F461500

General Info

Members Datasets Scaffolds Average Seq Length
542 281 521 278

Family's Representative Sequence

Representative Sequence 3300030521|Ga0307511_10001654|Ga0307511_100016548
Length 341
Sequence MPDCGILIINKVVQVYFNKGLSLSDKLPIAGRPRYKTLPAGYLKIPGKPYFTSMIVVIQCKDQVGLVAAISGVLAKEQLNIVSLREHVDKVENRFFIRIEVDGYPGNLEDRHSKAVEDSRSVALEQKMKDLLPPDALVTINPLPEKKIVVLVTKEYHCLADILVRHHFRSLGAAVQCVIGNHPVLQDICERFGIPFYRVSHEELTKELFEQQIVDIIERCAPDYIVLAKFMRILSPGFVARYPARIINIHHSFLPAFAGANPYRKAFERGVKLIGATAHFVTHELDEGPIITQEIIPVSHSFTAADMMKAGKEIETSVLAKALRLVFEDRVFVYNNKTVVL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2738541283 Pedobacter sp. OK701 Isolate Unclassified
4 2738541284 Pedobacter sp. YR016 Isolate Unclassified
5 2738541302 Pedobacter sp. CF074 Isolate Unclassified
6 2738543023 Pedobacter sp. OK628 Isolate Unclassified
7 2739367651 Pedobacter sp. OK291 Isolate Unclassified
8 2739367656 Pedobacter sp. CF523 Isolate Unclassified
9 2739367663 Pedobacter sp. YR510 Isolate Unclassified
10 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
11 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
12 2818991437 Pedobacter terrae 518 Isolate Unclassified
13 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
14 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
15 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
16 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
17 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
18 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
19 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
20 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
21 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
22 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
25 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
26 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
27 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
28 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
29 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
30 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
31 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
32 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
33 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
34 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
35 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
36 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
37 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
42 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
118 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
119 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
123 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
124 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
125 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
126 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
130 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
181 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
182 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
183 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
194 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
201 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
202 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
203 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
204 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
207 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
215 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
216 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
217 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
218 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
221 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
222 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
223 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
224 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
225 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
226 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
227 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
228 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
229 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
230 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
231 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
232 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
233 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
244 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
245 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
252 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
253 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
259 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
263 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
264 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
265 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
266 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
267 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
268 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
269 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
270 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
271 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
272 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
273 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
274 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
275 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
276 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
277 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
278 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
279 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.13
Metatranscriptomes 0
Isolates 3.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.78
Nodule 0
Rhizoplane 0.74
Rhizosphere 84.13
Stem 0
Stem Tuber 0
Unclassified 5.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2332060 2162886007 Bacteria 996
2 SwRhRL2b_contig_2990130 2162886007 Bacteria 4572
3 JGI24737J22298_10002725 3300001990 Bacteria 6247
4 JGI24737J22298_10003609 3300001990 Bacteria 5454
5 JGI24737J22298_10014460 3300001990 Bacteria 2562
6 JGI24735J21928_10000010 3300002067 Bacteria 237152
7 JGI24735J21928_10009342 3300002067 Bacteria 3151
8 JGI25162J39368_1000005 3300002737 Bacteria 435925
9 JGI25164J39214_1000820 3300002772 Bacteria 10880
10 JGI25152J39213_1000028 3300002773 Bacteria 100367
11 JGI25150J39212_1000006 3300002774 Bacteria 257228
12 JGI25151J46595_10000024 3300003187 Bacteria 217596
13 JGI25153J46596_10000026 3300003215 Bacteria 217245
14 rootH1_10093589 3300003316 Bacteria 3670
15 rootH2_10060614 3300003320 Bacteria 2749
16 rootH2_10173383 3300003320 Bacteria 2397
17 rootL2_10024252 3300003322 Bacteria 6664
18 rootL2_10051934 3300003322 Bacteria 4689
19 rootL2_10114251 3300003322 Bacteria 2501
20 rootH1_10004576 3300003323 Bacteria 68064
21 rootH1_10265515 3300003323 Bacteria 1604
22 rootH1_10360764 3300003323 Bacteria 1453
23 Ga0055536_1000002 3300003781 Bacteria 605605
24 Ga0055530_10003780 3300003791 Bacteria 8345
25 Ga0065714_10002303 3300005288 Bacteria 42461
26 Ga0065714_10002338 3300005288 Bacteria 23916
27 Ga0065714_10064672 3300005288 Bacteria 24535
28 Ga0065714_10070076 3300005288 Bacteria 3978
29 Ga0065714_10092517 3300005288 Bacteria 1869
30 Ga0065704_10000214 3300005289 Bacteria 119751
31 Ga0065704_10072187 3300005289 Bacteria 8980
32 Ga0065704_10074124 3300005289 Bacteria 6511
33 Ga0065712_10004276 3300005290 Bacteria 3298
34 Ga0070658_10040046 3300005327 Bacteria 3781
35 Ga0070683_100014426 3300005329 Bacteria 6912
36 Ga0070683_100348508 3300005329 Bacteria 1410
37 Ga0070690_100325099 3300005330 Bacteria 1109
38 Ga0070670_100049908 3300005331 Bacteria 3597
39 Ga0070670_100069190 3300005331 Bacteria 3030
40 Ga0070677_10055255 3300005333 Unclassified 1620
41 Ga0068869_100296872 3300005334 Bacteria 1303
42 Ga0070666_10027477 3300005335 Bacteria 3727
43 Ga0070666_10045832 3300005335 Bacteria 2931
44 Ga0070666_10105348 3300005335 Bacteria 1948
45 Ga0070682_100057061 3300005337 Bacteria 2458
46 Ga0068868_100019587 3300005338 Bacteria 5072
47 Ga0068868_100073991 3300005338 Bacteria 2720
48 Ga0070689_100007881 3300005340 Bacteria 7469
49 Ga0070668_100161342 3300005347 Bacteria 1819
50 Ga0070669_100011362 3300005353 Bacteria 6321
51 Ga0070675_100020822 3300005354 Bacteria 5234
52 Ga0070675_100077299 3300005354 Bacteria 2770
53 Ga0070671_100102453 3300005355 Bacteria 2402
54 Ga0070674_100109667 3300005356 Bacteria 2024
55 Ga0070673_100036768 3300005364 Unclassified 3726
56 Ga0070688_100017731 3300005365 Bacteria 4091
57 Ga0070688_100039310 3300005365 Bacteria 2894
58 Ga0070659_100069493 3300005366 Bacteria 2796
59 Ga0070667_100077893 3300005367 Bacteria 2831
60 Ga0070711_100000405 3300005439 Bacteria 22335
61 Ga0070678_100069854 3300005456 Unclassified 2624
62 Ga0070678_100376836 3300005456 Bacteria 1227
63 Ga0070681_10159230 3300005458 Bacteria 2181
64 Ga0070679_100124629 3300005530 Bacteria 2559
65 Ga0070684_100091718 3300005535 Bacteria 2703
66 Ga0070684_100147076 3300005535 Bacteria 2133
67 Ga0070684_100301222 3300005535 Bacteria 1471
68 Ga0068853_100655702 3300005539 Bacteria 999
69 Ga0070672_100109941 3300005543 Unclassified 2245
70 Ga0070665_100144306 3300005548 Unclassified 2384
71 Ga0070665_100172447 3300005548 Bacteria 2164
72 Ga0068855_100000014 3300005563 Bacteria 232720
73 Ga0068855_100002947 3300005563 Bacteria 20801
74 Ga0068855_100004470 3300005563 Bacteria 17094
75 Ga0068855_100018554 3300005563 Bacteria 8365
76 Ga0068855_100098597 3300005563 Bacteria 3366
77 Ga0068855_100210611 3300005563 Bacteria 2184
78 Ga0070664_100160766 3300005564 Bacteria 1987
79 Ga0068857_100018131 3300005577 Bacteria 6173
80 Ga0068857_100019349 3300005577 Bacteria 5977
81 Ga0068857_100083158 3300005577 Bacteria 2859
82 Ga0068857_100116561 3300005577 Bacteria 2403
83 Ga0068857_100241274 3300005577 Bacteria 1655
84 Ga0068854_100115194 3300005578 Bacteria 2033
85 Ga0068854_100248311 3300005578 Bacteria 1420
86 Ga0068854_100425748 3300005578 Unclassified 1103
87 Ga0068856_100009673 3300005614 Bacteria 9361
88 Ga0068856_100013770 3300005614 Bacteria 7819
89 Ga0068856_100042520 3300005614 Bacteria 4470
90 Ga0068856_100073650 3300005614 Bacteria 3381
91 Ga0068852_100001164 3300005616 Bacteria 17398
92 Ga0068852_100268373 3300005616 Bacteria 1641
93 Ga0068852_100309484 3300005616 Bacteria 1531
94 Ga0068859_100032442 3300005617 Bacteria 5246
95 Ga0068859_100249205 3300005617 Bacteria 1866
96 Ga0068859_100897501 3300005617 Bacteria 971
97 Ga0068870_10086325 3300005840 Unclassified 1745
98 Ga0068863_100347695 3300005841 Bacteria 1443
99 Ga0068863_100376277 3300005841 Bacteria 1386
100 Ga0068858_100043036 3300005842 Bacteria 4187
101 Ga0068858_100056680 3300005842 Bacteria 3621
102 Ga0068860_100000103 3300005843 Bacteria 139076
103 Ga0068860_100003301 3300005843 Bacteria 16599
104 Ga0068860_100277567 3300005843 Unclassified 1637
105 Ga0068862_100099632 3300005844 Bacteria 2540
106 Ga0068862_100153386 3300005844 Unclassified 2051
107 Ga0081455_10009215 3300005937 Bacteria 10171
108 Ga0081538_10000952 3300005981 Bacteria 31074
109 Ga0081540_1000174 3300005983 Bacteria 67477
110 Ga0081539_10003568 3300005985 Bacteria 18888
111 Ga0075366_10000043 3300006195 Bacteria 45049
112 Ga0075366_10024194 3300006195 Bacteria 3543
113 Ga0075366_10057402 3300006195 Unclassified 2314
114 Ga0097621_100037634 3300006237 Bacteria 3879
115 Ga0097621_100155837 3300006237 Unclassified 1960
116 Ga0075370_10102569 3300006353 Bacteria 1657
117 Ga0075433_10184174 3300006852 Unclassified 1858
118 Ga0068865_100470268 3300006881 Bacteria 1043
119 Ga0097620_100032444 3300006931 Bacteria 5246
120 Ga0097620_100249210 3300006931 Bacteria 1866
121 Ga0097620_100897601 3300006931 Bacteria 971
122 Ga0105251_10033532 3300009011 Bacteria 2548
123 Ga0105244_10054188 3300009036 Bacteria 2036
124 Ga0105240_10000194 3300009093 Bacteria 123394
125 Ga0105240_10000270 3300009093 Bacteria 102445
126 Ga0105240_10003698 3300009093 Bacteria 23636
127 Ga0105240_10003850 3300009093 Bacteria 23179
128 Ga0105240_10018869 3300009093 Bacteria 9234
129 Ga0105240_10246276 3300009093 Bacteria 2070
130 Ga0105240_10339158 3300009093 Bacteria 1708
131 Ga0105240_10596569 3300009093 Bacteria 1216
132 Ga0111539_10019936 3300009094 Bacteria 8260
133 Ga0111539_10347614 3300009094 Unclassified 1726
134 Ga0105247_10020637 3300009101 Bacteria 3961
135 Ga0114129_10042079 3300009147 Bacteria 6433
136 Ga0105241_10121121 3300009174 Bacteria 2107
137 Ga0105241_10126205 3300009174 Bacteria 2066
138 Ga0105241_10289082 3300009174 Bacteria 1403
139 Ga0105242_10023238 3300009176 Bacteria 4887
140 Ga0105242_10071239 3300009176 Bacteria 2884
141 Ga0105242_10476131 3300009176 Bacteria 1182
142 Ga0105248_10349133 3300009177 Bacteria 1666
143 Ga0105237_10000253 3300009545 Bacteria 75836
144 Ga0105237_10001575 3300009545 Bacteria 29702
145 Ga0105237_10003114 3300009545 Bacteria 19970
146 Ga0105237_10003672 3300009545 Bacteria 18079
147 Ga0105237_10006229 3300009545 Bacteria 13289
148 Ga0105237_10058298 3300009545 Bacteria 3865
149 Ga0105237_10062350 3300009545 Bacteria 3728
150 Ga0105237_10073429 3300009545 Bacteria 3413
151 Ga0105237_10297082 3300009545 Bacteria 1618
152 Ga0105237_10330610 3300009545 Bacteria 1528
153 Ga0105238_10071328 3300009551 Bacteria 3471
154 Ga0105238_10172884 3300009551 Bacteria 2137
155 Ga0105238_10559999 3300009551 Bacteria 1148
156 Ga0105238_10581704 3300009551 Bacteria 1126
157 Ga0105239_10000009 3300010375 Bacteria 361182
158 Ga0105239_10000011 3300010375 Bacteria 337500
159 Ga0105239_10000101 3300010375 Bacteria 119610
160 Ga0105239_10000429 3300010375 Bacteria 61309
161 Ga0105239_10001186 3300010375 Bacteria 35727
162 Ga0105239_10003047 3300010375 Bacteria 20835
163 Ga0105239_10005256 3300010375 Bacteria 15230
164 Ga0105239_10528809 3300010375 Bacteria 1342
165 Ga0105246_10379795 3300011119 Bacteria 1167
166 Ga0157373_10000090 3300013100 Bacteria 78142
167 Ga0157373_10000157 3300013100 Bacteria 54891
168 Ga0157373_10005766 3300013100 Bacteria 9271
169 Ga0157373_10050719 3300013100 Bacteria 2955
170 Ga0157373_10188952 3300013100 Bacteria 1451
171 Ga0157371_10000232 3300013102 Bacteria 79717
172 Ga0157371_10000367 3300013102 Bacteria 56890
173 Ga0157371_10001304 3300013102 Bacteria 26218
174 Ga0157371_10001664 3300013102 Bacteria 22687
175 Ga0157371_10003368 3300013102 Bacteria 14536
176 Ga0157371_10122952 3300013102 Bacteria 1846
177 Ga0157370_10001458 3300013104 Bacteria 29239
178 Ga0157370_10002955 3300013104 Bacteria 20235
179 Ga0157370_10015673 3300013104 Bacteria 7698
180 Ga0157370_10016887 3300013104 Bacteria 7379
181 Ga0157370_10017405 3300013104 Bacteria 7254
182 Ga0157370_10044812 3300013104 Bacteria 4248
183 Ga0157370_10247891 3300013104 Bacteria 1648
184 Ga0157370_10270248 3300013104 Bacteria 1571
185 Ga0157369_10000158 3300013105 Bacteria 96395
186 Ga0157369_10000402 3300013105 Bacteria 57623
187 Ga0157369_10025326 3300013105 Bacteria 6587
188 Ga0157369_10075155 3300013105 Bacteria 3623
189 Ga0157369_10202856 3300013105 Bacteria 2081
190 Ga0157369_10276309 3300013105 Bacteria 1750
191 Ga0157374_10009196 3300013296 Bacteria 8472
192 Ga0157374_10191023 3300013296 Unclassified 2003
193 Ga0157378_10003133 3300013297 Bacteria 14695
194 Ga0157378_10029953 3300013297 Bacteria 4806
195 Ga0163162_10000011 3300013306 Bacteria 299877
196 Ga0163162_10000269 3300013306 Bacteria 47344
197 Ga0163162_10005627 3300013306 Bacteria 12110
198 Ga0163162_10073815 3300013306 Bacteria 3468
199 Ga0163162_10112118 3300013306 Bacteria 2826
200 Ga0163162_10309242 3300013306 Bacteria 1713
201 Ga0163162_10473136 3300013306 Bacteria 1384
202 Ga0157372_10000026 3300013307 Bacteria 195407
203 Ga0157372_10001364 3300013307 Bacteria 26417
204 Ga0157372_10008792 3300013307 Bacteria 10725
205 Ga0157372_10020280 3300013307 Bacteria 7169
206 Ga0157372_10043622 3300013307 Bacteria 4966
207 Ga0157372_10194085 3300013307 Bacteria 2352
208 Ga0157372_10336740 3300013307 Bacteria 1758
209 Ga0157372_10648223 3300013307 Bacteria 1230
210 Ga0157372_10897056 3300013307 Bacteria 1029
211 Ga0157372_10929874 3300013307 Bacteria 1008
212 Ga0157375_10046086 3300013308 Bacteria 4248
213 Ga0163163_10124157 3300014325 Bacteria 2618
214 Ga0163163_10138726 3300014325 Bacteria 2473
215 Ga0163163_10348213 3300014325 Unclassified 1537
216 Ga0157380_10009608 3300014326 Bacteria 6937
217 Ga0157380_10449918 3300014326 Unclassified 1237
218 Ga0182008_10000004 3300014497 Bacteria 436804
219 Ga0182008_10000046 3300014497 Bacteria 111777
220 Ga0182008_10000213 3300014497 Bacteria 45587
221 Ga0157377_10209019 3300014745 Bacteria 1243
222 Ga0157379_10023316 3300014968 Bacteria 5492
223 Ga0157379_10269761 3300014968 Bacteria 1547
224 Ga0157376_10066971 3300014969 Bacteria 3036
225 Ga0182006_1000139 3300015261 Bacteria 77918
226 Ga0182006_1000289 3300015261 Bacteria 44305
227 Ga0182006_1002093 3300015261 Bacteria 11148
228 Ga0182007_10000008 3300015262 Bacteria 332953
229 Ga0183373_1002 3300015682 Bacteria 990153
230 Ga0163161_10000355 3300017792 Bacteria 38658
231 Ga0163161_10000626 3300017792 Bacteria 28192
232 Ga0163161_10003961 3300017792 Bacteria 10388
233 Ga0163161_10014932 3300017792 Bacteria 5410
234 Ga0163161_10023875 3300017792 Bacteria 4315
235 Ga0163161_10026190 3300017792 Bacteria 4131
236 Ga0163161_10063909 3300017792 Bacteria 2684
237 Ga0163161_10093226 3300017792 Bacteria 2231
238 Ga0163161_10095275 3300017792 Bacteria 2208
239 Ga0207427_101087 3300025231 Bacteria 11112
240 Ga0209437_100043 3300025233 Bacteria 440454
241 Ga0209437_100048 3300025233 Bacteria 405107
242 Ga0207425_1000003 3300025245 Bacteria 1145342
243 Ga0209129_1000022 3300025258 Bacteria 440876
244 Ga0209129_1018976 3300025258 Bacteria 1309
245 Ga0209233_1000029 3300025261 Bacteria 641642
246 Ga0209455_1001549 3300025272 Bacteria 10198
247 Ga0209676_1000022 3300025292 Bacteria 605659
248 Ga0209025_1000007 3300025294 Bacteria 1145109
249 Ga0209758_1000012 3300025297 Bacteria 949866
250 Ga0209050_1000020 3300025298 Bacteria 605671
251 Ga0207655_1078836 3300025728 Bacteria 1195
252 Ga0207682_10035762 3300025893 Unclassified 2007
253 Ga0207710_10063437 3300025900 Bacteria 1681
254 Ga0207688_10249844 3300025901 Bacteria 1074
255 Ga0207647_10000171 3300025904 Bacteria 51875
256 Ga0207647_10005860 3300025904 Bacteria 8956
257 Ga0207647_10153640 3300025904 Bacteria 1344
258 Ga0207645_10007782 3300025907 Bacteria 7540
259 Ga0207645_10033742 3300025907 Bacteria 3289
260 Ga0207643_10008742 3300025908 Bacteria 5434
261 Ga0207643_10035503 3300025908 Bacteria 2796
262 Ga0207705_10089627 3300025909 Bacteria 2251
263 Ga0207654_10087443 3300025911 Bacteria 1891
264 Ga0207654_10206761 3300025911 Unclassified 1295
265 Ga0207654_10260791 3300025911 Bacteria 1165
266 Ga0207707_10345474 3300025912 Bacteria 1282
267 Ga0207695_10000016 3300025913 Bacteria 771991
268 Ga0207695_10000280 3300025913 Bacteria 126470
269 Ga0207695_10004275 3300025913 Bacteria 19602
270 Ga0207695_10030352 3300025913 Bacteria 5951
271 Ga0207695_10074958 3300025913 Bacteria 3444
272 Ga0207695_10131608 3300025913 Unclassified 2459
273 Ga0207695_10213671 3300025913 Bacteria 1838
274 Ga0207695_10228937 3300025913 Bacteria 1764
275 Ga0207695_10360465 3300025913 Bacteria 1340
276 Ga0207671_10000835 3300025914 Bacteria 39117
277 Ga0207671_10001310 3300025914 Bacteria 29175
278 Ga0207671_10002992 3300025914 Bacteria 17322
279 Ga0207671_10003671 3300025914 Bacteria 15133
280 Ga0207671_10006550 3300025914 Bacteria 10348
281 Ga0207671_10012139 3300025914 Bacteria 6952
282 Ga0207671_10014667 3300025914 Bacteria 6181
283 Ga0207671_10016310 3300025914 Bacteria 5779
284 Ga0207671_10016378 3300025914 Bacteria 5762
285 Ga0207671_10075141 3300025914 Unclassified 2526
286 Ga0207671_10205321 3300025914 Bacteria 1540
287 Ga0207663_10000240 3300025916 Bacteria 24147
288 Ga0207657_10326774 3300025919 Bacteria 1212
289 Ga0207652_10015385 3300025921 Bacteria 6213
290 Ga0207652_10119555 3300025921 Bacteria 2343
291 Ga0207681_10081777 3300025923 Bacteria 2281
292 Ga0207694_10112376 3300025924 Bacteria 2168
293 Ga0207694_10113400 3300025924 Bacteria 2158
294 Ga0207694_10167883 3300025924 Bacteria 1775
295 Ga0207694_10314218 3300025924 Bacteria 1292
296 Ga0207650_10174217 3300025925 Bacteria 1711
297 Ga0207659_10106534 3300025926 Unclassified 2123
298 Ga0207690_10000228 3300025932 Bacteria 41941
299 Ga0207690_10014551 3300025932 Bacteria 4752
300 Ga0207706_10018624 3300025933 Bacteria 6247
301 Ga0207706_10096076 3300025933 Bacteria 2606
302 Ga0207706_10167442 3300025933 Bacteria 1931
303 Ga0207686_10193313 3300025934 Unclassified 1452
304 Ga0207670_10025115 3300025936 Unclassified 3735
305 Ga0207669_10083426 3300025937 Bacteria 2055
306 Ga0207704_10041095 3300025938 Bacteria 2708
307 Ga0207691_10030848 3300025940 Bacteria 5007
308 Ga0207691_10030924 3300025940 Bacteria 4999
309 Ga0207689_10003569 3300025942 Bacteria 14211
310 Ga0207689_10009194 3300025942 Bacteria 8547
311 Ga0207689_10016522 3300025942 Bacteria 6247
312 Ga0207661_10048688 3300025944 Bacteria 3370
313 Ga0207661_10103464 3300025944 Bacteria 2396
314 Ga0207661_10160101 3300025944 Bacteria 1953
315 Ga0207679_10152213 3300025945 Bacteria 1884
316 Ga0207679_10347898 3300025945 Bacteria 1291
317 Ga0207667_10000049 3300025949 Bacteria 235027
318 Ga0207667_10003048 3300025949 Bacteria 20784
319 Ga0207667_10008666 3300025949 Bacteria 12057
320 Ga0207667_10008873 3300025949 Bacteria 11902
321 Ga0207667_10011842 3300025949 Bacteria 10102
322 Ga0207667_10040254 3300025949 Bacteria 4977
323 Ga0207667_10145376 3300025949 Bacteria 2441
324 Ga0207651_10071678 3300025960 Bacteria 2457
325 Ga0207651_10405256 3300025960 Bacteria 1161
326 Ga0207668_10053665 3300025972 Bacteria 2794
327 Ga0207640_10080553 3300025981 Bacteria 2223
328 Ga0207640_10083953 3300025981 Bacteria 2185
329 Ga0207677_10020352 3300026023 Bacteria 4027
330 Ga0207677_10088909 3300026023 Bacteria 2241
331 Ga0207677_10166848 3300026023 Bacteria 1717
332 Ga0207703_10015759 3300026035 Bacteria 5895
333 Ga0207639_10094519 3300026041 Bacteria 2400
334 Ga0207639_10200514 3300026041 Bacteria 1711
335 Ga0207678_10055959 3300026067 Bacteria 3397
336 Ga0207702_10037268 3300026078 Bacteria 4069
337 Ga0207702_10049457 3300026078 Bacteria 3548
338 Ga0207702_10072369 3300026078 Bacteria 2971
339 Ga0207641_10136942 3300026088 Bacteria 2205
340 Ga0207648_10013029 3300026089 Bacteria 7755
341 Ga0207676_10134454 3300026095 Bacteria 2108
342 Ga0207676_10145812 3300026095 Bacteria 2033
343 Ga0207676_10156451 3300026095 Bacteria 1970
344 Ga0207676_10224051 3300026095 Bacteria 1677
345 Ga0207674_10094757 3300026116 Bacteria 2972
346 Ga0207674_10110788 3300026116 Bacteria 2720
347 Ga0207674_10112959 3300026116 Bacteria 2690
348 Ga0207674_10120714 3300026116 Bacteria 2589
349 Ga0207674_10332294 3300026116 Bacteria 1470
350 Ga0207675_100561989 3300026118 Bacteria 1141
351 Ga0207683_10003429 3300026121 Bacteria 13817
352 Ga0207683_10175326 3300026121 Bacteria 1943
353 Ga0207698_10073200 3300026142 Bacteria 2727
354 Ga0207698_10115394 3300026142 Bacteria 2261
355 Ga0207698_10539688 3300026142 Bacteria 1141
356 Ga0207428_10150926 3300027907 Bacteria 1769
357 Ga0268266_10000105 3300028379 Bacteria 176691
358 Ga0268265_10104835 3300028380 Unclassified 2293
359 Ga0268264_10000013 3300028381 Bacteria 513859
360 Ga0268264_10002373 3300028381 Bacteria 16610
361 Ga0268264_10041539 3300028381 Bacteria 3805
362 Ga0307515_10013138 3300028794 Bacteria 15497
363 Ga0307511_10001654 3300030521 Bacteria 23511
364 Ga0316181_1275821 3300030744 Bacteria 872
365 Ga0265327_10000115 3300031251 Bacteria 173854
366 Ga0265327_10100010 3300031251 Bacteria 1401
367 Ga0307408_100188277 3300031548 Bacteria 1660
368 Ga0316576_10222056 3300031727 Bacteria 1421
369 Ga0307405_10000045 3300031731 Bacteria 71537
370 Ga0307413_10016321 3300031824 Bacteria 3833
371 Ga0307407_10000002 3300031903 Bacteria 323084
372 Ga0307412_10000219 3300031911 Bacteria 38370
373 Ga0307412_10003683 3300031911 Bacteria 8510
374 Ga0307412_10174511 3300031911 Bacteria 1610
375 Ga0307409_100067027 3300031995 Bacteria 2833
376 Ga0307409_100117369 3300031995 Bacteria 2245
377 Ga0307416_100000005 3300032002 Bacteria 477728
378 Ga0307414_10000731 3300032004 Bacteria 16808
379 Ga0307414_10001484 3300032004 Bacteria 12203
380 Ga0307414_10043966 3300032004 Bacteria 3046
381 Ga0307507_10000071 3300033179 Bacteria 158391
382 Ga0307507_10167977 3300033179 Bacteria 1602
383 Ga0316574_0002740 3300035398 Bacteria 8934
384 Ga0395899_0000001 3300037312 Bacteria 1750322
385 Ga0395899_0000055 3300037312 Bacteria 220579
386 Ga0395899_0053792 3300037312 Bacteria 2980
387 Ga0395899_0258551 3300037312 Bacteria 1192
388 Ga0395900_0382485 3300037418 Bacteria 1375
389 Ga0395900_0475421 3300037418 Bacteria 1203
390 Ga0395898_0223730 3300037466 Bacteria 1795
391 Ga0395898_0438008 3300037466 Bacteria 1245
392 Ga0395905_0000355 3300037471 Bacteria 65176
393 Ga0395905_0293693 3300037471 Bacteria 1512
394 Ga0395905_0331658 3300037471 Bacteria 1412
395 Ga0395901_0003761 3300038443 Bacteria 15293
396 Ga0395901_0044471 3300038443 Bacteria 4606
397 Ga0436362_1116171 3300039453 Bacteria 2134
398 Ga0451853_1365108 3300041512 Bacteria 1367
399 Ga0439431_0006937 3300041997 Bacteria 2519
400 Ga0466969_0006579 3300044656 Bacteria 6178
401 Ga0466972_0000001 3300044658 Bacteria 412457
402 Ga0466972_0000183 3300044658 Bacteria 48447
403 Ga0466972_0015976 3300044658 Bacteria 3753
404 Ga0466966_0000053 3300044684 Bacteria 84809
405 Ga0453684_0070903 3300044712 Bacteria 4409
406 Ga0466970_0000266 3300044765 Bacteria 25589
407 Ga0466957_0002049 3300044842 Bacteria 10768
408 Ga0466957_0002372 3300044842 Bacteria 10111
409 Ga0466959_0000005 3300045049 Bacteria 213958
410 Ga0466959_0253854 3300045049 Bacteria 1212
411 Ga0451576_0187929 3300045051 Bacteria 2157
412 Ga0451576_0415694 3300045051 Unclassified 1411
413 Ga0466967_0233965 3300045976 Bacteria 1750
414 Ga0495627_021327 3300046453 Bacteria 2149
415 Ga0495638_0016688 3300046460 Bacteria 4912
416 Ga0495638_0075501 3300046460 Bacteria 2054
417 Ga0495638_0225030 3300046460 Unclassified 1047
418 Ga0495651_0077973 3300046462 Bacteria 2507
419 Ga0495650_0000127 3300046471 Bacteria 177276
420 Ga0495585_0000062 3300046492 Bacteria 109539
421 Ga0495585_0000770 3300046492 Bacteria 28347
422 Ga0495607_0119322 3300046501 Bacteria 1387
423 Ga0495583_0016037 3300046506 Bacteria 4045
424 Ga0495606_0002873 3300046507 Bacteria 19039
425 Ga0495606_0032760 3300046507 Bacteria 3595
426 Ga0495606_0141466 3300046507 Bacteria 1420
427 Ga0495610_0000084 3300046512 Bacteria 112459
428 Ga0495610_0001362 3300046512 Bacteria 21702
429 Ga0495610_0003898 3300046512 Bacteria 11324
430 Ga0495610_0040023 3300046512 Bacteria 2366
431 Ga0495616_0001940 3300046513 Bacteria 13911
432 Ga0495616_0036337 3300046513 Bacteria 2542
433 Ga0495637_0003742 3300046520 Bacteria 8034
434 Ga0495648_0015092 3300046524 Bacteria 5624
435 Ga0495648_0018307 3300046524 Bacteria 4966
436 Ga0495648_0042682 3300046524 Bacteria 2851
437 Ga0495586_0020745 3300046535 Bacteria 3499
438 Ga0495609_0002974 3300046538 Bacteria 10009
439 Ga0495609_0018067 3300046538 Bacteria 3272
440 Ga0495609_0033452 3300046538 Bacteria 2334
441 Ga0495633_0000021 3300046558 Bacteria 227171
442 Ga0495633_0040444 3300046558 Bacteria 2221
443 Ga0495633_0071209 3300046558 Bacteria 1622
444 Ga0495668_0000075 3300046616 Bacteria 163092
445 Ga0495668_0001280 3300046616 Bacteria 24932
446 Ga0495625_0000048 3300046660 Bacteria 198976
447 Ga0495625_0000439 3300046660 Bacteria 62433
448 Ga0495625_0000905 3300046660 Bacteria 39943
449 Ga0495625_0321073 3300046660 Unclassified 986
450 Ga0495661_0000714 3300046665 Bacteria 32835
451 Ga0495661_0164464 3300046665 Bacteria 1188
452 Ga0495670_0064651 3300046691 Bacteria 1843
453 Ga0495649_0000146 3300046694 Bacteria 61862
454 Ga0495589_0100976 3300046794 Bacteria 1396
455 Ga0495660_0051778 3300046810 Bacteria 2233
456 Ga0495672_0012751 3300047320 Bacteria 5843
457 Ga0495681_0157696 3300047470 Bacteria 947
458 Ga0495684_0007608 3300047471 Bacteria 8383
459 Ga0495686_0007545 3300047472 Bacteria 8139
460 Ga0495686_0026850 3300047472 Bacteria 3766
461 Ga0495686_0099830 3300047472 Unclassified 1752
462 Ga0495686_0218586 3300047472 Unclassified 1085
463 Ga0496110_0592859 3300048913 Bacteria 1006
464 Ga0496111_0202671 3300048914 Bacteria 1475
465 Ga0496112_0273033 3300048915 Bacteria 1639
466 Ga0496114_0540694 3300048917 Bacteria 1030
467 Ga0496122_0001661 3300048925 Bacteria 34502
468 Ga0496123_0021283 3300048926 Bacteria 5045
469 Ga0495678_029468 3300049459 Bacteria 2304
470 Ga0501033_0031723 3300049570 Bacteria 3968
471 Ga0501033_0514862 3300049570 Bacteria 827
472 Ga0501034_0129526 3300049571 Unclassified 2507
473 Ga0501034_0196416 3300049571 Bacteria 1977
474 Ga0501047_0084696 3300049581 Bacteria 3047
475 Ga0501047_0456195 3300049581 Bacteria 1107
476 Ga0501070_0073770 3300049586 Bacteria 2824
477 Ga0501071_0141270 3300049587 Bacteria 1793
478 Ga0501073_0022381 3300049589 Bacteria 4552
479 Ga0501238_017803 3300049671 Bacteria 991
480 Ga0501249_031757 3300049679 Bacteria 1179
481 Ga0501219_000186 3300049703 Bacteria 11481
482 Ga0501079_0031481 3300049741 Bacteria 4078
483 Ga0501269_022152 3300049766 Bacteria 795
484 Ga0501035_0041715 3300049822 Bacteria 4143
485 Ga0501035_0459016 3300049822 Bacteria 1053
486 Ga0501044_0099917 3300049823 Unclassified 2920
487 Ga0501044_0168835 3300049823 Bacteria 2160
488 nmdc:mga0k408_13007_c1 3300050493 Bacteria 4556
489 nmdc:mga0k408_32912_c1 3300050493 Bacteria 2962
490 nmdc:mga0k408_52309_c1 3300050493 Bacteria 2367
491 nmdc:mga0k408_56421_c1 3300050493 Unclassified 2279
492 nmdc:mga0k408_635_c1 3300050493 Bacteria 19349
493 nmdc:mga07m45_109729_c1 3300050496 Bacteria 1588
494 nmdc:mga05p37_1882_c2 3300050507 Bacteria 12283
495 nmdc:mga08y16_101084_c1 3300050511 Bacteria 3002
496 nmdc:mga08y16_734911_c1 3300050511 Unclassified 984
497 Ga0500578_0000017 3300053086 Bacteria 178494
498 Ga0500644_0014069 3300053088 Bacteria 2250
499 Ga0500583_0000130 3300053092 Bacteria 34913
500 Ga0500583_0062147 3300053092 Bacteria 1765
501 Ga0500651_0000721 3300053093 Bacteria 16254
502 Ga0500562_009600 3300053108 Bacteria 2445
503 Ga0500608_077133 3300053122 Bacteria 1578
504 Ga0500618_000005 3300053125 Bacteria 253092
505 Ga0500642_0028872 3300053130 Bacteria 2293
506 Ga0500642_0086508 3300053130 Bacteria 1445
507 Ga0500568_0003293 3300053139 Bacteria 9111
508 Ga0500577_0116093 3300053142 Bacteria 1110
509 Ga0500588_0007037 3300053146 Bacteria 2579
510 Ga0500616_0008972 3300053153 Bacteria 6127
511 Ga0500622_0000115 3300053156 Bacteria 83078
512 Ga0500622_0001018 3300053156 Bacteria 23542
513 Ga0500622_0002517 3300053156 Bacteria 13158
514 Ga0500622_0002889 3300053156 Bacteria 12004
515 Ga0500624_000423 3300053157 Bacteria 12913
516 Ga0500627_0068965 3300053158 Bacteria 1564
517 Ga0500637_0026286 3300053178 Bacteria 3207
518 Ga0500611_004195 3300053727 Unclassified 1924
519 Ga0500645_008319 3300053730 Bacteria 3550
520 Ga0501084_0269869 3300054114 Bacteria 1436
521 Ga0530510_0336660 3300061734 Bacteria 1132

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053158 Ga0500627_0068965 Ga0500627_0068965_837_1535 227
2 3300049766 Ga0501269_022152 Ga0501269_022152_39_773 239
3 3300049587 Ga0501071_0141270 Ga0501071_0141270_21_803 250
4 3300049570 Ga0501033_0514862 Ga0501033_0514862_20_790 251
5 3300049679 Ga0501249_031757 Ga0501249_031757_347_1120 251
6 3300013104 Ga0157370_10017405 Ga0157370_100174055 260
7 3300005290 Ga0065712_10004276 Ga0065712_100042764 261
8 3300005331 Ga0070670_100049908 Ga0070670_1000499082 261
9 3300005340 Ga0070689_100007881 Ga0070689_1000078813 261
10 3300005353 Ga0070669_100011362 Ga0070669_1000113621 261
11 3300005354 Ga0070675_100077299 Ga0070675_1000772993 261
12 3300005364 Ga0070673_100036768 Ga0070673_1000367685 261
13 3300005365 Ga0070688_100039310 Ga0070688_1000393101 261
14 3300005578 Ga0068854_100115194 Ga0068854_1001151942 261
15 3300005617 Ga0068859_100249205 Ga0068859_1002492051 261
16 3300005844 Ga0068862_100099632 Ga0068862_1000996322 261
17 3300006931 Ga0097620_100249210 Ga0097620_1002492101 261
18 3300009094 Ga0111539_10019936 Ga0111539_100199369 261
19 3300011119 Ga0105246_10379795 Ga0105246_103797951 261
20 3300013306 Ga0163162_10112118 Ga0163162_101121181 261
21 3300014326 Ga0157380_10009608 Ga0157380_100096082 261
22 3300017792 Ga0163161_10095275 Ga0163161_100952752 261
23 3300025923 Ga0207681_10081777 Ga0207681_100817771 261
24 3300025933 Ga0207706_10167442 Ga0207706_101674422 261
25 3300025936 Ga0207670_10025115 Ga0207670_100251153 261
26 3300025940 Ga0207691_10030924 Ga0207691_100309246 261
27 3300025960 Ga0207651_10071678 Ga0207651_100716783 261
28 3300025981 Ga0207640_10080553 Ga0207640_100805532 261
29 3300027907 Ga0207428_10150926 Ga0207428_101509262 261
30 3300050511 nmdc:mga08y16_101084_c1 nmdc:mga08y16_101084_c1_549_1451 261
31 3300005337 Ga0070682_100057061 Ga0070682_1000570614 262
32 3300005535 Ga0070684_100091718 Ga0070684_1000917183 262
33 3300005535 Ga0070684_100147076 Ga0070684_1001470762 262
34 3300025944 Ga0207661_10103464 Ga0207661_101034642 262
35 3300025944 Ga0207661_10160101 Ga0207661_101601012 262
36 3300026023 Ga0207677_10088909 Ga0207677_100889092 262
37 3300026095 Ga0207676_10134454 Ga0207676_101344542 262
38 3300048914 Ga0496111_0202671 Ga0496111_0202671_20_841 262
39 3300048917 Ga0496114_0540694 Ga0496114_0540694_66_887 262
40 3300045976 Ga0466967_0233965 Ga0466967_0233965_573_1400 264
41 iso_pu_bacteria 2738541283 2738754007 265
42 iso_pu_bacteria 2738541284 2738762567 265
43 iso_pu_bacteria 2738543023 2739304226 265
44 iso_pu_bacteria 2775506987 2776614012 265
45 iso_pu_bacteria 2852627209 2852630621 265
46 iso_pu_bacteria 2919186247 2919190574 265
47 iso_pu_bacteria 2939664404 2939669216 265
48 3300005937 Ga0081455_10009215 Ga0081455_100092159 266
49 3300005983 Ga0081540_1000174 Ga0081540_100017444 266
50 3300037312 Ga0395899_0258551 Ga0395899_0258551_335_1177 266
51 3300037418 Ga0395900_0382485 Ga0395900_0382485_500_1342 266
52 3300037418 Ga0395900_0475421 Ga0395900_0475421_256_1098 266
53 3300037471 Ga0395905_0293693 Ga0395905_0293693_414_1256 266
54 3300038443 Ga0395901_0044471 Ga0395901_0044471_2860_3696 266
55 3300041512 Ga0451853_1365108 Ga0451853_1365108_48_890 266
56 3300031824 Ga0307413_10016321 Ga0307413_100163211 267
57 3300031995 Ga0307409_100067027 Ga0307409_1000670272 267
58 iso_pu_bacteria 2896109856 2896113166 268
59 2162886007 SwRhRL2b_contig_2990130 SwRhRL2b_0843.00000410 269
60 3300003323 rootH1_10360764 rootH1_103607642 269
61 3300005288 Ga0065714_10002303 Ga0065714_1000230326 269
62 3300005288 Ga0065714_10002338 Ga0065714_1000233812 269
63 3300005289 Ga0065704_10000214 Ga0065704_1000021426 269
64 3300005289 Ga0065704_10074124 Ga0065704_100741243 269
65 3300006852 Ga0075433_10184174 Ga0075433_101841741 269
66 3300009094 Ga0111539_10347614 Ga0111539_103476142 269
67 3300009545 Ga0105237_10330610 Ga0105237_103306102 269
68 3300013100 Ga0157373_10000157 Ga0157373_1000015724 269
69 3300013102 Ga0157371_10001304 Ga0157371_100013048 269
70 3300013102 Ga0157371_10003368 Ga0157371_100033681 269
71 3300013104 Ga0157370_10001458 Ga0157370_100014586 269
72 3300013104 Ga0157370_10270248 Ga0157370_102702481 269
73 3300013306 Ga0163162_10309242 Ga0163162_103092422 269
74 3300014497 Ga0182008_10000004 Ga0182008_10000004154 269
75 3300014497 Ga0182008_10000213 Ga0182008_100002139 269
76 3300015261 Ga0182006_1002093 Ga0182006_10020937 269
77 3300017792 Ga0163161_10003961 Ga0163161_100039616 269
78 3300025914 Ga0207671_10205321 Ga0207671_102053212 269
79 3300030744 Ga0316181_1275821 Ga0316181_12758211 269
80 3300031911 Ga0307412_10000219 Ga0307412_100002198 269
81 3300032004 Ga0307414_10000731 Ga0307414_1000073110 269
82 3300032004 Ga0307414_10001484 Ga0307414_1000148413 269
83 3300039453 Ga0436362_1116171 Ga0436362_1116171_975_1835 269
84 3300048915 Ga0496112_0273033 Ga0496112_0273033_285_1121 269
85 3300048925 Ga0496122_0001661 Ga0496122_0001661_33031_33858 269
86 3300048926 Ga0496123_0021283 Ga0496123_0021283_4199_5026 269
87 3300049589 Ga0501073_0022381 Ga0501073_0022381_1736_2572 269
88 3300050511 nmdc:mga08y16_734911_c1 nmdc:mga08y16_734911_c1_139_957 269
89 3300053093 Ga0500651_0000721 Ga0500651_0000721_10378_11205 269
90 iso_pu_bacteria 2585427687 2586207167 269
91 iso_pu_bacteria 2738541302 2738852750 269
92 iso_pu_bacteria 2739367651 2739586675 269
93 iso_pu_bacteria 2739367656 2739615012 269
94 iso_pu_bacteria 2739367663 2739645865 269
95 iso_pu_bacteria 2818991437 2819547112 269
96 iso_pu_bacteria 2842722452 2842727139 269
97 iso_pu_bacteria 2842909656 2842910858 269
98 iso_pu_bacteria 2849281842 2849284070 269
99 iso_pu_bacteria 2857627736 2857628053 269
100 iso_pu_bacteria 2904445276 2904449738 269
101 iso_pu_bacteria 2954016120 2954020499 269
102 3300002773 JGI25152J39213_1000028 JGI25152J39213_100002886 270
103 3300002774 JGI25150J39212_1000006 JGI25150J39212_1000006105 270
104 3300003187 JGI25151J46595_10000024 JGI25151J46595_1000002486 270
105 3300003215 JGI25153J46596_10000026 JGI25153J46596_10000026106 270
106 3300003781 Ga0055536_1000002 Ga0055536_1000002200 270
107 3300003791 Ga0055530_10003780 Ga0055530_100037806 270
108 3300005288 Ga0065714_10064672 Ga0065714_1006467220 270
109 3300005288 Ga0065714_10092517 Ga0065714_100925172 270
110 3300005327 Ga0070658_10040046 Ga0070658_100400464 270
111 3300005366 Ga0070659_100069493 Ga0070659_1000694933 270
112 3300005439 Ga0070711_100000405 Ga0070711_10000040512 270
113 3300005458 Ga0070681_10159230 Ga0070681_101592302 270
114 3300005530 Ga0070679_100124629 Ga0070679_1001246293 270
115 3300005563 Ga0068855_100098597 Ga0068855_1000985972 270
116 3300005577 Ga0068857_100083158 Ga0068857_1000831584 270
117 3300005841 Ga0068863_100347695 Ga0068863_1003476952 270
118 3300006881 Ga0068865_100470268 Ga0068865_1004702681 270
119 3300009036 Ga0105244_10054188 Ga0105244_100541882 270
120 3300009093 Ga0105240_10246276 Ga0105240_102462764 270
121 3300013100 Ga0157373_10050719 Ga0157373_100507192 270
122 3300013102 Ga0157371_10000232 Ga0157371_1000023227 270
123 3300013102 Ga0157371_10000367 Ga0157371_1000036720 270
124 3300013102 Ga0157371_10122952 Ga0157371_101229522 270
125 3300013104 Ga0157370_10002955 Ga0157370_1000295512 270
126 3300013104 Ga0157370_10015673 Ga0157370_100156736 270
127 3300013104 Ga0157370_10044812 Ga0157370_100448123 270
128 3300013104 Ga0157370_10247891 Ga0157370_102478912 270
129 3300013105 Ga0157369_10000158 Ga0157369_100001585 270
130 3300013105 Ga0157369_10025326 Ga0157369_100253266 270
131 3300013105 Ga0157369_10202856 Ga0157369_102028562 270
132 3300013306 Ga0163162_10000011 Ga0163162_10000011108 270
133 3300013307 Ga0157372_10020280 Ga0157372_100202805 270
134 3300013307 Ga0157372_10194085 Ga0157372_101940852 270
135 3300013307 Ga0157372_10648223 Ga0157372_106482231 270
136 3300014497 Ga0182008_10000046 Ga0182008_1000004615 270
137 3300015261 Ga0182006_1000139 Ga0182006_100013919 270
138 3300015261 Ga0182006_1000289 Ga0182006_100028914 270
139 3300015262 Ga0182007_10000008 Ga0182007_1000000885 270
140 3300015682 Ga0183373_1002 Ga0183373_1002354 270
141 3300017792 Ga0163161_10000355 Ga0163161_1000035525 270
142 3300017792 Ga0163161_10000626 Ga0163161_100006265 270
143 3300017792 Ga0163161_10014932 Ga0163161_100149325 270
144 3300017792 Ga0163161_10023875 Ga0163161_100238753 270
145 3300017792 Ga0163161_10026190 Ga0163161_100261902 270
146 3300025245 Ga0207425_1000003 Ga0207425_1000003104 270
147 3300025258 Ga0209129_1000022 Ga0209129_1000022103 270
148 3300025292 Ga0209676_1000022 Ga0209676_1000022340 270
149 3300025294 Ga0209025_1000007 Ga0209025_1000007103 270
150 3300025297 Ga0209758_1000012 Ga0209758_1000012104 270
151 3300025298 Ga0209050_1000020 Ga0209050_1000020199 270
152 3300025728 Ga0207655_1078836 Ga0207655_10788362 270
153 3300025909 Ga0207705_10089627 Ga0207705_100896272 270
154 3300025912 Ga0207707_10345474 Ga0207707_103454742 270
155 3300025916 Ga0207663_10000240 Ga0207663_1000024015 270
156 3300025921 Ga0207652_10015385 Ga0207652_100153855 270
157 3300025921 Ga0207652_10119555 Ga0207652_101195553 270
158 3300025932 Ga0207690_10014551 Ga0207690_100145514 270
159 3300025949 Ga0207667_10008873 Ga0207667_100088737 270
160 3300025949 Ga0207667_10145376 Ga0207667_101453762 270
161 3300026041 Ga0207639_10094519 Ga0207639_100945192 270
162 3300026088 Ga0207641_10136942 Ga0207641_101369422 270
163 3300026116 Ga0207674_10112959 Ga0207674_101129592 270
164 3300031548 Ga0307408_100188277 Ga0307408_1001882772 270
165 3300031731 Ga0307405_10000045 Ga0307405_100000454 270
166 3300031903 Ga0307407_10000002 Ga0307407_10000002165 270
167 3300031911 Ga0307412_10003683 Ga0307412_100036831 270
168 3300031911 Ga0307412_10174511 Ga0307412_101745111 270
169 3300031995 Ga0307409_100117369 Ga0307409_1001173692 270
170 3300032002 Ga0307416_100000005 Ga0307416_100000005167 270
171 3300032004 Ga0307414_10043966 Ga0307414_100439663 270
172 3300037312 Ga0395899_0000001 Ga0395899_0000001_1554531_1555361 270
173 3300044712 Ga0453684_0070903 Ga0453684_0070903_2850_3677 270
174 3300045051 Ga0451576_0187929 Ga0451576_0187929_1100_1927 270
175 3300046453 Ga0495627_021327 Ga0495627_021327_572_1411 270
176 3300046512 Ga0495610_0000084 Ga0495610_0000084_91536_92375 270
177 3300046512 Ga0495610_0001362 Ga0495610_0001362_20459_21298 270
178 3300046520 Ga0495637_0003742 Ga0495637_0003742_4334_5173 270
179 3300046558 Ga0495633_0071209 Ga0495633_0071209_399_1238 270
180 3300047470 Ga0495681_0157696 Ga0495681_0157696_89_928 270
181 3300049570 Ga0501033_0031723 Ga0501033_0031723_901_1746 270
182 3300049571 Ga0501034_0129526 Ga0501034_0129526_714_1559 270
183 3300049586 Ga0501070_0073770 Ga0501070_0073770_1661_2506 270
184 3300049741 Ga0501079_0031481 Ga0501079_0031481_116_1024 270
185 3300049822 Ga0501035_0041715 Ga0501035_0041715_3079_3924 270
186 3300049822 Ga0501035_0459016 Ga0501035_0459016_138_983 270
187 3300049823 Ga0501044_0099917 Ga0501044_0099917_1784_2629 270
188 3300053088 Ga0500644_0014069 Ga0500644_0014069_965_1801 270
189 3300053108 Ga0500562_009600 Ga0500562_009600_1407_2243 270
190 3300053130 Ga0500642_0028872 Ga0500642_0028872_1347_2168 270
191 3300053153 Ga0500616_0008972 Ga0500616_0008972_2999_3835 270
192 3300053156 Ga0500622_0000115 Ga0500622_0000115_60431_61267 270
193 3300053156 Ga0500622_0001018 Ga0500622_0001018_1034_1870 270
194 3300053156 Ga0500622_0002889 Ga0500622_0002889_1418_2254 270
195 3300054114 Ga0501084_0269869 Ga0501084_0269869_478_1386 270
196 3300061734 Ga0530510_0336660 Ga0530510_0336660_70_978 270
197 3300001990 JGI24737J22298_10014460 JGI24737J22298_100144602 271
198 3300002067 JGI24735J21928_10000010 JGI24735J21928_1000001042 271
199 3300002737 JGI25162J39368_1000005 JGI25162J39368_1000005357 271
200 3300003316 rootH1_10093589 rootH1_100935894 271
201 3300003322 rootL2_10051934 rootL2_100519341 271
202 3300003323 rootH1_10265515 rootH1_102655152 271
203 3300005288 Ga0065714_10070076 Ga0065714_100700767 271
204 3300005456 Ga0070678_100376836 Ga0070678_1003768362 271
205 3300005578 Ga0068854_100248311 Ga0068854_1002483111 271
206 3300005614 Ga0068856_100009673 Ga0068856_1000096731 271
207 3300005981 Ga0081538_10000952 Ga0081538_1000095233 271
208 3300009011 Ga0105251_10033532 Ga0105251_100335322 271
209 3300009101 Ga0105247_10020637 Ga0105247_100206372 271
210 3300009545 Ga0105237_10001575 Ga0105237_1000157532 271
211 3300009545 Ga0105237_10058298 Ga0105237_100582982 271
212 3300009545 Ga0105237_10062350 Ga0105237_100623502 271
213 3300009551 Ga0105238_10581704 Ga0105238_105817042 271
214 3300010375 Ga0105239_10005256 Ga0105239_100052568 271
215 3300013105 Ga0157369_10276309 Ga0157369_102763092 271
216 3300013297 Ga0157378_10003133 Ga0157378_100031336 271
217 3300013306 Ga0163162_10005627 Ga0163162_100056271 271
218 3300017792 Ga0163161_10093226 Ga0163161_100932262 271
219 3300025233 Ga0209437_100043 Ga0209437_10004349 271
220 3300025258 Ga0209129_1018976 Ga0209129_10189761 271
221 3300025900 Ga0207710_10063437 Ga0207710_100634372 271
222 3300025904 Ga0207647_10153640 Ga0207647_101536402 271
223 3300025913 Ga0207695_10213671 Ga0207695_102136711 271
224 3300025914 Ga0207671_10000835 Ga0207671_100008356 271
225 3300025914 Ga0207671_10014667 Ga0207671_100146672 271
226 3300025914 Ga0207671_10016378 Ga0207671_100163785 271
227 3300025949 Ga0207667_10040254 Ga0207667_100402546 271
228 3300026078 Ga0207702_10037268 Ga0207702_100372684 271
229 3300026116 Ga0207674_10110788 Ga0207674_101107884 271
230 3300030521 Ga0307511_10001654 Ga0307511_100016548 271
231 3300031251 Ga0265327_10100010 Ga0265327_101000102 271
232 3300031727 Ga0316576_10222056 Ga0316576_102220562 271
233 3300035398 Ga0316574_0002740 Ga0316574_0002740_2549_3418 271
234 3300037312 Ga0395899_0053792 Ga0395899_0053792_1081_1902 271
235 3300037466 Ga0395898_0223730 Ga0395898_0223730_702_1523 271
236 3300037471 Ga0395905_0000355 Ga0395905_0000355_58313_59134 271
237 3300038443 Ga0395901_0003761 Ga0395901_0003761_8037_8858 271
238 3300045049 Ga0466959_0253854 Ga0466959_0253854_280_1182 271
239 3300046471 Ga0495650_0000127 Ga0495650_0000127_43447_44271 271
240 3300046492 Ga0495585_0000062 Ga0495585_0000062_9007_9831 271
241 3300046506 Ga0495583_0016037 Ga0495583_0016037_348_1172 271
242 3300046507 Ga0495606_0002873 Ga0495606_0002873_10941_11765 271
243 3300046507 Ga0495606_0032760 Ga0495606_0032760_212_1036 271
244 3300046512 Ga0495610_0003898 Ga0495610_0003898_4539_5363 271
245 3300046512 Ga0495610_0040023 Ga0495610_0040023_166_990 271
246 3300046513 Ga0495616_0001940 Ga0495616_0001940_317_1141 271
247 3300046513 Ga0495616_0036337 Ga0495616_0036337_823_1647 271
248 3300046524 Ga0495648_0042682 Ga0495648_0042682_1412_2236 271
249 3300046535 Ga0495586_0020745 Ga0495586_0020745_431_1327 271
250 3300046538 Ga0495609_0033452 Ga0495609_0033452_371_1195 271
251 3300046558 Ga0495633_0040444 Ga0495633_0040444_509_1333 271
252 3300046660 Ga0495625_0000048 Ga0495625_0000048_142986_143810 271
253 3300046665 Ga0495661_0000714 Ga0495661_0000714_25854_26678 271
254 3300046665 Ga0495661_0164464 Ga0495661_0164464_88_912 271
255 3300046691 Ga0495670_0064651 Ga0495670_0064651_541_1437 271
256 3300046694 Ga0495649_0000146 Ga0495649_0000146_44262_45086 271
257 3300046794 Ga0495589_0100976 Ga0495589_0100976_228_1052 271
258 3300046810 Ga0495660_0051778 Ga0495660_0051778_790_1614 271
259 3300047320 Ga0495672_0012751 Ga0495672_0012751_3489_4394 271
260 3300047471 Ga0495684_0007608 Ga0495684_0007608_4021_4959 271
261 3300047472 Ga0495686_0218586 Ga0495686_0218586_46_876 271
262 3300049459 Ga0495678_029468 Ga0495678_029468_1434_2258 271
263 3300050493 nmdc:mga0k408_13007_c1 nmdc:mga0k408_13007_c1_3415_4239 271
264 3300053130 Ga0500642_0086508 Ga0500642_0086508_143_1027 271
265 3300053157 Ga0500624_000423 Ga0500624_000423_10373_11197 271
266 3300053730 Ga0500645_008319 Ga0500645_008319_294_1178 271
267 iso_pu_bacteria 2811994882 2812373567 271
268 2162886007 SwRhRL2b_contig_2332060 SwRhRL2b_0975.00002480 272
269 3300001990 JGI24737J22298_10002725 JGI24737J22298_100027254 272
270 3300001990 JGI24737J22298_10003609 JGI24737J22298_100036094 272
271 3300002067 JGI24735J21928_10009342 JGI24735J21928_100093424 272
272 3300002772 JGI25164J39214_1000820 JGI25164J39214_10008206 272
273 3300003320 rootH2_10060614 rootH2_100606143 272
274 3300003320 rootH2_10173383 rootH2_101733832 272
275 3300003322 rootL2_10024252 rootL2_100242523 272
276 3300003322 rootL2_10114251 rootL2_101142513 272
277 3300003323 rootH1_10004576 rootH1_1000457640 272
278 3300005289 Ga0065704_10072187 Ga0065704_100721873 272
279 3300005329 Ga0070683_100014426 Ga0070683_1000144262 272
280 3300005329 Ga0070683_100348508 Ga0070683_1003485082 272
281 3300005330 Ga0070690_100325099 Ga0070690_1003250991 272
282 3300005331 Ga0070670_100069190 Ga0070670_1000691903 272
283 3300005333 Ga0070677_10055255 Ga0070677_100552552 272
284 3300005334 Ga0068869_100296872 Ga0068869_1002968721 272
285 3300005335 Ga0070666_10027477 Ga0070666_100274772 272
286 3300005335 Ga0070666_10045832 Ga0070666_100458323 272
287 3300005335 Ga0070666_10105348 Ga0070666_101053482 272
288 3300005338 Ga0068868_100019587 Ga0068868_1000195875 272
289 3300005338 Ga0068868_100073991 Ga0068868_1000739912 272
290 3300005347 Ga0070668_100161342 Ga0070668_1001613421 272
291 3300005354 Ga0070675_100020822 Ga0070675_1000208224 272
292 3300005355 Ga0070671_100102453 Ga0070671_1001024532 272
293 3300005356 Ga0070674_100109667 Ga0070674_1001096672 272
294 3300005365 Ga0070688_100017731 Ga0070688_1000177313 272
295 3300005367 Ga0070667_100077893 Ga0070667_1000778931 272
296 3300005456 Ga0070678_100069854 Ga0070678_1000698542 272
297 3300005535 Ga0070684_100301222 Ga0070684_1003012222 272
298 3300005539 Ga0068853_100655702 Ga0068853_1006557021 272
299 3300005543 Ga0070672_100109941 Ga0070672_1001099412 272
300 3300005548 Ga0070665_100144306 Ga0070665_1001443062 272
301 3300005548 Ga0070665_100172447 Ga0070665_1001724472 272
302 3300005563 Ga0068855_100000014 Ga0068855_1000000149 272
303 3300005563 Ga0068855_100002947 Ga0068855_10000294715 272
304 3300005563 Ga0068855_100004470 Ga0068855_1000044704 272
305 3300005563 Ga0068855_100018554 Ga0068855_1000185543 272
306 3300005563 Ga0068855_100210611 Ga0068855_1002106111 272
307 3300005564 Ga0070664_100160766 Ga0070664_1001607662 272
308 3300005577 Ga0068857_100018131 Ga0068857_1000181316 272
309 3300005577 Ga0068857_100019349 Ga0068857_1000193499 272
310 3300005577 Ga0068857_100116561 Ga0068857_1001165613 272
311 3300005577 Ga0068857_100241274 Ga0068857_1002412742 272
312 3300005578 Ga0068854_100425748 Ga0068854_1004257481 272
313 3300005614 Ga0068856_100013770 Ga0068856_1000137705 272
314 3300005614 Ga0068856_100042520 Ga0068856_1000425202 272
315 3300005614 Ga0068856_100073650 Ga0068856_1000736503 272
316 3300005616 Ga0068852_100001164 Ga0068852_10000116411 272
317 3300005616 Ga0068852_100268373 Ga0068852_1002683732 272
318 3300005616 Ga0068852_100309484 Ga0068852_1003094841 272
319 3300005617 Ga0068859_100032442 Ga0068859_1000324425 272
320 3300005617 Ga0068859_100897501 Ga0068859_1008975012 272
321 3300005840 Ga0068870_10086325 Ga0068870_100863252 272
322 3300005841 Ga0068863_100376277 Ga0068863_1003762772 272
323 3300005842 Ga0068858_100043036 Ga0068858_1000430362 272
324 3300005842 Ga0068858_100056680 Ga0068858_1000566802 272
325 3300005843 Ga0068860_100000103 Ga0068860_10000010312 272
326 3300005843 Ga0068860_100003301 Ga0068860_10000330111 272
327 3300005843 Ga0068860_100277567 Ga0068860_1002775671 272
328 3300005844 Ga0068862_100153386 Ga0068862_1001533862 272
329 3300005985 Ga0081539_10003568 Ga0081539_100035687 272
330 3300006195 Ga0075366_10000043 Ga0075366_1000004310 272
331 3300006195 Ga0075366_10024194 Ga0075366_100241943 272
332 3300006195 Ga0075366_10057402 Ga0075366_100574022 272
333 3300006237 Ga0097621_100037634 Ga0097621_1000376342 272
334 3300006237 Ga0097621_100155837 Ga0097621_1001558372 272
335 3300006353 Ga0075370_10102569 Ga0075370_101025693 272
336 3300006931 Ga0097620_100032444 Ga0097620_1000324445 272
337 3300006931 Ga0097620_100897601 Ga0097620_1008976012 272
338 3300009093 Ga0105240_10000194 Ga0105240_1000019421 272
339 3300009093 Ga0105240_10000270 Ga0105240_1000027024 272
340 3300009093 Ga0105240_10003698 Ga0105240_1000369811 272
341 3300009093 Ga0105240_10003850 Ga0105240_1000385015 272
342 3300009093 Ga0105240_10018869 Ga0105240_100188698 272
343 3300009093 Ga0105240_10339158 Ga0105240_103391581 272
344 3300009093 Ga0105240_10596569 Ga0105240_105965691 272
345 3300009147 Ga0114129_10042079 Ga0114129_100420794 272
346 3300009174 Ga0105241_10121121 Ga0105241_101211212 272
347 3300009174 Ga0105241_10126205 Ga0105241_101262053 272
348 3300009174 Ga0105241_10289082 Ga0105241_102890822 272
349 3300009176 Ga0105242_10023238 Ga0105242_100232383 272
350 3300009176 Ga0105242_10071239 Ga0105242_100712392 272
351 3300009176 Ga0105242_10476131 Ga0105242_104761312 272
352 3300009177 Ga0105248_10349133 Ga0105248_103491331 272
353 3300009545 Ga0105237_10000253 Ga0105237_100002536 272
354 3300009545 Ga0105237_10003114 Ga0105237_100031148 272
355 3300009545 Ga0105237_10003672 Ga0105237_1000367216 272
356 3300009545 Ga0105237_10006229 Ga0105237_100062294 272
357 3300009545 Ga0105237_10073429 Ga0105237_100734293 272
358 3300009545 Ga0105237_10297082 Ga0105237_102970823 272
359 3300009551 Ga0105238_10071328 Ga0105238_100713283 272
360 3300009551 Ga0105238_10172884 Ga0105238_101728843 272
361 3300009551 Ga0105238_10559999 Ga0105238_105599992 272
362 3300010375 Ga0105239_10000009 Ga0105239_10000009233 272
363 3300010375 Ga0105239_10000011 Ga0105239_1000001190 272
364 3300010375 Ga0105239_10000101 Ga0105239_1000010175 272
365 3300010375 Ga0105239_10000429 Ga0105239_1000042939 272
366 3300010375 Ga0105239_10001186 Ga0105239_1000118621 272
367 3300010375 Ga0105239_10003047 Ga0105239_100030474 272
368 3300010375 Ga0105239_10528809 Ga0105239_105288092 272
369 3300013100 Ga0157373_10000090 Ga0157373_1000009025 272
370 3300013100 Ga0157373_10005766 Ga0157373_100057665 272
371 3300013100 Ga0157373_10188952 Ga0157373_101889522 272
372 3300013102 Ga0157371_10001664 Ga0157371_100016644 272
373 3300013104 Ga0157370_10016887 Ga0157370_100168873 272
374 3300013105 Ga0157369_10000402 Ga0157369_1000040238 272
375 3300013105 Ga0157369_10075155 Ga0157369_100751554 272
376 3300013296 Ga0157374_10009196 Ga0157374_100091965 272
377 3300013296 Ga0157374_10191023 Ga0157374_101910232 272
378 3300013297 Ga0157378_10029953 Ga0157378_100299532 272
379 3300013306 Ga0163162_10000269 Ga0163162_1000026929 272
380 3300013306 Ga0163162_10073815 Ga0163162_100738152 272
381 3300013306 Ga0163162_10473136 Ga0163162_104731362 272
382 3300013307 Ga0157372_10000026 Ga0157372_1000002697 272
383 3300013307 Ga0157372_10001364 Ga0157372_1000136412 272
384 3300013307 Ga0157372_10008792 Ga0157372_100087923 272
385 3300013307 Ga0157372_10043622 Ga0157372_100436222 272
386 3300013307 Ga0157372_10336740 Ga0157372_103367401 272
387 3300013307 Ga0157372_10897056 Ga0157372_108970561 272
388 3300013307 Ga0157372_10929874 Ga0157372_109298741 272
389 3300013308 Ga0157375_10046086 Ga0157375_100460862 272
390 3300014325 Ga0163163_10124157 Ga0163163_101241574 272
391 3300014325 Ga0163163_10138726 Ga0163163_101387262 272
392 3300014325 Ga0163163_10348213 Ga0163163_103482132 272
393 3300014326 Ga0157380_10449918 Ga0157380_104499182 272
394 3300014745 Ga0157377_10209019 Ga0157377_102090191 272
395 3300014968 Ga0157379_10023316 Ga0157379_100233164 272
396 3300014968 Ga0157379_10269761 Ga0157379_102697612 272
397 3300014969 Ga0157376_10066971 Ga0157376_100669712 272
398 3300017792 Ga0163161_10063909 Ga0163161_100639092 272
399 3300025231 Ga0207427_101087 Ga0207427_1010873 272
400 3300025233 Ga0209437_100048 Ga0209437_100048152 272
401 3300025261 Ga0209233_1000029 Ga0209233_1000029225 272
402 3300025272 Ga0209455_1001549 Ga0209455_10015494 272
403 3300025893 Ga0207682_10035762 Ga0207682_100357622 272
404 3300025901 Ga0207688_10249844 Ga0207688_102498441 272
405 3300025904 Ga0207647_10000171 Ga0207647_1000017144 272
406 3300025904 Ga0207647_10005860 Ga0207647_100058608 272
407 3300025907 Ga0207645_10007782 Ga0207645_100077825 272
408 3300025907 Ga0207645_10033742 Ga0207645_100337424 272
409 3300025908 Ga0207643_10008742 Ga0207643_100087425 272
410 3300025908 Ga0207643_10035503 Ga0207643_100355033 272
411 3300025911 Ga0207654_10087443 Ga0207654_100874433 272
412 3300025911 Ga0207654_10206761 Ga0207654_102067611 272
413 3300025911 Ga0207654_10260791 Ga0207654_102607911 272
414 3300025913 Ga0207695_10000016 Ga0207695_10000016625 272
415 3300025913 Ga0207695_10000280 Ga0207695_1000028024 272
416 3300025913 Ga0207695_10004275 Ga0207695_1000427510 272
417 3300025913 Ga0207695_10030352 Ga0207695_100303522 272
418 3300025913 Ga0207695_10074958 Ga0207695_100749584 272
419 3300025913 Ga0207695_10131608 Ga0207695_101316082 272
420 3300025913 Ga0207695_10228937 Ga0207695_102289372 272
421 3300025913 Ga0207695_10360465 Ga0207695_103604652 272
422 3300025914 Ga0207671_10001310 Ga0207671_100013103 272
423 3300025914 Ga0207671_10002992 Ga0207671_100029924 272
424 3300025914 Ga0207671_10003671 Ga0207671_1000367111 272
425 3300025914 Ga0207671_10006550 Ga0207671_100065503 272
426 3300025914 Ga0207671_10012139 Ga0207671_100121394 272
427 3300025914 Ga0207671_10016310 Ga0207671_100163102 272
428 3300025914 Ga0207671_10075141 Ga0207671_100751413 272
429 3300025919 Ga0207657_10326774 Ga0207657_103267742 272
430 3300025924 Ga0207694_10112376 Ga0207694_101123763 272
431 3300025924 Ga0207694_10113400 Ga0207694_101134003 272
432 3300025924 Ga0207694_10167883 Ga0207694_101678832 272
433 3300025924 Ga0207694_10314218 Ga0207694_103142182 272
434 3300025925 Ga0207650_10174217 Ga0207650_101742171 272
435 3300025926 Ga0207659_10106534 Ga0207659_101065342 272
436 3300025932 Ga0207690_10000228 Ga0207690_1000022843 272
437 3300025933 Ga0207706_10018624 Ga0207706_100186245 272
438 3300025933 Ga0207706_10096076 Ga0207706_100960763 272
439 3300025934 Ga0207686_10193313 Ga0207686_101933132 272
440 3300025937 Ga0207669_10083426 Ga0207669_100834262 272
441 3300025938 Ga0207704_10041095 Ga0207704_100410953 272
442 3300025940 Ga0207691_10030848 Ga0207691_100308486 272
443 3300025942 Ga0207689_10003569 Ga0207689_100035699 272
444 3300025942 Ga0207689_10009194 Ga0207689_100091947 272
445 3300025942 Ga0207689_10016522 Ga0207689_100165225 272
446 3300025944 Ga0207661_10048688 Ga0207661_100486882 272
447 3300025945 Ga0207679_10152213 Ga0207679_101522132 272
448 3300025945 Ga0207679_10347898 Ga0207679_103478981 272
449 3300025949 Ga0207667_10000049 Ga0207667_100000498 272
450 3300025949 Ga0207667_10003048 Ga0207667_1000304814 272
451 3300025949 Ga0207667_10008666 Ga0207667_100086667 272
452 3300025949 Ga0207667_10011842 Ga0207667_100118423 272
453 3300025960 Ga0207651_10405256 Ga0207651_104052562 272
454 3300025972 Ga0207668_10053665 Ga0207668_100536651 272
455 3300025981 Ga0207640_10083953 Ga0207640_100839532 272
456 3300026023 Ga0207677_10020352 Ga0207677_100203522 272
457 3300026023 Ga0207677_10166848 Ga0207677_101668481 272
458 3300026035 Ga0207703_10015759 Ga0207703_100157593 272
459 3300026041 Ga0207639_10200514 Ga0207639_102005142 272
460 3300026067 Ga0207678_10055959 Ga0207678_100559592 272
461 3300026078 Ga0207702_10049457 Ga0207702_100494572 272
462 3300026078 Ga0207702_10072369 Ga0207702_100723693 272
463 3300026089 Ga0207648_10013029 Ga0207648_100130296 272
464 3300026095 Ga0207676_10145812 Ga0207676_101458122 272
465 3300026095 Ga0207676_10156451 Ga0207676_101564512 272
466 3300026095 Ga0207676_10224051 Ga0207676_102240512 272
467 3300026116 Ga0207674_10094757 Ga0207674_100947574 272
468 3300026116 Ga0207674_10120714 Ga0207674_101207143 272
469 3300026116 Ga0207674_10332294 Ga0207674_103322942 272
470 3300026118 Ga0207675_100561989 Ga0207675_1005619892 272
471 3300026121 Ga0207683_10003429 Ga0207683_100034292 272
472 3300026121 Ga0207683_10175326 Ga0207683_101753263 272
473 3300026142 Ga0207698_10073200 Ga0207698_100732001 272
474 3300026142 Ga0207698_10115394 Ga0207698_101153942 272
475 3300026142 Ga0207698_10539688 Ga0207698_105396881 272
476 3300028379 Ga0268266_10000105 Ga0268266_10000105117 272
477 3300028380 Ga0268265_10104835 Ga0268265_101048352 272
478 3300028381 Ga0268264_10000013 Ga0268264_10000013308 272
479 3300028381 Ga0268264_10002373 Ga0268264_1000237311 272
480 3300028381 Ga0268264_10041539 Ga0268264_100415395 272
481 3300028794 Ga0307515_10013138 Ga0307515_100131388 272
482 3300031251 Ga0265327_10000115 Ga0265327_10000115128 272
483 3300033179 Ga0307507_10000071 Ga0307507_1000007148 272
484 3300033179 Ga0307507_10167977 Ga0307507_101679772 272
485 3300037312 Ga0395899_0000055 Ga0395899_0000055_125611_126438 272
486 3300037466 Ga0395898_0438008 Ga0395898_0438008_400_1227 272
487 3300037471 Ga0395905_0331658 Ga0395905_0331658_387_1214 272
488 3300041997 Ga0439431_0006937 Ga0439431_0006937_766_1593 272
489 3300044656 Ga0466969_0006579 Ga0466969_0006579_2797_3624 272
490 3300044658 Ga0466972_0000001 Ga0466972_0000001_203268_204098 272
491 3300044658 Ga0466972_0000183 Ga0466972_0000183_40622_41449 272
492 3300044658 Ga0466972_0015976 Ga0466972_0015976_881_1708 272
493 3300044684 Ga0466966_0000053 Ga0466966_0000053_60663_61490 272
494 3300044765 Ga0466970_0000266 Ga0466970_0000266_17375_18205 272
495 3300044842 Ga0466957_0002049 Ga0466957_0002049_751_1578 272
496 3300044842 Ga0466957_0002372 Ga0466957_0002372_2674_3501 272
497 3300045049 Ga0466959_0000005 Ga0466959_0000005_164988_165815 272
498 3300045051 Ga0451576_0415694 Ga0451576_0415694_424_1251 272
499 3300046460 Ga0495638_0016688 Ga0495638_0016688_1414_2241 272
500 3300046460 Ga0495638_0075501 Ga0495638_0075501_746_1582 272
501 3300046460 Ga0495638_0225030 Ga0495638_0225030_66_893 272
502 3300046462 Ga0495651_0077973 Ga0495651_0077973_294_1121 272
503 3300046492 Ga0495585_0000770 Ga0495585_0000770_10883_11710 272
504 3300046501 Ga0495607_0119322 Ga0495607_0119322_297_1124 272
505 3300046507 Ga0495606_0141466 Ga0495606_0141466_25_852 272
506 3300046524 Ga0495648_0015092 Ga0495648_0015092_3828_4655 272
507 3300046524 Ga0495648_0018307 Ga0495648_0018307_3163_3990 272
508 3300046538 Ga0495609_0002974 Ga0495609_0002974_6751_7578 272
509 3300046538 Ga0495609_0018067 Ga0495609_0018067_1253_2080 272
510 3300046558 Ga0495633_0000021 Ga0495633_0000021_196720_197547 272
511 3300046616 Ga0495668_0000075 Ga0495668_0000075_36784_37611 272
512 3300046616 Ga0495668_0001280 Ga0495668_0001280_9515_10342 272
513 3300046660 Ga0495625_0000439 Ga0495625_0000439_50572_51399 272
514 3300046660 Ga0495625_0000905 Ga0495625_0000905_33219_34046 272
515 3300046660 Ga0495625_0321073 Ga0495625_0321073_125_952 272
516 3300047472 Ga0495686_0007545 Ga0495686_0007545_817_1644 272
517 3300047472 Ga0495686_0026850 Ga0495686_0026850_1849_2676 272
518 3300047472 Ga0495686_0099830 Ga0495686_0099830_775_1602 272
519 3300048913 Ga0496110_0592859 Ga0496110_0592859_46_873 272
520 3300049571 Ga0501034_0196416 Ga0501034_0196416_316_1143 272
521 3300049581 Ga0501047_0084696 Ga0501047_0084696_472_1299 272
522 3300049581 Ga0501047_0456195 Ga0501047_0456195_92_919 272
523 3300049671 Ga0501238_017803 Ga0501238_017803_136_963 272
524 3300049703 Ga0501219_000186 Ga0501219_000186_4928_5803 272
525 3300049823 Ga0501044_0168835 Ga0501044_0168835_61_888 272
526 3300050493 nmdc:mga0k408_32912_c1 nmdc:mga0k408_32912_c1_225_1052 272
527 3300050493 nmdc:mga0k408_52309_c1 nmdc:mga0k408_52309_c1_358_1185 272
528 3300050493 nmdc:mga0k408_56421_c1 nmdc:mga0k408_56421_c1_566_1393 272
529 3300050493 nmdc:mga0k408_635_c1 nmdc:mga0k408_635_c1_6915_7742 272
530 3300050496 nmdc:mga07m45_109729_c1 nmdc:mga07m45_109729_c1_109_936 272
531 3300050507 nmdc:mga05p37_1882_c2 nmdc:mga05p37_1882_c2_4151_4978 272
532 3300053086 Ga0500578_0000017 Ga0500578_0000017_84912_85739 272
533 3300053092 Ga0500583_0000130 Ga0500583_0000130_14939_15766 272
534 3300053092 Ga0500583_0062147 Ga0500583_0062147_648_1475 272
535 3300053122 Ga0500608_077133 Ga0500608_077133_219_1046 272
536 3300053125 Ga0500618_000005 Ga0500618_000005_95530_96360 272
537 3300053139 Ga0500568_0003293 Ga0500568_0003293_1724_2551 272
538 3300053142 Ga0500577_0116093 Ga0500577_0116093_264_1100 272
539 3300053146 Ga0500588_0007037 Ga0500588_0007037_586_1413 272
540 3300053156 Ga0500622_0002517 Ga0500622_0002517_5185_6012 272
541 3300053178 Ga0500637_0026286 Ga0500637_0026286_1449_2285 272
542 3300053727 Ga0500611_004195 Ga0500611_004195_78_905 272

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

146

323

0.98

PF01842

ACT

ACT domain

54

107

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lou-assembly1.cif.gz_B crystal structure of formyltetrahydrofolate deformylase (yp_105254.1) from burkholderia mallei atcc 23344 at 1.90 a resolution 0.9324 2 272
3w7b-assembly1.cif.gz_A crystal structure of formyltetrahydrofolate deformylase from thermus thermophilus hb8 0.932 2 272
3lou-assembly1.cif.gz_A crystal structure of formyltetrahydrofolate deformylase (yp_105254.1) from burkholderia mallei atcc 23344 at 1.90 a resolution 0.9314 2 272
3n0v-assembly1.cif.gz_C crystal structure of a formyltetrahydrofolate deformylase (pp_0327) from pseudomonas putida kt2440 at 2.25 a resolution 0.9268 2 271
3n0v-assembly1.cif.gz_D crystal structure of a formyltetrahydrofolate deformylase (pp_0327) from pseudomonas putida kt2440 at 2.25 a resolution 0.9266 2 271
ID Description Score Start End Superfamily
af_P37051_4_77_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9858 1 70 3.30.70.260
af_A0A1D6F177_170_222_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9485 1 49 3.30.70.260
af_K7N190_5_82_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9247 2 49 3.90.550.10
af_P37051_4_77_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.921 1 70 3.30.70.260
af_K7KPK5_251_361_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9155 2 63 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A4Q3UU89-F1-model_v4 Formyltetrahydrofolate deformylase (EC 3.5.1.10) 0.9725 90 272 GO:0006189
GO:0006730
GO:0008864
AF-A0A533ZIJ0-F1-model_v4 Formyltetrahydrofolate deformylase (EC 3.5.1.10) 0.9654 85 272 GO:0006189
GO:0006730
GO:0008864
AF-A0A7Y4SEU0-F1-model_v4 Formyltetrahydrofolate deformylase (EC 3.5.1.10) 0.9629 109 272 GO:0006189
GO:0006730
GO:0008864
AF-A0A257XG96-F1-model_v4 deleted 0.9536 146 271
AF-N4X8L9-F1-model_v4 Formyl transferase N-terminal domain-containing protein 0.952 72 272 GO:0006189
GO:0006730
GO:0008864

Feature Viewer

pLDDT pTM Quality
94.16 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map