ga0070658_10021716 3300005327 Bacteria 5145
3 Ga0070658_10085533 3300005327 Bacteria 2593
4 Ga0070658_10216962 3300005327 Bacteria 1617
5 Ga0070658_10338297 3300005327 Archaea 1287
6 Ga0070676_10029249 3300005328 Bacteria 3133
7 Ga0070676_10245083 3300005328 Bacteria 1194
8 Ga0070683_100019956 3300005329 Bacteria 5957
9 Ga0070683_100021893 3300005329 Bacteria 5707
10 Ga0070683_100033236 3300005329 Bacteria 4703
11 Ga0070683_100056412 3300005329 Bacteria 3648
12 Ga0070683_100193019 3300005329 Bacteria 1934
13 Ga0070683_100433634 3300005329 Bacteria 1254
14 Ga0070683_100462258 3300005329 Bacteria 1211
15 Ga0070680_100007216 3300005336 Bacteria 8472
16 Ga0070680_100012380 3300005336 Bacteria 6624
17 Ga0070680_100020001 3300005336 Bacteria 5307
18 Ga0070680_100020872 3300005336 Bacteria 5200
19 Ga0070680_100030342 3300005336 Bacteria 4344
20 Ga0070680_100324151 3300005336 Bacteria 1308
21 Ga0070680_100360891 3300005336 Bacteria 1236
22 Ga0070682_100523393 3300005337 Bacteria 923
23 Ga0068868_100302523 3300005338 Unclassified 1359
24 Ga0070660_100027478 3300005339 Bacteria 4246
25 Ga0070660_100028943 3300005339 Bacteria 4149
26 Ga0070660_100255466 3300005339 Bacteria 1430
27 Ga0070660_100574027 3300005339 Bacteria 942
28 Ga0070689_100017373 3300005340 Bacteria 5282
29 Ga0070691_10002925 3300005341 Bacteria 7660
30 Ga0070691_10165939 3300005341 Bacteria 1141
31 Ga0070661_100025402 3300005344 Bacteria 4256
32 Ga0070661_100034765 3300005344 Bacteria 3656
33 Ga0070661_100039113 3300005344 Bacteria 3455
34 Ga0070661_100070396 3300005344 Bacteria 2572
35 Ga0070661_100153466 3300005344 Bacteria 1742
36 Ga0070661_100201783 3300005344 Bacteria 1520
37 Ga0070661_100215421 3300005344 Bacteria 1471
38 Ga0070661_100240049 3300005344 Bacteria 1395
39 Ga0070661_100329490 3300005344 Bacteria 1194
40 Ga0070692_10195547 3300005345 Unclassified 1181
41 Ga0070668_100010325 3300005347 Bacteria 6932
42 Ga0070668_100052116 3300005347 Bacteria 3154
43 Ga0070668_100082570 3300005347 Bacteria 2521
44 Ga0070668_100234516 3300005347 Unclassified 1518
45 Ga0070669_100009190 3300005353 Bacteria 7041
46 Ga0070675_100007808 3300005354 Bacteria 8290
47 Ga0070675_100030937 3300005354 Bacteria 4323
48 Ga0070671_100043066 3300005355 Bacteria 3753
49 Ga0070671_100240416 3300005355 Unclassified 1537
50 Ga0070671_100813311 3300005355 Unclassified 814
51 Ga0070673_100058044 3300005364 Bacteria 3059
52 Ga0070673_100385644 3300005364 Unclassified 1250
53 Ga0070673_100428441 3300005364 Bacteria 1187
54 Ga0070673_100477571 3300005364 Unclassified 1125
55 Ga0070688_100019852 3300005365 Bacteria 3898
56 Ga0070688_100046098 3300005365 Bacteria 2698
57 Ga0070659_100015438 3300005366 Bacteria 5720
58 Ga0070659_100035705 3300005366 Bacteria 3872
59 Ga0070659_100433969 3300005366 Bacteria 1112
60 Ga0070667_100067569 3300005367 Bacteria 3039
61 Ga0070667_100375065 3300005367 Bacteria 1291
62 Ga0070709_10007406 3300005434 Bacteria 6015
63 Ga0070714_100007479 3300005435 Bacteria 8503
64 Ga0070714_100071359 3300005435 Bacteria 3003
65 Ga0070713_100127675 3300005436 Bacteria 2239
66 Ga0070713_100499072 3300005436 Bacteria 1148
67 Ga0070710_10024779 3300005437 Bacteria 3169
68 Ga0070701_10203397 3300005438 Bacteria 1172
69 Ga0070711_100242343 3300005439 Unclassified 1410
70 Ga0070694_100362838 3300005444 Bacteria 1125
71 Ga0070663_100104486 3300005455 Bacteria 2119
72 Ga0070663_100228598 3300005455 Bacteria 1464
73 Ga0070681_10000631 3300005458 Bacteria 28933
74 Ga0070681_10001027 3300005458 Bacteria 23667
75 Ga0070681_10006014 3300005458 Bacteria 11759
76 Ga0070681_10009065 3300005458 Bacteria 9782
77 Ga0070681_10019285 3300005458 Bacteria 6824
78 Ga0070681_10025940 3300005458 Bacteria 5892
79 Ga0070681_10116754 3300005458 Bacteria 2605
80 Ga0070681_10212643 3300005458 Bacteria 1850
81 Ga0070681_10434431 3300005458 Bacteria 1225
82 Ga0070685_10023937 3300005466 Bacteria 3349
83 Ga0070706_100117976 3300005467 Bacteria 2472
84 Ga0070698_100009181 3300005471 Bacteria 10614
85 Ga0070699_100020660 3300005518 Bacteria 5682
86 Ga0070699_100742498 3300005518 Bacteria 897
87 Ga0070679_100002378 3300005530 Bacteria 17053
88 Ga0070679_100003980 3300005530 Bacteria 13610
89 Ga0070679_100004645 3300005530 Bacteria 12678
90 Ga0070679_100026050 3300005530 Bacteria 5740
91 Ga0070679_100045465 3300005530 Bacteria 4375
92 Ga0070679_100050251 3300005530 Bacteria 4153
93 Ga0070679_100250616 3300005530 Bacteria 1727
94 Ga0070679_100270846 3300005530 Bacteria 1652
95 Ga0070679_100610638 3300005530 Unclassified 1034
96 Ga0070679_100757466 3300005530 Unclassified 914
97 Ga0070684_100004275 3300005535 Bacteria 10832
98 Ga0070684_100006282 3300005535 Bacteria 9178
99 Ga0070684_100006841 3300005535 Bacteria 8848
100 Ga0070684_100140878 3300005535 Bacteria 2181
101 Ga0070684_100180074 3300005535 Bacteria 1922
102 Ga0070684_100300108 3300005535 Bacteria 1474
103 Ga0070684_100553232 3300005535 Bacteria 1068
104 Ga0070684_100794150 3300005535 Bacteria 885
105 Ga0070672_100070714 3300005543 Bacteria 2774
106 Ga0070672_100203913 3300005543 Bacteria 1654
107 Ga0070672_100234283 3300005543 Bacteria 1543
108 Ga0070695_100013296 3300005545 Bacteria 4946
109 Ga0070695_100043750 3300005545 Bacteria 2849
110 Ga0070696_100552414 3300005546 Unclassified 923
111 Ga0070693_100054815 3300005547 Unclassified 2294
112 Ga0070693_100066908 3300005547 Bacteria 2104
113 Ga0070704_100213982 3300005549 Unclassified 1563
114 Ga0068855_100001981 3300005563 Bacteria 25451
115 Ga0068855_100020328 3300005563 Bacteria 7965
116 Ga0068855_100055481 3300005563 Bacteria 4654
117 Ga0068855_100082035 3300005563 Bacteria 3737
118 Ga0068855_100176673 3300005563 Bacteria 2416
119 Ga0068855_100207547 3300005563 Unclassified 2203
120 Ga0068855_100210345 3300005563 Bacteria 2186
121 Ga0068855_100220896 3300005563 Bacteria 2125
122 Ga0070664_100005637 3300005564 Bacteria 10079
123 Ga0070664_100025323 3300005564 Bacteria 4917
124 Ga0070664_100051515 3300005564 Bacteria 3486
125 Ga0070664_100119931 3300005564 Bacteria 2302
126 Ga0070664_100178802 3300005564 Bacteria 1885
127 Ga0070664_100353951 3300005564 Bacteria 1336
128 Ga0068857_100039271 3300005577 Bacteria 4192
129 Ga0068857_100092038 3300005577 Bacteria 2715
130 Ga0068857_100321505 3300005577 Bacteria 1429
131 Ga0068854_100020094 3300005578 Bacteria 4511
132 Ga0068854_100051140 3300005578 Bacteria 2959
133 Ga0068854_100395699 3300005578 Bacteria 1142
134 Ga0068856_100096514 3300005614 Bacteria 2944
135 Ga0068852_100006758 3300005616 Bacteria 8324
136 Ga0068852_100044902 3300005616 Bacteria 3756
137 Ga0068852_100091962 3300005616 Bacteria 2716
138 Ga0068864_100229898 3300005618 Bacteria 1715
139 Ga0068864_100663703 3300005618 Bacteria 1016
140 Ga0068870_10008889 3300005840 Bacteria 4538
141 Ga0068860_100702612 3300005843 Unclassified 1021
142 Ga0081455_10005471 3300005937 Bacteria 13923
143 Ga0081539_10052432 3300005985 Bacteria 2291
144 Ga0070717_10263902 3300006028 Bacteria 1524
145 Ga0075428_100700177 3300006844 Bacteria 1079
146 Ga0075431_100507193 3300006847 Bacteria 1197
147 Ga0075434_100040261 3300006871 Bacteria 4628
148 Ga0075434_100103806 3300006871 Bacteria 2851
149 Ga0068865_100027987 3300006881 Bacteria 3729
150 Ga0105240_10003569 3300009093 Bacteria 24134
151 Ga0105240_10006327 3300009093 Bacteria 17434
152 Ga0105240_10106246 3300009093 Bacteria 3406
153 Ga0105240_10407501 3300009093 Bacteria 1530
154 Ga0105240_10426661 3300009093 Bacteria 1488
155 Ga0105240_10698665 3300009093 Bacteria 1107
156 Ga0105245_10087206 3300009098 Bacteria 2865
157 Ga0105245_10413853 3300009098 Bacteria 1350
158 Ga0114129_10719300 3300009147 Bacteria 1281
159 Ga0105243_10138049 3300009148 Bacteria 2077
160 Ga0105241_10000025 3300009174 Bacteria 132929
161 Ga0105241_10152133 3300009174 Bacteria 1894
162 Ga0105241_10498870 3300009174 Bacteria 1085
163 Ga0105241_10595049 3300009174 Bacteria 998
164 Ga0105242_10043077 3300009176 Bacteria 3649
165 Ga0105248_10068273 3300009177 Bacteria 3992
166 Ga0105248_10619839 3300009177 Bacteria 1221
167 Ga0105248_10690162 3300009177 Unclassified 1152
168 Ga0105248_10919636 3300009177 Bacteria 988
169 Ga0105237_10473675 3300009545 Bacteria 1258
170 Ga0105238_10004780 3300009551 Bacteria 13407
171 Ga0105238_10537240 3300009551 Unclassified 1173
172 Ga0105238_10839742 3300009551 Unclassified 935
173 Ga0105249_10000078 3300009553 Bacteria 140030
174 Ga0105239_10308482 3300010375 Unclassified 1783
175 Ga0157373_10029156 3300013100 Bacteria 3978
176 Ga0157373_10038315 3300013100 Bacteria 3436
177 Ga0157371_10004747 3300013102 Bacteria 11725
178 Ga0157371_10224890 3300013102 Bacteria 1348
179 Ga0157370_10001847 3300013104 Bacteria 26111
180 Ga0157370_10021404 3300013104 Bacteria 6444
181 Ga0157370_10119209 3300013104 Bacteria 2464
182 Ga0157370_10138889 3300013104 Bacteria 2264
183 Ga0157370_10323261 3300013104 Bacteria 1423
184 Ga0157369_10028472 3300013105 Bacteria 6184
185 Ga0157369_10033903 3300013105 Bacteria 5606
186 Ga0157369_10036846 3300013105 Bacteria 5357
187 Ga0157369_10102589 3300013105 Bacteria 3048
188 Ga0157369_10117744 3300013105 Bacteria 2820
189 Ga0157369_10206332 3300013105 Bacteria 2061
190 Ga0157374_10116363 3300013296 Bacteria 2576
191 Ga0157374_10685553 3300013296 Bacteria 1037
192 Ga0157374_10714115 3300013296 Bacteria 1016
193 Ga0157378_10959352 3300013297 Unclassified 888
194 Ga0157372_10002084 3300013307 Bacteria 21727
195 Ga0157372_10003298 3300013307 Bacteria 17437
196 Ga0157372_10011056 3300013307 Bacteria 9604
197 Ga0157372_10017343 3300013307 Bacteria 7730
198 Ga0157372_10030167 3300013307 Bacteria 5929
199 Ga0157372_10039692 3300013307 Bacteria 5197
200 Ga0157372_10043975 3300013307 Bacteria 4947
201 Ga0157372_10076385 3300013307 Bacteria 3782
202 Ga0157372_10114009 3300013307 Bacteria 3098
203 Ga0157372_10174298 3300013307 Bacteria 2489
204 Ga0157372_10275780 3300013307 Bacteria 1955
205 Ga0157375_10018916 3300013308 Bacteria 6254
206 Ga0157375_10066196 3300013308 Bacteria 3606
207 Ga0157375_10068237 3300013308 Bacteria 3557
208 Ga0157375_10422428 3300013308 Bacteria 1499
209 Ga0157375_10698125 3300013308 Bacteria 1168
210 Ga0163163_10427828 3300014325 Unclassified 1383
211 Ga0163163_10764526 3300014325 Bacteria 1029
212 Ga0157380_10159673 3300014326 Bacteria 1958
213 Ga0182008_10005605 3300014497 Bacteria 7117
214 Ga0157377_10162183 3300014745 Bacteria 1391
215 Ga0157379_10676853 3300014968 Bacteria 967
216 Ga0157376_10179820 3300014969 Bacteria 1932
217 Ga0197907_11188549 3300020069 Unclassified 2432
218 Ga0206354_11678005 3300020081 Bacteria 839
219 Ga0213876_10010396 3300021384 Bacteria 4997
220 Ga0207697_10060832 3300025315 Bacteria 1571
221 Ga0207656_10010840 3300025321 Bacteria 3428
222 Ga0207692_10130290 3300025898 Unclassified 1420
223 Ga0207680_10494042 3300025903 Bacteria 871
224 Ga0207645_10019731 3300025907 Bacteria 4417
225 Ga0207645_10133121 3300025907 Bacteria 1619
226 Ga0207645_10249535 3300025907 Bacteria 1174
227 Ga0207705_10016916 3300025909 Bacteria 5224
228 Ga0207705_10019742 3300025909 Bacteria 4819
229 Ga0207705_10024091 3300025909 Bacteria 4343
230 Ga0207705_10045257 3300025909 Bacteria 3163
231 Ga0207705_10217378 3300025909 Bacteria 1451
232 Ga0207705_10259981 3300025909 Bacteria 1325
233 Ga0207654_10000492 3300025911 Bacteria 22614
234 Ga0207654_10076372 3300025911 Bacteria 2005
235 Ga0207707_10000322 3300025912 Bacteria 50600
236 Ga0207707_10003416 3300025912 Bacteria 14075
237 Ga0207707_10003644 3300025912 Bacteria 13662
238 Ga0207707_10005438 3300025912 Bacteria 11136
239 Ga0207707_10009065 3300025912 Bacteria 8642
240 Ga0207707_10015989 3300025912 Bacteria 6544
241 Ga0207707_10155470 3300025912 Bacteria 2000
242 Ga0207707_10270919 3300025912 Unclassified 1471
243 Ga0207707_10479794 3300025912 Bacteria 1062
244 Ga0207707_10667255 3300025912 Unclassified 875
245 Ga0207695_10002468 3300025913 Bacteria 27266
246 Ga0207695_10005733 3300025913 Bacteria 16362
247 Ga0207695_10011715 3300025913 Bacteria 10595
248 Ga0207695_10060635 3300025913 Bacteria 3915
249 Ga0207695_10065117 3300025913 Bacteria 3748
250 Ga0207695_10104379 3300025913 Bacteria 2824
251 Ga0207695_10637951 3300025913 Bacteria 946
252 Ga0207663_10378413 3300025916 Bacteria 1078
253 Ga0207660_10041782 3300025917 Bacteria 3215
254 Ga0207660_10057137 3300025917 Unclassified 2794
255 Ga0207660_10060780 3300025917 Bacteria 2718
256 Ga0207660_10063778 3300025917 Bacteria 2658
257 Ga0207660_10080514 3300025917 Bacteria 2392
258 Ga0207660_10100050 3300025917 Bacteria 2164
259 Ga0207660_10143950 3300025917 Bacteria 1825
260 Ga0207662_10002925 3300025918 Bacteria 8666
261 Ga0207657_10010260 3300025919 Bacteria 9350
262 Ga0207657_10018154 3300025919 Bacteria 6729
263 Ga0207657_10351805 3300025919 Bacteria 1162
264 Ga0207649_10032369 3300025920 Bacteria 3117
265 Ga0207649_10114033 3300025920 Bacteria 1811
266 Ga0207649_10115150 3300025920 Bacteria 1803
267 Ga0207649_10155453 3300025920 Unclassified 1579
268 Ga0207649_10454141 3300025920 Bacteria 968
269 Ga0207652_10006464 3300025921 Bacteria 9451
270 Ga0207652_10010695 3300025921 Bacteria 7388
271 Ga0207652_10011127 3300025921 Bacteria 7252
272 Ga0207652_10024692 3300025921 Bacteria 4988
273 Ga0207652_10044981 3300025921 Bacteria 3763
274 Ga0207652_10050197 3300025921 Bacteria 3574
275 Ga0207652_10062448 3300025921 Bacteria 3219
276 Ga0207652_10068825 3300025921 Bacteria 3072
277 Ga0207652_10097260 3300025921 Bacteria 2594
278 Ga0207652_10102470 3300025921 Unclassified 2530
279 Ga0207652_10103519 3300025921 Bacteria 2517
280 Ga0207652_10220810 3300025921 Bacteria 1708
281 Ga0207652_10227067 3300025921 Bacteria 1683
282 Ga0207652_10288821 3300025921 Bacteria 1480
283 Ga0207646_10444510 3300025922 Bacteria 1170
284 Ga0207681_10004225 3300025923 Bacteria 8870
285 Ga0207694_10091178 3300025924 Bacteria 2405
286 Ga0207694_10558747 3300025924 Unclassified 961
287 Ga0207650_10068273 3300025925 Bacteria 2669
288 Ga0207700_10479805 3300025928 Bacteria 1099
289 Ga0207664_10043146 3300025929 Bacteria 3526
290 Ga0207664_10086321 3300025929 Bacteria 2563
291 Ga0207664_10135002 3300025929 Bacteria 2081
292 Ga0207664_10310789 3300025929 Bacteria 1388
293 Ga0207644_10074807 3300025931 Bacteria 2487
294 Ga0207690_10088478 3300025932 Bacteria 2182
295 Ga0207690_10166985 3300025932 Unclassified 1646
296 Ga0207690_10354349 3300025932 Unclassified 1161
297 Ga0207690_10851634 3300025932 Unclassified 755
298 Ga0207706_10135684 3300025933 Bacteria 2165
299 Ga0207686_10037389 3300025934 Bacteria 2929
300 Ga0207670_10098450 3300025936 Bacteria 2084
301 Ga0207669_10324465 3300025937 Bacteria 1180
302 Ga0207704_10034858 3300025938 Bacteria 2876
303 Ga0207665_10000198 3300025939 Bacteria 40191
304 Ga0207691_10013294 3300025940 Bacteria 7886
305 Ga0207691_10022054 3300025940 Bacteria 6008
306 Ga0207691_10077436 3300025940 Bacteria 2996
307 Ga0207691_10153147 3300025940 Bacteria 2026
308 Ga0207689_10094631 3300025942 Bacteria 2453
309 Ga0207661_10000396 3300025944 Bacteria 28141
310 Ga0207661_10003118 3300025944 Bacteria 11481
311 Ga0207661_10027519 3300025944 Bacteria 4344
312 Ga0207661_10053848 3300025944 Bacteria 3222
313 Ga0207661_10055595 3300025944 Bacteria 3175
314 Ga0207661_10066838 3300025944 Bacteria 2921
315 Ga0207661_10080070 3300025944 Bacteria 2694
316 Ga0207661_10092143 3300025944 Bacteria 2526
317 Ga0207661_10234674 3300025944 Unclassified 1626
318 Ga0207661_10439603 3300025944 Bacteria 1187
319 Ga0207661_10648665 3300025944 Bacteria 970
320 Ga0207679_10043078 3300025945 Bacteria 3248
321 Ga0207679_10049674 3300025945 Bacteria 3062
322 Ga0207679_10053749 3300025945 Bacteria 2961
323 Ga0207679_10076991 3300025945 Bacteria 2536
324 Ga0207679_10079509 3300025945 Bacteria 2501
325 Ga0207679_10149467 3300025945 Bacteria 1899
326 Ga0207679_10176164 3300025945 Bacteria 1765
327 Ga0207679_10281061 3300025945 Bacteria 1427
328 Ga0207679_10364579 3300025945 Bacteria 1263
329 Ga0207667_10002650 3300025949 Bacteria 22117
330 Ga0207667_10027226 3300025949 Bacteria 6228
331 Ga0207667_10091232 3300025949 Bacteria 3148
332 Ga0207667_10167022 3300025949 Bacteria 2262
333 Ga0207651_10124061 3300025960 Bacteria 1964
334 Ga0207651_10616280 3300025960 Unclassified 950
335 Ga0207712_10000079 3300025961 Bacteria 115164
336 Ga0207668_10058640 3300025972 Bacteria 2692
337 Ga0207668_10104619 3300025972 Bacteria 2111
338 Ga0207668_10378464 3300025972 Unclassified 1191
339 Ga0207640_10007497 3300025981 Bacteria 6027
340 Ga0207640_10326602 3300025981 Bacteria 1223
341 Ga0207640_10424799 3300025981 Unclassified 1089
342 Ga0207658_10112598 3300025986 Bacteria 2154
343 Ga0207677_10352035 3300026023 Unclassified 1234
344 Ga0207677_10448449 3300026023 Unclassified 1105
345 Ga0207703_10150019 3300026035 Bacteria 2032
346 Ga0207639_10126350 3300026041 Unclassified 2110
347 Ga0207639_10302099 3300026041 Bacteria 1415
348 Ga0207639_10387897 3300026041 Bacteria 1256
349 Ga0207639_10485504 3300026041 Unclassified 1127
350 Ga0207678_10001695 3300026067 Bacteria 20205
351 Ga0207678_10033009 3300026067 Bacteria 4511
352 Ga0207702_10051697 3300026078 Bacteria 3474
353 Ga0207702_10355702 3300026078 Bacteria 1402
354 Ga0207648_10299950 3300026089 Bacteria 1441
355 Ga0207674_10016913 3300026116 Bacteria 7968
356 Ga0207674_10018642 3300026116 Bacteria 7537
357 Ga0207674_10335055 3300026116 Bacteria 1463
358 Ga0207674_10413491 3300026116 Bacteria 1303
359 Ga0207698_10004633 3300026142 Bacteria 8399
360 Ga0207698_10021125 3300026142 Bacteria 4496
361 Ga0207698_10023939 3300026142 Bacteria 4276
362 Ga0207698_10282852 3300026142 Bacteria 1535
363 Ga0207698_10714412 3300026142 Bacteria 998
364 Ga0209998_10011661 3300027717 Bacteria 1822
365 Ga0209974_10057740 3300027876 Bacteria 1311
366 Ga0268266_10479380 3300028379 Unclassified 1186
367 Ga0268264_10150212 3300028381 Bacteria 2088
368 Ga0307408_100010153 3300031548 Bacteria 6211
369 Ga0307408_100168691 3300031548 Unclassified 1746
370 Ga0307408_100247394 3300031548 Bacteria 1469
371 Ga0307408_100455392 3300031548 Unclassified 1111
372 Ga0307405_10000086 3300031731 Bacteria 39376
373 Ga0307405_10018983 3300031731 Bacteria 3808
374 Ga0307405_10239465 3300031731 Bacteria 1343
375 Ga0307405_10419185 3300031731 Bacteria 1053
376 Ga0307405_10630474 3300031731 Bacteria 879
377 Ga0307410_10000638 3300031852 Bacteria 14477
378 Ga0307410_10015895 3300031852 Bacteria 4473
379 Ga0307410_10027010 3300031852 Bacteria 3623
380 Ga0307410_10079816 3300031852 Bacteria 2294
381 Ga0307410_10100501 3300031852 Bacteria 2072
382 Ga0307410_10165506 3300031852 Bacteria 1661
383 Ga0307406_10000581 3300031901 Bacteria 21084
384 Ga0307406_10014298 3300031901 Bacteria 4564
385 Ga0307406_10091223 3300031901 Bacteria 2052
386 Ga0307406_10120095 3300031901 Bacteria 1826
387 Ga0307407_10000133 3300031903 Bacteria 22779
388 Ga0307407_10007413 3300031903 Bacteria 4968
389 Ga0307407_10079094 3300031903 Bacteria 1983
390 Ga0307407_10112876 3300031903 Bacteria 1709
391 Ga0307407_10204886 3300031903 Unclassified 1324
392 Ga0307412_10011207 3300031911 Bacteria 5187
393 Ga0307412_10295987 3300031911 Unclassified 1277
394 Ga0307409_100000277 3300031995 Bacteria 20763
395 Ga0307409_100008908 3300031995 Bacteria 6128
396 Ga0307409_100045955 3300031995 Bacteria 3301
397 Ga0307409_100269100 3300031995 Bacteria 1568
398 Ga0307409_100371342 3300031995 Unclassified 1357
399 Ga0307416_100001149 3300032002 Bacteria 14224
400 Ga0307416_100034188 3300032002 Bacteria 3865
401 Ga0307416_100077096 3300032002 Bacteria 2798
402 Ga0307414_10012313 3300032004 Bacteria 5052
403 Ga0307414_10477417 3300032004 Archaea 1099
404 Ga0307411_10040426 3300032005 Bacteria 2958
405 Ga0307411_10056691 3300032005 Bacteria 2584
406 Ga0307411_10157443 3300032005 Bacteria 1696
407 Ga0307411_10258392 3300032005 Unclassified 1374
408 Ga0307411_10453040 3300032005 Bacteria 1074
409 Ga0307411_10648487 3300032005 Unclassified 914
410 Ga0307415_100001402 3300032126 Bacteria 11511
411 Ga0307415_100013088 3300032126 Bacteria 4827
412 Ga0307415_100033395 3300032126 Bacteria 3340
413 Ga0307415_100222247 3300032126 Unclassified 1515
414 Ga0373934_0000531 3300035086 Bacteria 13482
415 Ga0373923_0003955 3300035111 Bacteria 4841
416 Ga0373953_0001218 3300035117 Bacteria 7332
417 Ga0373956_0084675 3300035119 Bacteria 1457
418 Ga0373946_0083739 3300035171 Unclassified 1401
419 Ga0373955_0000269 3300035172 Bacteria 21687
420 Ga0373935_0285752 3300035692 Bacteria 1162
421 Ga0373933_0000055 3300035724 Bacteria 67484
422 Ga0373937_0000420 3300036401 Bacteria 39552
423 Ga0373937_0133184 3300036401 Bacteria 2323
424 Ga0373937_0588843 3300036401 Bacteria 1056
425 Ga0395899_0037444 3300037312 Bacteria 3636
426 Ga0395900_0080139 3300037418 Bacteria 3355
427 Ga0395905_0004043 3300037471 Bacteria 15393
428 Ga0395905_0108035 3300037471 Bacteria 2612
429 Ga0395901_0002608 3300038443 Bacteria 18254
430 Ga0436365_0815860 3300039437 Bacteria 13587
431 Ga0436365_0880704 3300039437 Bacteria 1047
432 Ga0466966_0026042 3300044684 Bacteria 3819
433 Ga0466959_0067918 3300045049 Bacteria 2583
434 Ga0451576_0025000 3300045051 Bacteria 6441
435 Ga0466967_0911658 3300045976 Bacteria 874
436 Ga0495592_0000395 3300046454 Bacteria 33972
437 Ga0495629_0024246 3300046459 Bacteria 4319
438 Ga0495651_0000287 3300046462 Bacteria 39077
439 Ga0495653_0000232 3300046463 Bacteria 45432
440 Ga0495653_0019392 3300046463 Bacteria 5516
441 Ga0495653_0160843 3300046463 Bacteria 1559
442 Ga0495662_0028572 3300046476 Bacteria 2692
443 Ga0495664_0131602 3300046477 Bacteria 1515
444 Ga0495594_0046600 3300046499 Bacteria 2381
445 Ga0495608_0000085 3300046511 Bacteria 68124
446 Ga0495608_0023173 3300046511 Bacteria 4256
447 Ga0495618_0261465 3300046514 Bacteria 1084
448 Ga0495628_0000154 3300046516 Bacteria 59770
449 Ga0495628_0106170 3300046516 Bacteria 2163
450 Ga0495630_0002303 3300046517 Bacteria 13287
451 Ga0495630_0016436 3300046517 Bacteria 5407
452 Ga0495643_0149651 3300046522 Unclassified 1157
453 Ga0495652_0066322 3300046529 Bacteria 3030
454 Ga0495652_0083037 3300046529 Bacteria 2638
455 Ga0495652_0109755 3300046529 Bacteria 2220
456 Ga0495665_0029677 3300046531 Bacteria 2930
457 Ga0495665_0228155 3300046531 Bacteria 962
458 Ga0495640_0019289 3300046533 Bacteria 5036
459 Ga0495586_0061427 3300046535 Bacteria 2045
460 Ga0495586_0075232 3300046535 Unclassified 1849
461 Ga0495586_0138057 3300046535 Unclassified 1367
462 Ga0495587_0000678 3300046536 Bacteria 22835
463 Ga0495598_0042834 3300046537 Bacteria 1331
464 Ga0495645_0000763 3300046543 Bacteria 21977
465 Ga0495645_0075387 3300046543 Bacteria 2428
466 Ga0495645_0217604 3300046543 Bacteria 1286
467 Ga0495667_0006064 3300046559 Bacteria 8179
468 Ga0495667_0053080 3300046559 Bacteria 2670
469 Ga0495634_0101898 3300046642 Bacteria 1854
470 Ga0495635_0000219 3300046663 Bacteria 36123
471 Ga0495657_0001169 3300046675 Bacteria 22972
472 Ga0495599_0000320 3300046678 Bacteria 28749
473 Ga0495599_0124369 3300046678 Bacteria 1603
474 Ga0495623_0000750 3300046679 Bacteria 21746
475 Ga0495623_0155241 3300046679 Bacteria 1349
476 Ga0495623_0172514 3300046679 Bacteria 1262
477 Ga0495646_0033128 3300046680 Bacteria 3213
478 Ga0495669_0045989 3300046684 Bacteria 1947
479 Ga0495613_0005521 3300046689 Bacteria 9495
480 Ga0495613_0155337 3300046689 Bacteria 1630
481 Ga0495613_0155426 3300046689 Bacteria 1630
482 Ga0495624_0019553 3300046690 Bacteria 4518
483 Ga0495600_0000023 3300046809 Bacteria 94401
484 Ga0495600_0025717 3300046809 Bacteria 3794
485 Ga0495600_0163616 3300046809 Bacteria 1438
486 Ga0495604_0013275 3300047317 Bacteria 6559
487 Ga0495604_0024747 3300047317 Bacteria 4790
488 Ga0495604_0049782 3300047317 Bacteria 3253
489 Ga0495604_0089057 3300047317 Bacteria 2295
490 Ga0495636_0148244 3300047318 Bacteria 1051
491 Ga0495674_0002240 3300047319 Bacteria 19005
492 Ga0495674_0072646 3300047319 Bacteria 2967
493 Ga0495680_0005182 3300047322 Bacteria 12300
494 Ga0495680_0007752 3300047322 Bacteria 9805
495 Ga0495684_0000037 3300047471 Bacteria 106933
496 Ga0495684_0018749 3300047471 Bacteria 5330
497 Ga0495684_0102052 3300047471 Bacteria 2168
498 Ga0495593_0201456 3300047673 Bacteria 1000
499 Ga0495602_0000290 3300048088 Bacteria 46018
500 Ga0496100_0267906 3300048903 Bacteria 1269
501 Ga0496101_0017130 3300048904 Bacteria 4910
502 Ga0496101_0196815 3300048904 Bacteria 1557
503 Ga0496104_0204952 3300048907 Bacteria 1884
504 Ga0496107_0384916 3300048910 Bacteria 1043
505 Ga0496109_0240208 3300048912 Bacteria 1705
506 Ga0496112_0160171 3300048915 Unclassified 2217
507 Ga0496112_0195710 3300048915 Bacteria 1982
508 Ga0496112_0575124 3300048915 Bacteria 1059
509 Ga0496113_0390944 3300048916 Bacteria 1116
510 Ga0496114_0086057 3300048917 Bacteria 2663
511 Ga0501033_0045560 3300049570 Bacteria 3264
512 Ga0501034_0056683 3300049571 Bacteria 3942
513 Ga0501038_0376991 3300049574 Bacteria 1101
514 Ga0501040_0124653 3300049576 Bacteria 1809
515 Ga0501042_0100797 3300049578 Bacteria 2076
516 Ga0501043_0059360 3300049579 Bacteria 3002
517 Ga0501046_0219822 3300049580 Bacteria 1407
518 Ga0501046_0348756 3300049580 Bacteria 1075
519 Ga0501047_0015612 3300049581 Bacteria 7237
520 Ga0501047_0220257 3300049581 Bacteria 1754
521 Ga0501070_0026560 3300049586 Bacteria 4858
522 Ga0501073_0042080 3300049589 Bacteria 3226
523 Ga0501075_0030063 3300049591 Bacteria 4021
524 Ga0501076_0756068 3300049592 Bacteria 802
525 Ga0501225_0003383 3300049705 Bacteria 4843
526 Ga0501079_0041662 3300049741 Bacteria 3546
527 Ga0501080_0117637 3300049742 Bacteria 2464
528 Ga0501081_0121629 3300049743 Bacteria 1860
529 Ga0501268_008688 3300049765 Bacteria 1545
530 Ga0501035_0212432 3300049822 Bacteria 1655
531 Ga0501044_0388546 3300049823 Bacteria 1310
532 Ga0501044_0880528 3300049823 Unclassified 771
533 nmdc:mga05p37_30138_c1 3300050507 Bacteria 6620
534 nmdc:mga0qj67_164398_c1 3300050509 Bacteria 1801
535 nmdc:mga06r32_114706_c1 3300050510 Unclassified 2652
536 nmdc:mga0n895_156084_c1 3300050512 Bacteria 2313
537 nmdc:mga0n895_396329_c1 3300050512 Bacteria 1396
538 nmdc:mga08x19_33339_c1 3300050514 Bacteria 3250
539 Ga0495601_0014940 3300053077 Bacteria 4687
540 Ga0495612_0000437 3300053078 Bacteria 16652
541 Ga0495619_0003858 3300053085 Bacteria 9647
542 Ga0501082_0229146 3300060353 Bacteria 1617

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031852 Ga0307410_10015895 Ga0307410_100158954 222
2 3300031903 Ga0307407_10007413 Ga0307407_100074132 222
3 3300032002 Ga0307416_100034188 Ga0307416_1000341882 222
4 3300032004 Ga0307414_10012313 Ga0307414_100123134 222
5 3300032126 Ga0307415_100033395 Ga0307415_1000333953 222
6 3300031903 Ga0307407_10204886 Ga0307407_102048862 223
7 3300032005 Ga0307411_10258392 Ga0307411_102583922 223
8 3300032126 Ga0307415_100222247 Ga0307415_1002222472 223
9 3300036401 Ga0373937_0133184 Ga0373937_0133184_75_770 223
10 3300039437 Ga0436365_0880704 Ga0436365_0880704_355_1035 223
11 3300048912 Ga0496109_0240208 Ga0496109_0240208_950_1621 223
12 3300005336 Ga0070680_100324151 Ga0070680_1003241512 225
13 3300013104 Ga0157370_10323261 Ga0157370_103232612 225
14 3300049592 Ga0501076_0756068 Ga0501076_0756068_76_753 225
15 3300049765 Ga0501268_008688 Ga0501268_008688_22_699 225
16 3300005327 Ga0070658_10085533 Ga0070658_100855332 227
17 3300005329 Ga0070683_100433634 Ga0070683_1004336341 227
18 3300005530 Ga0070679_100270846 Ga0070679_1002708462 227
19 3300005563 Ga0068855_100207547 Ga0068855_1002075472 227
20 3300005578 Ga0068854_100020094 Ga0068854_1000200944 227
21 3300005616 Ga0068852_100006758 Ga0068852_1000067582 227
22 3300005616 Ga0068852_100091962 Ga0068852_1000919624 227
23 3300009093 Ga0105240_10106246 Ga0105240_101062464 227
24 3300009174 Ga0105241_10595049 Ga0105241_105950492 227
25 3300013102 Ga0157371_10004747 Ga0157371_100047472 227
26 3300013105 Ga0157369_10036846 Ga0157369_100368466 227
27 3300013105 Ga0157369_10206332 Ga0157369_102063322 227
28 3300013307 Ga0157372_10011056 Ga0157372_100110562 227
29 3300025909 Ga0207705_10024091 Ga0207705_100240912 227
30 3300025909 Ga0207705_10259981 Ga0207705_102599812 227
31 3300025912 Ga0207707_10479794 Ga0207707_104797941 227
32 3300025913 Ga0207695_10065117 Ga0207695_100651172 227
33 3300025917 Ga0207660_10063778 Ga0207660_100637783 227
34 3300025919 Ga0207657_10010260 Ga0207657_100102605 227
35 3300025921 Ga0207652_10044981 Ga0207652_100449812 227
36 3300025921 Ga0207652_10227067 Ga0207652_102270672 227
37 3300025949 Ga0207667_10002650 Ga0207667_1000265020 227
38 3300025949 Ga0207667_10167022 Ga0207667_101670224 227
39 3300026067 Ga0207678_10001695 Ga0207678_100016955 227
40 3300026078 Ga0207702_10355702 Ga0207702_103557021 227
41 3300026142 Ga0207698_10004633 Ga0207698_1000463310 227
42 3300026142 Ga0207698_10021125 Ga0207698_100211253 227
43 3300046463 Ga0495653_0160843 Ga0495653_0160843_864_1547 227
44 3300046535 Ga0495586_0075232 Ga0495586_0075232_77_766 227
45 3300046809 Ga0495600_0025717 Ga0495600_0025717_2350_3039 227
46 3300005344 Ga0070661_100201783 Ga0070661_1002017832 228
47 3300005535 Ga0070684_100180074 Ga0070684_1001800742 228
48 3300005547 Ga0070693_100066908 Ga0070693_1000669082 228
49 3300005549 Ga0070704_100213982 Ga0070704_1002139822 228
50 3300005563 Ga0068855_100176673 Ga0068855_1001766732 228
51 3300006871 Ga0075434_100040261 Ga0075434_1000402614 228
52 3300013296 Ga0157374_10714115 Ga0157374_107141152 228
53 3300013307 Ga0157372_10114009 Ga0157372_101140093 228
54 3300013308 Ga0157375_10698125 Ga0157375_106981252 228
55 3300025921 Ga0207652_10288821 Ga0207652_102888211 228
56 3300025932 Ga0207690_10354349 Ga0207690_103543492 228
57 3300025940 Ga0207691_10022054 Ga0207691_100220547 228
58 3300025940 Ga0207691_10153147 Ga0207691_101531472 228
59 3300026041 Ga0207639_10485504 Ga0207639_104855042 228
60 3300044684 Ga0466966_0026042 Ga0466966_0026042_1932_2630 228
61 3300045049 Ga0466959_0067918 Ga0466959_0067918_1705_2403 228
62 3300046463 Ga0495653_0019392 Ga0495653_0019392_2446_3141 228
63 3300046476 Ga0495662_0028572 Ga0495662_0028572_1811_2506 228
64 3300046511 Ga0495608_0023173 Ga0495608_0023173_260_955 228
65 3300046517 Ga0495630_0016436 Ga0495630_0016436_2672_3367 228
66 3300046529 Ga0495652_0066322 Ga0495652_0066322_1975_2670 228
67 3300046533 Ga0495640_0019289 Ga0495640_0019289_939_1634 228
68 3300046535 Ga0495586_0138057 Ga0495586_0138057_600_1295 228
69 3300046543 Ga0495645_0075387 Ga0495645_0075387_1647_2342 228
70 3300046559 Ga0495667_0006064 Ga0495667_0006064_2570_3265 228
71 3300046679 Ga0495623_0155241 Ga0495623_0155241_448_1143 228
72 3300046689 Ga0495613_0005521 Ga0495613_0005521_351_1046 228
73 3300046690 Ga0495624_0019553 Ga0495624_0019553_1853_2548 228
74 3300047317 Ga0495604_0049782 Ga0495604_0049782_2448_3143 228
75 3300047322 Ga0495680_0007752 Ga0495680_0007752_2555_3250 228
76 3300047471 Ga0495684_0102052 Ga0495684_0102052_214_909 228
77 3300005329 Ga0070683_100033236 Ga0070683_1000332366 229
78 3300005329 Ga0070683_100193019 Ga0070683_1001930193 229
79 3300005329 Ga0070683_100462258 Ga0070683_1004622581 229
80 3300005336 Ga0070680_100012380 Ga0070680_1000123805 229
81 3300005336 Ga0070680_100360891 Ga0070680_1003608912 229
82 3300005339 Ga0070660_100027478 Ga0070660_1000274784 229
83 3300005344 Ga0070661_100039113 Ga0070661_1000391132 229
84 3300005344 Ga0070661_100240049 Ga0070661_1002400492 229
85 3300005347 Ga0070668_100052116 Ga0070668_1000521162 229
86 3300005435 Ga0070714_100071359 Ga0070714_1000713592 229
87 3300005436 Ga0070713_100499072 Ga0070713_1004990722 229
88 3300005455 Ga0070663_100104486 Ga0070663_1001044861 229
89 3300005458 Ga0070681_10009065 Ga0070681_100090658 229
90 3300005458 Ga0070681_10019285 Ga0070681_100192857 229
91 3300005458 Ga0070681_10116754 Ga0070681_101167542 229
92 3300005467 Ga0070706_100117976 Ga0070706_1001179762 229
93 3300005471 Ga0070698_100009181 Ga0070698_1000091819 229
94 3300005530 Ga0070679_100050251 Ga0070679_1000502515 229
95 3300005545 Ga0070695_100013296 Ga0070695_1000132963 229
96 3300005545 Ga0070695_100043750 Ga0070695_1000437504 229
97 3300005563 Ga0068855_100001981 Ga0068855_10000198111 229
98 3300005563 Ga0068855_100020328 Ga0068855_1000203283 229
99 3300005564 Ga0070664_100051515 Ga0070664_1000515152 229
100 3300005564 Ga0070664_100178802 Ga0070664_1001788022 229
101 3300005564 Ga0070664_100353951 Ga0070664_1003539512 229
102 3300005578 Ga0068854_100051140 Ga0068854_1000511403 229
103 3300005614 Ga0068856_100096514 Ga0068856_1000965142 229
104 3300005937 Ga0081455_10005471 Ga0081455_100054712 229
105 3300005985 Ga0081539_10052432 Ga0081539_100524322 229
106 3300006028 Ga0070717_10263902 Ga0070717_102639022 229
107 3300006871 Ga0075434_100103806 Ga0075434_1001038062 229
108 3300009093 Ga0105240_10426661 Ga0105240_104266612 229
109 3300009551 Ga0105238_10004780 Ga0105238_100047809 229
110 3300009551 Ga0105238_10839742 Ga0105238_108397421 229
111 3300009553 Ga0105249_10000078 Ga0105249_1000007888 229
112 3300010375 Ga0105239_10308482 Ga0105239_103084822 229
113 3300013105 Ga0157369_10102589 Ga0157369_101025892 229
114 3300013105 Ga0157369_10117744 Ga0157369_101177444 229
115 3300013296 Ga0157374_10685553 Ga0157374_106855532 229
116 3300013307 Ga0157372_10017343 Ga0157372_100173434 229
117 3300014497 Ga0182008_10005605 Ga0182008_100056058 229
118 3300025912 Ga0207707_10000322 Ga0207707_1000032233 229
119 3300025912 Ga0207707_10015989 Ga0207707_100159892 229
120 3300025912 Ga0207707_10667255 Ga0207707_106672552 229
121 3300025917 Ga0207660_10080514 Ga0207660_100805143 229
122 3300025917 Ga0207660_10100050 Ga0207660_101000502 229
123 3300025917 Ga0207660_10143950 Ga0207660_101439502 229
124 3300025919 Ga0207657_10018154 Ga0207657_100181542 229
125 3300025920 Ga0207649_10155453 Ga0207649_101554532 229
126 3300025921 Ga0207652_10097260 Ga0207652_100972602 229
127 3300025921 Ga0207652_10103519 Ga0207652_101035194 229
128 3300025922 Ga0207646_10444510 Ga0207646_104445102 229
129 3300025924 Ga0207694_10558747 Ga0207694_105587471 229
130 3300025929 Ga0207664_10135002 Ga0207664_101350022 229
131 3300025929 Ga0207664_10310789 Ga0207664_103107892 229
132 3300025944 Ga0207661_10439603 Ga0207661_104396032 229
133 3300025944 Ga0207661_10648665 Ga0207661_106486652 229
134 3300025945 Ga0207679_10043078 Ga0207679_100430784 229
135 3300025945 Ga0207679_10149467 Ga0207679_101494672 229
136 3300025945 Ga0207679_10281061 Ga0207679_102810612 229
137 3300025949 Ga0207667_10027226 Ga0207667_100272262 229
138 3300025961 Ga0207712_10000079 Ga0207712_1000007919 229
139 3300025981 Ga0207640_10326602 Ga0207640_103266022 229
140 3300025981 Ga0207640_10424799 Ga0207640_104247992 229
141 3300026041 Ga0207639_10126350 Ga0207639_101263502 229
142 3300026067 Ga0207678_10033009 Ga0207678_100330092 229
143 3300026078 Ga0207702_10051697 Ga0207702_100516972 229
144 3300026142 Ga0207698_10282852 Ga0207698_102828522 229
145 3300027717 Ga0209998_10011661 Ga0209998_100116612 229
146 3300027876 Ga0209974_10057740 Ga0209974_100577402 229
147 3300031548 Ga0307408_100168691 Ga0307408_1001686912 229
148 3300031852 Ga0307410_10027010 Ga0307410_100270102 229
149 3300031911 Ga0307412_10295987 Ga0307412_102959872 229
150 3300032005 Ga0307411_10157443 Ga0307411_101574432 229
151 3300032005 Ga0307411_10648487 Ga0307411_106484872 229
152 3300035171 Ga0373946_0083739 Ga0373946_0083739_29_718 229
153 3300035692 Ga0373935_0285752 Ga0373935_0285752_297_986 229
154 3300045051 Ga0451576_0025000 Ga0451576_0025000_4435_5136 229
155 3300045976 Ga0466967_0911658 Ga0466967_0911658_102_800 229
156 3300046477 Ga0495664_0131602 Ga0495664_0131602_768_1466 229
157 3300046516 Ga0495628_0106170 Ga0495628_0106170_1435_2133 229
158 3300046522 Ga0495643_0149651 Ga0495643_0149651_435_1124 229
159 3300046529 Ga0495652_0109755 Ga0495652_0109755_468_1166 229
160 3300046531 Ga0495665_0228155 Ga0495665_0228155_198_896 229
161 3300046543 Ga0495645_0217604 Ga0495645_0217604_333_1031 229
162 3300046559 Ga0495667_0053080 Ga0495667_0053080_344_1042 229
163 3300046678 Ga0495599_0124369 Ga0495599_0124369_127_825 229
164 3300046689 Ga0495613_0155426 Ga0495613_0155426_106_804 229
165 3300047317 Ga0495604_0089057 Ga0495604_0089057_862_1560 229
166 3300047318 Ga0495636_0148244 Ga0495636_0148244_46_738 229
167 3300047319 Ga0495674_0072646 Ga0495674_0072646_1085_1783 229
168 3300047471 Ga0495684_0018749 Ga0495684_0018749_962_1660 229
169 3300048915 Ga0496112_0160171 Ga0496112_0160171_106_795 229
170 3300048915 Ga0496112_0575124 Ga0496112_0575124_321_1010 229
171 3300049705 Ga0501225_0003383 Ga0501225_0003383_89_778 229
172 3300050512 nmdc:mga0n895_156084_c1 nmdc:mga0n895_156084_c1_839_1540 229
173 3300005327 Ga0070658_10021716 Ga0070658_100217163 230
174 3300005327 Ga0070658_10216962 Ga0070658_102169622 230
175 3300005328 Ga0070676_10029249 Ga0070676_100292492 230
176 3300005328 Ga0070676_10245083 Ga0070676_102450832 230
177 3300005329 Ga0070683_100019956 Ga0070683_1000199564 230
178 3300005329 Ga0070683_100021893 Ga0070683_1000218935 230
179 3300005329 Ga0070683_100056412 Ga0070683_1000564122 230
180 3300005336 Ga0070680_100007216 Ga0070680_1000072169 230
181 3300005336 Ga0070680_100020001 Ga0070680_1000200014 230
182 3300005336 Ga0070680_100020872 Ga0070680_1000208724 230
183 3300005336 Ga0070680_100030342 Ga0070680_1000303422 230
184 3300005337 Ga0070682_100523393 Ga0070682_1005233931 230
185 3300005338 Ga0068868_100302523 Ga0068868_1003025232 230
186 3300005339 Ga0070660_100255466 Ga0070660_1002554662 230
187 3300005339 Ga0070660_100574027 Ga0070660_1005740272 230
188 3300005340 Ga0070689_100017373 Ga0070689_1000173735 230
189 3300005341 Ga0070691_10165939 Ga0070691_101659392 230
190 3300005344 Ga0070661_100025402 Ga0070661_1000254024 230
191 3300005344 Ga0070661_100034765 Ga0070661_1000347654 230
192 3300005344 Ga0070661_100070396 Ga0070661_1000703962 230
193 3300005344 Ga0070661_100153466 Ga0070661_1001534662 230
194 3300005344 Ga0070661_100215421 Ga0070661_1002154212 230
195 3300005344 Ga0070661_100329490 Ga0070661_1003294902 230
196 3300005345 Ga0070692_10195547 Ga0070692_101955472 230
197 3300005347 Ga0070668_100010325 Ga0070668_1000103253 230
198 3300005347 Ga0070668_100082570 Ga0070668_1000825702 230
199 3300005347 Ga0070668_100234516 Ga0070668_1002345162 230
200 3300005353 Ga0070669_100009190 Ga0070669_1000091907 230
201 3300005354 Ga0070675_100007808 Ga0070675_1000078082 230
202 3300005354 Ga0070675_100030937 Ga0070675_1000309373 230
203 3300005355 Ga0070671_100043066 Ga0070671_1000430663 230
204 3300005355 Ga0070671_100240416 Ga0070671_1002404162 230
205 3300005355 Ga0070671_100813311 Ga0070671_1008133111 230
206 3300005364 Ga0070673_100058044 Ga0070673_1000580443 230
207 3300005364 Ga0070673_100385644 Ga0070673_1003856443 230
208 3300005364 Ga0070673_100428441 Ga0070673_1004284411 230
209 3300005364 Ga0070673_100477571 Ga0070673_1004775712 230
210 3300005365 Ga0070688_100019852 Ga0070688_1000198522 230
211 3300005365 Ga0070688_100046098 Ga0070688_1000460982 230
212 3300005366 Ga0070659_100035705 Ga0070659_1000357054 230
213 3300005366 Ga0070659_100433969 Ga0070659_1004339691 230
214 3300005367 Ga0070667_100067569 Ga0070667_1000675693 230
215 3300005367 Ga0070667_100375065 Ga0070667_1003750652 230
216 3300005434 Ga0070709_10007406 Ga0070709_100074062 230
217 3300005435 Ga0070714_100007479 Ga0070714_1000074794 230
218 3300005437 Ga0070710_10024779 Ga0070710_100247792 230
219 3300005438 Ga0070701_10203397 Ga0070701_102033971 230
220 3300005439 Ga0070711_100242343 Ga0070711_1002423432 230
221 3300005444 Ga0070694_100362838 Ga0070694_1003628382 230
222 3300005455 Ga0070663_100228598 Ga0070663_1002285982 230
223 3300005458 Ga0070681_10000631 Ga0070681_1000063117 230
224 3300005458 Ga0070681_10001027 Ga0070681_1000102725 230
225 3300005458 Ga0070681_10006014 Ga0070681_100060147 230
226 3300005458 Ga0070681_10025940 Ga0070681_100259403 230
227 3300005458 Ga0070681_10212643 Ga0070681_102126432 230
228 3300005458 Ga0070681_10434431 Ga0070681_104344312 230
229 3300005466 Ga0070685_10023937 Ga0070685_100239373 230
230 3300005518 Ga0070699_100020660 Ga0070699_1000206602 230
231 3300005518 Ga0070699_100742498 Ga0070699_1007424982 230
232 3300005530 Ga0070679_100002378 Ga0070679_1000023783 230
233 3300005530 Ga0070679_100003980 Ga0070679_1000039802 230
234 3300005530 Ga0070679_100004645 Ga0070679_1000046459 230
235 3300005530 Ga0070679_100026050 Ga0070679_1000260507 230
236 3300005535 Ga0070684_100004275 Ga0070684_1000042755 230
237 3300005535 Ga0070684_100006282 Ga0070684_1000062827 230
238 3300005535 Ga0070684_100006841 Ga0070684_1000068417 230
239 3300005535 Ga0070684_100140878 Ga0070684_1001408782 230
240 3300005535 Ga0070684_100300108 Ga0070684_1003001081 230
241 3300005535 Ga0070684_100553232 Ga0070684_1005532322 230
242 3300005535 Ga0070684_100794150 Ga0070684_1007941501 230
243 3300005543 Ga0070672_100070714 Ga0070672_1000707141 230
244 3300005543 Ga0070672_100203913 Ga0070672_1002039132 230
245 3300005543 Ga0070672_100234283 Ga0070672_1002342832 230
246 3300005546 Ga0070696_100552414 Ga0070696_1005524141 230
247 3300005547 Ga0070693_100054815 Ga0070693_1000548152 230
248 3300005563 Ga0068855_100055481 Ga0068855_1000554812 230
249 3300005563 Ga0068855_100082035 Ga0068855_1000820352 230
250 3300005563 Ga0068855_100210345 Ga0068855_1002103452 230
251 3300005564 Ga0070664_100005637 Ga0070664_10000563713 230
252 3300005564 Ga0070664_100025323 Ga0070664_1000253233 230
253 3300005564 Ga0070664_100119931 Ga0070664_1001199312 230
254 3300005577 Ga0068857_100039271 Ga0068857_1000392712 230
255 3300005577 Ga0068857_100092038 Ga0068857_1000920384 230
256 3300005577 Ga0068857_100321505 Ga0068857_1003215052 230
257 3300005578 Ga0068854_100395699 Ga0068854_1003956991 230
258 3300005616 Ga0068852_100044902 Ga0068852_1000449022 230
259 3300005618 Ga0068864_100229898 Ga0068864_1002298982 230
260 3300005618 Ga0068864_100663703 Ga0068864_1006637032 230
261 3300005840 Ga0068870_10008889 Ga0068870_100088895 230
262 3300005843 Ga0068860_100702612 Ga0068860_1007026121 230
263 3300006844 Ga0075428_100700177 Ga0075428_1007001772 230
264 3300006847 Ga0075431_100507193 Ga0075431_1005071932 230
265 3300006881 Ga0068865_100027987 Ga0068865_1000279872 230
266 3300009093 Ga0105240_10003569 Ga0105240_1000356917 230
267 3300009093 Ga0105240_10006327 Ga0105240_1000632711 230
268 3300009093 Ga0105240_10407501 Ga0105240_104075012 230
269 3300009093 Ga0105240_10698665 Ga0105240_106986652 230
270 3300009098 Ga0105245_10087206 Ga0105245_100872062 230
271 3300009098 Ga0105245_10413853 Ga0105245_104138531 230
272 3300009147 Ga0114129_10719300 Ga0114129_107193002 230
273 3300009148 Ga0105243_10138049 Ga0105243_101380492 230
274 3300009174 Ga0105241_10000025 Ga0105241_1000002592 230
275 3300009174 Ga0105241_10152133 Ga0105241_101521332 230
276 3300009174 Ga0105241_10498870 Ga0105241_104988702 230
277 3300009176 Ga0105242_10043077 Ga0105242_100430775 230
278 3300009177 Ga0105248_10068273 Ga0105248_100682732 230
279 3300009177 Ga0105248_10619839 Ga0105248_106198392 230
280 3300009177 Ga0105248_10690162 Ga0105248_106901621 230
281 3300009177 Ga0105248_10919636 Ga0105248_109196362 230
282 3300009545 Ga0105237_10473675 Ga0105237_104736752 230
283 3300009551 Ga0105238_10537240 Ga0105238_105372402 230
284 3300013100 Ga0157373_10029156 Ga0157373_100291564 230
285 3300013102 Ga0157371_10224890 Ga0157371_102248902 230
286 3300013104 Ga0157370_10001847 Ga0157370_1000184715 230
287 3300013104 Ga0157370_10021404 Ga0157370_100214043 230
288 3300013104 Ga0157370_10119209 Ga0157370_101192093 230
289 3300013104 Ga0157370_10138889 Ga0157370_101388892 230
290 3300013105 Ga0157369_10033903 Ga0157369_100339036 230
291 3300013296 Ga0157374_10116363 Ga0157374_101163634 230
292 3300013297 Ga0157378_10959352 Ga0157378_109593521 230
293 3300013307 Ga0157372_10002084 Ga0157372_1000208415 230
294 3300013307 Ga0157372_10030167 Ga0157372_100301675 230
295 3300013307 Ga0157372_10039692 Ga0157372_100396922 230
296 3300013307 Ga0157372_10043975 Ga0157372_100439752 230
297 3300013307 Ga0157372_10076385 Ga0157372_100763854 230
298 3300013307 Ga0157372_10174298 Ga0157372_101742982 230
299 3300013307 Ga0157372_10275780 Ga0157372_102757802 230
300 3300013308 Ga0157375_10018916 Ga0157375_100189163 230
301 3300013308 Ga0157375_10066196 Ga0157375_100661962 230
302 3300013308 Ga0157375_10068237 Ga0157375_100682374 230
303 3300013308 Ga0157375_10422428 Ga0157375_104224282 230
304 3300014325 Ga0163163_10427828 Ga0163163_104278282 230
305 3300014325 Ga0163163_10764526 Ga0163163_107645262 230
306 3300014326 Ga0157380_10159673 Ga0157380_101596733 230
307 3300014745 Ga0157377_10162183 Ga0157377_101621832 230
308 3300014968 Ga0157379_10676853 Ga0157379_106768532 230
309 3300014969 Ga0157376_10179820 Ga0157376_101798202 230
310 3300020069 Ga0197907_11188549 Ga0197907_111885494 230
311 3300020081 Ga0206354_11678005 Ga0206354_116780052 230
312 3300021384 Ga0213876_10010396 Ga0213876_100103962 230
313 3300025315 Ga0207697_10060832 Ga0207697_100608322 230
314 3300025321 Ga0207656_10010840 Ga0207656_100108405 230
315 3300025898 Ga0207692_10130290 Ga0207692_101302902 230
316 3300025903 Ga0207680_10494042 Ga0207680_104940422 230
317 3300025907 Ga0207645_10019731 Ga0207645_100197314 230
318 3300025907 Ga0207645_10133121 Ga0207645_101331212 230
319 3300025907 Ga0207645_10249535 Ga0207645_102495352 230
320 3300025909 Ga0207705_10016916 Ga0207705_100169168 230
321 3300025909 Ga0207705_10019742 Ga0207705_100197423 230
322 3300025909 Ga0207705_10217378 Ga0207705_102173782 230
323 3300025911 Ga0207654_10000492 Ga0207654_1000049214 230
324 3300025911 Ga0207654_10076372 Ga0207654_100763723 230
325 3300025912 Ga0207707_10003416 Ga0207707_1000341613 230
326 3300025912 Ga0207707_10003644 Ga0207707_100036447 230
327 3300025912 Ga0207707_10005438 Ga0207707_100054389 230
328 3300025912 Ga0207707_10009065 Ga0207707_100090656 230
329 3300025912 Ga0207707_10155470 Ga0207707_101554702 230
330 3300025912 Ga0207707_10270919 Ga0207707_102709192 230
331 3300025913 Ga0207695_10002468 Ga0207695_1000246826 230
332 3300025913 Ga0207695_10005733 Ga0207695_100057333 230
333 3300025913 Ga0207695_10011715 Ga0207695_100117157 230
334 3300025913 Ga0207695_10060635 Ga0207695_100606352 230
335 3300025913 Ga0207695_10104379 Ga0207695_101043793 230
336 3300025913 Ga0207695_10637951 Ga0207695_106379512 230
337 3300025916 Ga0207663_10378413 Ga0207663_103784132 230
338 3300025917 Ga0207660_10041782 Ga0207660_100417823 230
339 3300025917 Ga0207660_10057137 Ga0207660_100571372 230
340 3300025917 Ga0207660_10060780 Ga0207660_100607802 230
341 3300025918 Ga0207662_10002925 Ga0207662_100029253 230
342 3300025919 Ga0207657_10351805 Ga0207657_103518052 230
343 3300025920 Ga0207649_10032369 Ga0207649_100323695 230
344 3300025920 Ga0207649_10114033 Ga0207649_101140332 230
345 3300025920 Ga0207649_10115150 Ga0207649_101151502 230
346 3300025920 Ga0207649_10454141 Ga0207649_104541412 230
347 3300025921 Ga0207652_10006464 Ga0207652_100064645 230
348 3300025921 Ga0207652_10010695 Ga0207652_100106952 230
349 3300025921 Ga0207652_10011127 Ga0207652_100111272 230
350 3300025921 Ga0207652_10024692 Ga0207652_100246922 230
351 3300025921 Ga0207652_10050197 Ga0207652_100501974 230
352 3300025921 Ga0207652_10062448 Ga0207652_100624483 230
353 3300025921 Ga0207652_10068825 Ga0207652_100688253 230
354 3300025921 Ga0207652_10102470 Ga0207652_101024703 230
355 3300025923 Ga0207681_10004225 Ga0207681_100042257 230
356 3300025924 Ga0207694_10091178 Ga0207694_100911784 230
357 3300025925 Ga0207650_10068273 Ga0207650_100682731 230
358 3300025929 Ga0207664_10043146 Ga0207664_100431463 230
359 3300025931 Ga0207644_10074807 Ga0207644_100748072 230
360 3300025932 Ga0207690_10088478 Ga0207690_100884782 230
361 3300025932 Ga0207690_10166985 Ga0207690_101669852 230
362 3300025932 Ga0207690_10851634 Ga0207690_108516341 230
363 3300025933 Ga0207706_10135684 Ga0207706_101356842 230
364 3300025934 Ga0207686_10037389 Ga0207686_100373892 230
365 3300025936 Ga0207670_10098450 Ga0207670_100984503 230
366 3300025937 Ga0207669_10324465 Ga0207669_103244652 230
367 3300025938 Ga0207704_10034858 Ga0207704_100348582 230
368 3300025939 Ga0207665_10000198 Ga0207665_100001982 230
369 3300025940 Ga0207691_10013294 Ga0207691_100132949 230
370 3300025940 Ga0207691_10077436 Ga0207691_100774363 230
371 3300025942 Ga0207689_10094631 Ga0207689_100946312 230
372 3300025944 Ga0207661_10000396 Ga0207661_1000039618 230
373 3300025944 Ga0207661_10003118 Ga0207661_100031184 230
374 3300025944 Ga0207661_10027519 Ga0207661_100275192 230
375 3300025944 Ga0207661_10053848 Ga0207661_100538482 230
376 3300025944 Ga0207661_10055595 Ga0207661_100555952 230
377 3300025944 Ga0207661_10066838 Ga0207661_100668383 230
378 3300025944 Ga0207661_10080070 Ga0207661_100800702 230
379 3300025944 Ga0207661_10092143 Ga0207661_100921432 230
380 3300025944 Ga0207661_10234674 Ga0207661_102346742 230
381 3300025945 Ga0207679_10049674 Ga0207679_100496742 230
382 3300025945 Ga0207679_10053749 Ga0207679_100537492 230
383 3300025945 Ga0207679_10076991 Ga0207679_100769914 230
384 3300025945 Ga0207679_10079509 Ga0207679_100795093 230
385 3300025945 Ga0207679_10176164 Ga0207679_101761642 230
386 3300025945 Ga0207679_10364579 Ga0207679_103645792 230
387 3300025949 Ga0207667_10091232 Ga0207667_100912322 230
388 3300025960 Ga0207651_10124061 Ga0207651_101240611 230
389 3300025960 Ga0207651_10616280 Ga0207651_106162802 230
390 3300025972 Ga0207668_10058640 Ga0207668_100586402 230
391 3300025972 Ga0207668_10104619 Ga0207668_101046192 230
392 3300025972 Ga0207668_10378464 Ga0207668_103784642 230
393 3300025981 Ga0207640_10007497 Ga0207640_100074974 230
394 3300025986 Ga0207658_10112598 Ga0207658_101125982 230
395 3300026023 Ga0207677_10352035 Ga0207677_103520351 230
396 3300026023 Ga0207677_10448449 Ga0207677_104484492 230
397 3300026035 Ga0207703_10150019 Ga0207703_101500192 230
398 3300026041 Ga0207639_10302099 Ga0207639_103020992 230
399 3300026041 Ga0207639_10387897 Ga0207639_103878972 230
400 3300026089 Ga0207648_10299950 Ga0207648_102999502 230
401 3300026116 Ga0207674_10016913 Ga0207674_100169137 230
402 3300026116 Ga0207674_10018642 Ga0207674_100186424 230
403 3300026116 Ga0207674_10335055 Ga0207674_103350552 230
404 3300026116 Ga0207674_10413491 Ga0207674_104134912 230
405 3300026142 Ga0207698_10023939 Ga0207698_100239393 230
406 3300026142 Ga0207698_10714412 Ga0207698_107144122 230
407 3300028379 Ga0268266_10479380 Ga0268266_104793802 230
408 3300028381 Ga0268264_10150212 Ga0268264_101502122 230
409 3300031548 Ga0307408_100010153 Ga0307408_1000101533 230
410 3300031548 Ga0307408_100247394 Ga0307408_1002473942 230
411 3300031548 Ga0307408_100455392 Ga0307408_1004553922 230
412 3300031731 Ga0307405_10000086 Ga0307405_100000865 230
413 3300031731 Ga0307405_10018983 Ga0307405_100189834 230
414 3300031731 Ga0307405_10239465 Ga0307405_102394652 230
415 3300031731 Ga0307405_10419185 Ga0307405_104191852 230
416 3300031731 Ga0307405_10630474 Ga0307405_106304742 230
417 3300031852 Ga0307410_10000638 Ga0307410_1000063811 230
418 3300031852 Ga0307410_10079816 Ga0307410_100798162 230
419 3300031852 Ga0307410_10100501 Ga0307410_101005012 230
420 3300031852 Ga0307410_10165506 Ga0307410_101655062 230
421 3300031901 Ga0307406_10000581 Ga0307406_1000058123 230
422 3300031901 Ga0307406_10014298 Ga0307406_100142982 230
423 3300031901 Ga0307406_10091223 Ga0307406_100912232 230
424 3300031901 Ga0307406_10120095 Ga0307406_101200953 230
425 3300031903 Ga0307407_10000133 Ga0307407_1000013313 230
426 3300031903 Ga0307407_10079094 Ga0307407_100790942 230
427 3300031903 Ga0307407_10112876 Ga0307407_101128762 230
428 3300031911 Ga0307412_10011207 Ga0307412_100112074 230
429 3300031995 Ga0307409_100000277 Ga0307409_1000002775 230
430 3300031995 Ga0307409_100008908 Ga0307409_1000089087 230
431 3300031995 Ga0307409_100045955 Ga0307409_1000459552 230
432 3300031995 Ga0307409_100269100 Ga0307409_1002691002 230
433 3300031995 Ga0307409_100371342 Ga0307409_1003713422 230
434 3300032002 Ga0307416_100001149 Ga0307416_1000011497 230
435 3300032002 Ga0307416_100077096 Ga0307416_1000770963 230
436 3300032004 Ga0307414_10477417 Ga0307414_104774172 230
437 3300032005 Ga0307411_10040426 Ga0307411_100404264 230
438 3300032005 Ga0307411_10056691 Ga0307411_100566912 230
439 3300032005 Ga0307411_10453040 Ga0307411_104530402 230
440 3300032126 Ga0307415_100001402 Ga0307415_1000014027 230
441 3300032126 Ga0307415_100013088 Ga0307415_1000130882 230
442 3300035086 Ga0373934_0000531 Ga0373934_0000531_6105_6833 230
443 3300035111 Ga0373923_0003955 Ga0373923_0003955_1944_2672 230
444 3300035117 Ga0373953_0001218 Ga0373953_0001218_570_1298 230
445 3300035119 Ga0373956_0084675 Ga0373956_0084675_243_971 230
446 3300035172 Ga0373955_0000269 Ga0373955_0000269_9322_10050 230
447 3300035724 Ga0373933_0000055 Ga0373933_0000055_36223_36951 230
448 3300036401 Ga0373937_0000420 Ga0373937_0000420_16955_17683 230
449 3300036401 Ga0373937_0588843 Ga0373937_0588843_60_764 230
450 3300037312 Ga0395899_0037444 Ga0395899_0037444_1527_2312 230
451 3300037418 Ga0395900_0080139 Ga0395900_0080139_1029_1814 230
452 3300037471 Ga0395905_0004043 Ga0395905_0004043_1157_1942 230
453 3300037471 Ga0395905_0108035 Ga0395905_0108035_134_922 230
454 3300038443 Ga0395901_0002608 Ga0395901_0002608_1510_2295 230
455 3300039437 Ga0436365_0815860 Ga0436365_0815860_102_893 230
456 3300046454 Ga0495592_0000395 Ga0495592_0000395_18239_18967 230
457 3300046459 Ga0495629_0024246 Ga0495629_0024246_1567_2295 230
458 3300046462 Ga0495651_0000287 Ga0495651_0000287_30760_31488 230
459 3300046463 Ga0495653_0000232 Ga0495653_0000232_3549_4277 230
460 3300046499 Ga0495594_0046600 Ga0495594_0046600_407_1108 230
461 3300046511 Ga0495608_0000085 Ga0495608_0000085_36158_36886 230
462 3300046514 Ga0495618_0261465 Ga0495618_0261465_187_915 230
463 3300046516 Ga0495628_0000154 Ga0495628_0000154_38530_39258 230
464 3300046517 Ga0495630_0002303 Ga0495630_0002303_9011_9739 230
465 3300046529 Ga0495652_0083037 Ga0495652_0083037_766_1494 230
466 3300046531 Ga0495665_0029677 Ga0495665_0029677_372_1100 230
467 3300046535 Ga0495586_0061427 Ga0495586_0061427_176_904 230
468 3300046536 Ga0495587_0000678 Ga0495587_0000678_14094_14822 230
469 3300046537 Ga0495598_0042834 Ga0495598_0042834_127_831 230
470 3300046543 Ga0495645_0000763 Ga0495645_0000763_15632_16360 230
471 3300046642 Ga0495634_0101898 Ga0495634_0101898_950_1678 230
472 3300046663 Ga0495635_0000219 Ga0495635_0000219_31622_32350 230
473 3300046675 Ga0495657_0001169 Ga0495657_0001169_849_1577 230
474 3300046678 Ga0495599_0000320 Ga0495599_0000320_7777_8505 230
475 3300046679 Ga0495623_0000750 Ga0495623_0000750_15416_16144 230
476 3300046679 Ga0495623_0172514 Ga0495623_0172514_474_1178 230
477 3300046680 Ga0495646_0033128 Ga0495646_0033128_1704_2432 230
478 3300046684 Ga0495669_0045989 Ga0495669_0045989_560_1264 230
479 3300046689 Ga0495613_0155337 Ga0495613_0155337_30_758 230
480 3300046809 Ga0495600_0000023 Ga0495600_0000023_32620_33348 230
481 3300046809 Ga0495600_0163616 Ga0495600_0163616_71_775 230
482 3300047317 Ga0495604_0013275 Ga0495604_0013275_5767_6495 230
483 3300047317 Ga0495604_0024747 Ga0495604_0024747_3793_4497 230
484 3300047319 Ga0495674_0002240 Ga0495674_0002240_9143_9871 230
485 3300047322 Ga0495680_0005182 Ga0495680_0005182_10085_10813 230
486 3300047471 Ga0495684_0000037 Ga0495684_0000037_48141_48869 230
487 3300047673 Ga0495593_0201456 Ga0495593_0201456_90_818 230
488 3300048088 Ga0495602_0000290 Ga0495602_0000290_12218_12946 230
489 3300048903 Ga0496100_0267906 Ga0496100_0267906_178_882 230
490 3300048904 Ga0496101_0017130 Ga0496101_0017130_645_1349 230
491 3300048904 Ga0496101_0196815 Ga0496101_0196815_39_761 230
492 3300048907 Ga0496104_0204952 Ga0496104_0204952_51_755 230
493 3300048910 Ga0496107_0384916 Ga0496107_0384916_179_883 230
494 3300048915 Ga0496112_0195710 Ga0496112_0195710_138_842 230
495 3300048916 Ga0496113_0390944 Ga0496113_0390944_161_865 230
496 3300048917 Ga0496114_0086057 Ga0496114_0086057_1249_1971 230
497 3300049570 Ga0501033_0045560 Ga0501033_0045560_1967_2677 230
498 3300049571 Ga0501034_0056683 Ga0501034_0056683_2566_3276 230
499 3300049574 Ga0501038_0376991 Ga0501038_0376991_312_1007 230
500 3300049576 Ga0501040_0124653 Ga0501040_0124653_581_1276 230
501 3300049578 Ga0501042_0100797 Ga0501042_0100797_816_1511 230
502 3300049580 Ga0501046_0219822 Ga0501046_0219822_498_1193 230
503 3300049580 Ga0501046_0348756 Ga0501046_0348756_166_858 230
504 3300049581 Ga0501047_0220257 Ga0501047_0220257_713_1423 230
505 3300049589 Ga0501073_0042080 Ga0501073_0042080_1070_1780 230
506 3300049591 Ga0501075_0030063 Ga0501075_0030063_1553_2248 230
507 3300049741 Ga0501079_0041662 Ga0501079_0041662_2036_2731 230
508 3300049742 Ga0501080_0117637 Ga0501080_0117637_868_1563 230
509 3300049743 Ga0501081_0121629 Ga0501081_0121629_784_1479 230
510 3300049823 Ga0501044_0880528 Ga0501044_0880528_38_736 230
511 3300050507 nmdc:mga05p37_30138_c1 nmdc:mga05p37_30138_c1_1459_2157 230
512 3300050509 nmdc:mga0qj67_164398_c1 nmdc:mga0qj67_164398_c1_856_1554 230
513 3300050510 nmdc:mga06r32_114706_c1 nmdc:mga06r32_114706_c1_578_1276 230
514 3300050512 nmdc:mga0n895_396329_c1 nmdc:mga0n895_396329_c1_191_919 230
515 3300050514 nmdc:mga08x19_33339_c1 nmdc:mga08x19_33339_c1_1220_1996 230
516 3300053077 Ga0495601_0014940 Ga0495601_0014940_372_1100 230
517 3300053078 Ga0495612_0000437 Ga0495612_0000437_857_1585 230
518 3300053085 Ga0495619_0003858 Ga0495619_0003858_3296_4024 230
519 3300060353 Ga0501082_0229146 Ga0501082_0229146_506_1201 230
520 3300005341 Ga0070691_10002925 Ga0070691_100029259 231
521 3300005327 Ga0070658_10010637 Ga0070658_100106375 232
522 3300005327 Ga0070658_10338297 Ga0070658_103382972 232
523 3300005339 Ga0070660_100028943 Ga0070660_1000289434 232
524 3300005366 Ga0070659_100015438 Ga0070659_1000154387 232
525 3300005436 Ga0070713_100127675 Ga0070713_1001276751 232
526 3300005530 Ga0070679_100045465 Ga0070679_1000454652 232
527 3300005530 Ga0070679_100250616 Ga0070679_1002506162 232
528 3300005530 Ga0070679_100610638 Ga0070679_1006106382 232
529 3300005530 Ga0070679_100757466 Ga0070679_1007574661 232
530 3300005563 Ga0068855_100220896 Ga0068855_1002208962 232
531 3300013100 Ga0157373_10038315 Ga0157373_100383155 232
532 3300013105 Ga0157369_10028472 Ga0157369_100284726 232
533 3300013307 Ga0157372_10003298 Ga0157372_100032982 232
534 3300025909 Ga0207705_10045257 Ga0207705_100452572 232
535 3300025921 Ga0207652_10220810 Ga0207652_102208102 232
536 3300025928 Ga0207700_10479805 Ga0207700_104798052 232
537 3300025929 Ga0207664_10086321 Ga0207664_100863212 232
538 3300049579 Ga0501043_0059360 Ga0501043_0059360_302_1000 232
539 3300049581 Ga0501047_0015612 Ga0501047_0015612_2773_3471 232
540 3300049586 Ga0501070_0026560 Ga0501070_0026560_3753_4451 232
541 3300049822 Ga0501035_0212432 Ga0501035_0212432_321_1019 232
542 3300049823 Ga0501044_0388546 Ga0501044_0388546_457_1155 232

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01128

IspD

2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

54

275

0.95

PF12804

NTP_transf_3

MobA-like NTP transferase domain

56

223

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2px7-assembly1.cif.gz_A crystal structure of 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase from thermus thermophilus hb8 0.9293 5 230
5hs2-assembly1.cif.gz_B crystal structure of ispd complexed with ctp and mg2+ from bacillus subtilis at 1.90 angstroms resolution 0.9212 5 231
2px7-assembly1.cif.gz_A crystal structure of 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase from thermus thermophilus hb8 0.9206 5 230
5ddv-assembly1.cif.gz_A-2 error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9197 5 230
5hs2-assembly1.cif.gz_A crystal structure of ispd complexed with ctp and mg2+ from bacillus subtilis at 1.90 angstroms resolution 0.918 5 231
ID Description Score Start End Superfamily
5ddvA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9197 5 230 3.90.550.10
af_B4FP01_68_298_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9161 1 229 3.90.550.10
1vpaB00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9158 5 229 3.90.550.10
2px7B00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9144 9 230 3.90.550.10
5ddvA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9118 5 230 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A838QC08-F1-model_v4 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT) 0.984 3 232 GO:0019288
GO:0050518
AF-A0A838QC08-F1-model_v4 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT) 0.9755 3 232 GO:0019288
GO:0050518
AF-A0A2V6C5P0-F1-model_v4 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 0.9729 81 229 GO:0050518
AF-A0A5Q4DF95-F1-model_v4 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT) 0.9688 1 228 GO:0004725
GO:0019288
GO:0050518
AF-A0A7Y2U7A7-F1-model_v4 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 0.9668 83 231 GO:0050518

Feature Viewer

pLDDT pTM Quality
91.27 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map