F461484
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 542 | 252 | 1084 | 199 |
Family's Representative Sequence
| Representative Sequence | 3300014325|Ga0163163_10203175|Ga0163163_102031752 |
| Length | 221 |
| Sequence | LRLARARAYPEPELTDRSIAQRQAGTEEKRRQILDAAVRVFARRGFHTSRVGDIAEEAGVAHGLLYHYFASKDEVLETVFRENWTELLVRFEQVEASGQPADEKLRGIVKILLRTWRNDPDLVTVMVREVGRSPHLASQVDVIGLGFAVIERVIARGQAEGVFRKELDARLASWIVYGGLEEILTGWVLGRLPDGDEEVARAERTIVDVVLGGLGETPVAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 42 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 64 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 106 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 107 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 109 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 110 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 111 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 112 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 113 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 114 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 115 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 116 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 117 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 118 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 119 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 120 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 121 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 122 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 123 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 124 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 125 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 127 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 128 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 129 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 130 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 131 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 132 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 133 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 134 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 135 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 136 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 137 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 138 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 139 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 140 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 141 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 142 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 143 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 144 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 145 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 146 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 147 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 148 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 149 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 150 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 151 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 204 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 205 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 206 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 207 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 208 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 209 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 212 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 213 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 214 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 215 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 216 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 217 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 249 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 252 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.15 |
| Metatranscriptomes | 1.85 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.18 |
| Nodule | 0 |
| Rhizoplane | 11.25 |
| Rhizosphere | 88.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0163163_10203175 | 3300014325 | Bacteria | 2030 |
| 2 | Ga0070658_10009017 | 3300005327 | Bacteria | 8023 |
| 3 | Ga0070658_10068850 | 3300005327 | Bacteria | 2894 |
| 4 | Ga0070683_100002427 | 3300005329 | Bacteria | 14814 |
| 5 | Ga0070683_100556482 | 3300005329 | Unclassified | 1097 |
| 6 | Ga0070680_100114449 | 3300005336 | Bacteria | 2247 |
| 7 | Ga0070680_100315429 | 3300005336 | Bacteria | 1327 |
| 8 | Ga0070660_100057861 | 3300005339 | Bacteria | 3005 |
| 9 | Ga0070660_100087713 | 3300005339 | Bacteria | 2449 |
| 10 | Ga0070691_10044034 | 3300005341 | Unclassified | 2115 |
| 11 | Ga0070687_100052997 | 3300005343 | Bacteria | 2108 |
| 12 | Ga0070692_10020665 | 3300005345 | Bacteria | 3194 |
| 13 | Ga0070692_10272610 | 3300005345 | Unclassified | 1022 |
| 14 | Ga0070674_100156760 | 3300005356 | Unclassified | 1723 |
| 15 | Ga0070659_100144505 | 3300005366 | Bacteria | 1938 |
| 16 | Ga0070703_10018902 | 3300005406 | Bacteria | 1996 |
| 17 | Ga0070709_10037851 | 3300005434 | Bacteria | 2949 |
| 18 | Ga0070709_10091773 | 3300005434 | Bacteria | 2005 |
| 19 | Ga0070714_100009012 | 3300005435 | Bacteria | 7815 |
| 20 | Ga0070714_100079377 | 3300005435 | Bacteria | 2853 |
| 21 | Ga0070714_100222906 | 3300005435 | Bacteria | 1734 |
| 22 | Ga0070713_100001098 | 3300005436 | Bacteria | 17278 |
| 23 | Ga0070713_100038848 | 3300005436 | Bacteria | 3860 |
| 24 | Ga0070710_10005679 | 3300005437 | Bacteria | 5939 |
| 25 | Ga0070711_100242922 | 3300005439 | Bacteria | 1409 |
| 26 | Ga0070711_100362402 | 3300005439 | Bacteria | 1168 |
| 27 | Ga0070705_100156163 | 3300005440 | Unclassified | 1519 |
| 28 | Ga0070700_100032289 | 3300005441 | Bacteria | 3145 |
| 29 | Ga0070694_100008952 | 3300005444 | Bacteria | 6133 |
| 30 | Ga0070708_100093723 | 3300005445 | Bacteria | 2738 |
| 31 | Ga0070663_100447344 | 3300005455 | Unclassified | 1064 |
| 32 | Ga0070678_100162937 | 3300005456 | Bacteria | 1809 |
| 33 | Ga0070662_100037003 | 3300005457 | Bacteria | 3457 |
| 34 | Ga0070681_10019349 | 3300005458 | Bacteria | 6814 |
| 35 | Ga0070681_10097344 | 3300005458 | Bacteria | 2890 |
| 36 | Ga0070681_10693538 | 3300005458 | Bacteria | 934 |
| 37 | Ga0068867_100570962 | 3300005459 | Unclassified | 982 |
| 38 | Ga0070707_100000749 | 3300005468 | Bacteria | 32054 |
| 39 | Ga0070707_100205788 | 3300005468 | Bacteria | 1918 |
| 40 | Ga0070707_100381827 | 3300005468 | Bacteria | 1368 |
| 41 | Ga0070679_100027666 | 3300005530 | Bacteria | 5582 |
| 42 | Ga0070679_100042702 | 3300005530 | Bacteria | 4516 |
| 43 | Ga0070679_100257203 | 3300005530 | Bacteria | 1701 |
| 44 | Ga0070679_100393545 | 3300005530 | Bacteria | 1332 |
| 45 | Ga0070684_100236451 | 3300005535 | Bacteria | 1669 |
| 46 | Ga0070684_100309684 | 3300005535 | Bacteria | 1450 |
| 47 | Ga0070684_100371053 | 3300005535 | Bacteria | 1317 |
| 48 | Ga0070672_100178069 | 3300005543 | Unclassified | 1771 |
| 49 | Ga0070686_100050586 | 3300005544 | Bacteria | 2642 |
| 50 | Ga0070686_100060386 | 3300005544 | Bacteria | 2446 |
| 51 | Ga0070695_100003203 | 3300005545 | Bacteria | 9558 |
| 52 | Ga0070695_100965286 | 3300005545 | Unclassified | 691 |
| 53 | Ga0070693_100044515 | 3300005547 | Unclassified | 2511 |
| 54 | Ga0070693_100418837 | 3300005547 | Bacteria | 933 |
| 55 | Ga0070704_100045627 | 3300005549 | Bacteria | 3050 |
| 56 | Ga0068855_100019171 | 3300005563 | Bacteria | 8221 |
| 57 | Ga0068855_100102195 | 3300005563 | Bacteria | 3299 |
| 58 | Ga0068855_100220786 | 3300005563 | Unclassified | 2125 |
| 59 | Ga0068855_101396503 | 3300005563 | Bacteria | 722 |
| 60 | Ga0068854_100071306 | 3300005578 | Unclassified | 2541 |
| 61 | Ga0068856_100145985 | 3300005614 | Bacteria | 2373 |
| 62 | Ga0070702_100029742 | 3300005615 | Bacteria | 2973 |
| 63 | Ga0070702_100717155 | 3300005615 | Unclassified | 764 |
| 64 | Ga0068852_100036839 | 3300005616 | Bacteria | 4098 |
| 65 | Ga0068852_100053017 | 3300005616 | Bacteria | 3489 |
| 66 | Ga0068866_10086096 | 3300005718 | Unclassified | 1700 |
| 67 | Ga0068863_100337998 | 3300005841 | Bacteria | 1465 |
| 68 | Ga0068863_101266469 | 3300005841 | Bacteria | 744 |
| 69 | Ga0081455_10063697 | 3300005937 | Bacteria | 3092 |
| 70 | Ga0070717_10002024 | 3300006028 | Bacteria | 14193 |
| 71 | Ga0070717_10023413 | 3300006028 | Bacteria | 4893 |
| 72 | Ga0070715_10068393 | 3300006163 | Bacteria | 1579 |
| 73 | Ga0070716_100000887 | 3300006173 | Bacteria | 12921 |
| 74 | Ga0070712_100186316 | 3300006175 | Bacteria | 1620 |
| 75 | Ga0068865_100038506 | 3300006881 | Bacteria | 3237 |
| 76 | Ga0068865_100041379 | 3300006881 | Bacteria | 3135 |
| 77 | Ga0105240_10039050 | 3300009093 | Bacteria | 6083 |
| 78 | Ga0105240_10046296 | 3300009093 | Bacteria | 5512 |
| 79 | Ga0105245_10082482 | 3300009098 | Bacteria | 2941 |
| 80 | Ga0105245_10225211 | 3300009098 | Unclassified | 1811 |
| 81 | Ga0105245_10293047 | 3300009098 | Bacteria | 1594 |
| 82 | Ga0105247_10202884 | 3300009101 | Bacteria | 1333 |
| 83 | Ga0114129_10011894 | 3300009147 | Bacteria | 12381 |
| 84 | Ga0114129_10042966 | 3300009147 | Bacteria | 6361 |
| 85 | Ga0105242_10029085 | 3300009176 | Bacteria | 4404 |
| 86 | Ga0105242_10031008 | 3300009176 | Bacteria | 4268 |
| 87 | Ga0105248_10575473 | 3300009177 | Bacteria | 1271 |
| 88 | Ga0105237_10016749 | 3300009545 | Bacteria | 7610 |
| 89 | Ga0105237_10491075 | 3300009545 | Unclassified | 1234 |
| 90 | Ga0105239_10051457 | 3300010375 | Bacteria | 4515 |
| 91 | Ga0105239_10102355 | 3300010375 | Bacteria | 3169 |
| 92 | Ga0157373_10441905 | 3300013100 | Bacteria | 935 |
| 93 | Ga0157371_10087104 | 3300013102 | Bacteria | 2212 |
| 94 | Ga0157370_10035172 | 3300013104 | Bacteria | 4872 |
| 95 | Ga0157370_10369253 | 3300013104 | Bacteria | 1322 |
| 96 | Ga0157369_10003856 | 3300013105 | Bacteria | 17824 |
| 97 | Ga0157369_10004745 | 3300013105 | Bacteria | 15975 |
| 98 | Ga0157369_10036917 | 3300013105 | Bacteria | 5352 |
| 99 | Ga0157369_11689488 | 3300013105 | Unclassified | 643 |
| 100 | Ga0157374_10106257 | 3300013296 | Bacteria | 2697 |
| 101 | Ga0163162_10098693 | 3300013306 | Bacteria | 3010 |
| 102 | Ga0157372_10014906 | 3300013307 | Bacteria | 8322 |
| 103 | Ga0157372_10271293 | 3300013307 | Bacteria | 1971 |
| 104 | Ga0157372_10408770 | 3300013307 | Bacteria | 1582 |
| 105 | Ga0157372_10608653 | 3300013307 | Bacteria | 1273 |
| 106 | Ga0157375_10020375 | 3300013308 | Bacteria | 6057 |
| 107 | Ga0157375_10036660 | 3300013308 | Bacteria | 4693 |
| 108 | Ga0182008_10214083 | 3300014497 | Bacteria | 984 |
| 109 | Ga0157377_10031174 | 3300014745 | Bacteria | 2895 |
| 110 | Ga0182006_1111053 | 3300015261 | Unclassified | 962 |
| 111 | Ga0197907_10360204 | 3300020069 | Bacteria | 4693 |
| 112 | Ga0206356_10246410 | 3300020070 | Bacteria | 1623 |
| 113 | Ga0206356_11202385 | 3300020070 | Bacteria | 997 |
| 114 | Ga0206354_10017572 | 3300020081 | Bacteria | 898 |
| 115 | Ga0206354_10378999 | 3300020081 | Bacteria | 3712 |
| 116 | Ga0206354_11247209 | 3300020081 | Bacteria | 2731 |
| 117 | Ga0206353_10364087 | 3300020082 | Bacteria | 4650 |
| 118 | Ga0206353_10493581 | 3300020082 | Bacteria | 4974 |
| 119 | Ga0206353_10784609 | 3300020082 | Bacteria | 4720 |
| 120 | Ga0206353_11077977 | 3300020082 | Bacteria | 1401 |
| 121 | Ga0207647_10115875 | 3300025904 | Unclassified | 1582 |
| 122 | Ga0207685_10010023 | 3300025905 | Bacteria | 2778 |
| 123 | Ga0207699_10061518 | 3300025906 | Bacteria | 2259 |
| 124 | Ga0207705_10021764 | 3300025909 | Bacteria | 4575 |
| 125 | Ga0207707_10038600 | 3300025912 | Bacteria | 4173 |
| 126 | Ga0207707_10056252 | 3300025912 | Bacteria | 3422 |
| 127 | Ga0207707_10079792 | 3300025912 | Bacteria | 2858 |
| 128 | Ga0207707_10093626 | 3300025912 | Bacteria | 2625 |
| 129 | Ga0207707_10205086 | 3300025912 | Bacteria | 1718 |
| 130 | Ga0207695_10045245 | 3300025913 | Bacteria | 4674 |
| 131 | Ga0207695_10146804 | 3300025913 | Bacteria | 2302 |
| 132 | Ga0207671_10031005 | 3300025914 | Bacteria | 3986 |
| 133 | Ga0207693_10019641 | 3300025915 | Bacteria | 5373 |
| 134 | Ga0207693_10544690 | 3300025915 | Bacteria | 905 |
| 135 | Ga0207663_10197815 | 3300025916 | Bacteria | 1448 |
| 136 | Ga0207660_10316665 | 3300025917 | Bacteria | 1245 |
| 137 | Ga0207662_10043228 | 3300025918 | Bacteria | 2657 |
| 138 | Ga0207657_10003291 | 3300025919 | Bacteria | 17267 |
| 139 | Ga0207657_10030717 | 3300025919 | Bacteria | 4873 |
| 140 | Ga0207657_10198914 | 3300025919 | Bacteria | 1613 |
| 141 | Ga0207652_10138191 | 3300025921 | Bacteria | 2177 |
| 142 | Ga0207652_10190419 | 3300025921 | Bacteria | 1845 |
| 143 | Ga0207652_10287135 | 3300025921 | Bacteria | 1484 |
| 144 | Ga0207652_10616095 | 3300025921 | Bacteria | 972 |
| 145 | Ga0207646_10051191 | 3300025922 | Bacteria | 3695 |
| 146 | Ga0207687_10103494 | 3300025927 | Unclassified | 2100 |
| 147 | Ga0207687_10181252 | 3300025927 | Bacteria | 1632 |
| 148 | Ga0207700_10192558 | 3300025928 | Bacteria | 1714 |
| 149 | Ga0207664_10081546 | 3300025929 | Bacteria | 2633 |
| 150 | Ga0207664_10167730 | 3300025929 | Bacteria | 1877 |
| 151 | Ga0207644_10039387 | 3300025931 | Bacteria | 3336 |
| 152 | Ga0207644_10152795 | 3300025931 | Bacteria | 1788 |
| 153 | Ga0207690_10045841 | 3300025932 | Bacteria | 2891 |
| 154 | Ga0207706_10031007 | 3300025933 | Bacteria | 4765 |
| 155 | Ga0207706_10054727 | 3300025933 | Bacteria | 3520 |
| 156 | Ga0207669_10038470 | 3300025937 | Bacteria | 2755 |
| 157 | Ga0207665_10003486 | 3300025939 | Bacteria | 10506 |
| 158 | Ga0207691_10211846 | 3300025940 | Unclassified | 1683 |
| 159 | Ga0207661_10015788 | 3300025944 | Bacteria | 5562 |
| 160 | Ga0207667_10076075 | 3300025949 | Bacteria | 3484 |
| 161 | Ga0207667_10091144 | 3300025949 | Bacteria | 3149 |
| 162 | Ga0207651_10120768 | 3300025960 | Bacteria | 1987 |
| 163 | Ga0207712_10072953 | 3300025961 | Bacteria | 2474 |
| 164 | Ga0207677_10248539 | 3300026023 | Unclassified | 1443 |
| 165 | Ga0207677_10341522 | 3300026023 | Bacteria | 1251 |
| 166 | Ga0207678_10573707 | 3300026067 | Bacteria | 988 |
| 167 | Ga0207708_10012727 | 3300026075 | Bacteria | 6274 |
| 168 | Ga0207702_10328971 | 3300026078 | Bacteria | 1457 |
| 169 | Ga0207641_11119347 | 3300026088 | Bacteria | 786 |
| 170 | Ga0207648_10012668 | 3300026089 | Bacteria | 7885 |
| 171 | Ga0207675_100176226 | 3300026118 | Unclassified | 2046 |
| 172 | Ga0207683_10076589 | 3300026121 | Bacteria | 2961 |
| 173 | Ga0207683_10300014 | 3300026121 | Bacteria | 1470 |
| 174 | Ga0265323_10087312 | 3300028653 | Bacteria | 1047 |
| 175 | Ga0265322_10003224 | 3300028654 | Bacteria | 4953 |
| 176 | Ga0265338_10043154 | 3300028800 | Bacteria | 4187 |
| 177 | Ga0265328_10123118 | 3300031239 | Bacteria | 968 |
| 178 | Ga0265325_10045261 | 3300031241 | Bacteria | 2287 |
| 179 | Ga0265340_10018357 | 3300031247 | Bacteria | 3609 |
| 180 | Ga0265339_10045257 | 3300031249 | Bacteria | 2423 |
| 181 | Ga0265316_10004699 | 3300031344 | Bacteria | 13532 |
| 182 | Ga0265313_10007060 | 3300031595 | Bacteria | 7767 |
| 183 | Ga0265314_10066576 | 3300031711 | Unclassified | 2429 |
| 184 | Ga0307409_100071805 | 3300031995 | Bacteria | 2754 |
| 185 | Ga0307416_100062006 | 3300032002 | Bacteria | 3055 |
| 186 | Ga0373951_0057952 | 3300035091 | Bacteria | 965 |
| 187 | Ga0373956_0287857 | 3300035119 | Bacteria | 782 |
| 188 | Ga0373943_0108718 | 3300035170 | Bacteria | 1460 |
| 189 | Ga0373931_0061703 | 3300035691 | Bacteria | 2022 |
| 190 | Ga0373935_0014166 | 3300035692 | Bacteria | 4814 |
| 191 | Ga0373927_0165066 | 3300035695 | Bacteria | 1451 |
| 192 | Ga0373947_0001659 | 3300035725 | Bacteria | 13619 |
| 193 | Ga0373947_0103398 | 3300035725 | Bacteria | 1793 |
| 194 | Ga0373937_0001461 | 3300036401 | Bacteria | 19779 |
| 195 | Ga0373937_0747976 | 3300036401 | Bacteria | 925 |
| 196 | Ga0373925_0004134 | 3300037068 | Bacteria | 11013 |
| 197 | Ga0395899_0035527 | 3300037312 | Bacteria | 3740 |
| 198 | Ga0395899_0106153 | 3300037312 | Unclassified | 2023 |
| 199 | Ga0395900_0186055 | 3300037418 | Unclassified | 2108 |
| 200 | Ga0395900_0364627 | 3300037418 | Unclassified | 1415 |
| 201 | Ga0395900_0562148 | 3300037418 | Bacteria | 1084 |
| 202 | Ga0395898_0021626 | 3300037466 | Bacteria | 6520 |
| 203 | Ga0395898_0104077 | 3300037466 | Bacteria | 2723 |
| 204 | Ga0395898_0124506 | 3300037466 | Bacteria | 2469 |
| 205 | Ga0395898_0150864 | 3300037466 | Bacteria | 2224 |
| 206 | Ga0395898_0293228 | 3300037466 | Bacteria | 1552 |
| 207 | Ga0395898_0361849 | 3300037466 | Bacteria | 1383 |
| 208 | Ga0395898_0577305 | 3300037466 | Bacteria | 1067 |
| 209 | Ga0395905_0062832 | 3300037471 | Bacteria | 3473 |
| 210 | Ga0395901_0043049 | 3300038443 | Bacteria | 4683 |
| 211 | Ga0395901_0054499 | 3300038443 | Bacteria | 4156 |
| 212 | Ga0395901_0357978 | 3300038443 | Bacteria | 1505 |
| 213 | Ga0395901_0770187 | 3300038443 | Bacteria | 954 |
| 214 | Ga0439466_0110990 | 3300041411 | Bacteria | 851 |
| 215 | Ga0439465_0039439 | 3300041413 | Bacteria | 1525 |
| 216 | Ga0439432_028288 | 3300042006 | Bacteria | 1826 |
| 217 | Ga0450907_006322 | 3300042146 | Bacteria | 1979 |
| 218 | Ga0450910_022159 | 3300042147 | Bacteria | 965 |
| 219 | Ga0466969_0284762 | 3300044656 | Unclassified | 748 |
| 220 | Ga0466972_0087557 | 3300044658 | Bacteria | 1479 |
| 221 | Ga0466965_0125556 | 3300044683 | Bacteria | 1327 |
| 222 | Ga0466965_0173609 | 3300044683 | Unclassified | 1135 |
| 223 | Ga0466965_0224688 | 3300044683 | Bacteria | 1001 |
| 224 | Ga0466966_0017793 | 3300044684 | Bacteria | 4693 |
| 225 | Ga0466966_0097261 | 3300044684 | Bacteria | 1823 |
| 226 | Ga0466966_0244192 | 3300044684 | Bacteria | 1082 |
| 227 | Ga0466961_0011827 | 3300044693 | Bacteria | 5579 |
| 228 | Ga0466961_0017835 | 3300044693 | Bacteria | 4562 |
| 229 | Ga0466961_0022341 | 3300044693 | Bacteria | 4069 |
| 230 | Ga0466961_0045125 | 3300044693 | Bacteria | 2820 |
| 231 | Ga0466963_0000400 | 3300044694 | Bacteria | 19783 |
| 232 | Ga0466963_0000752 | 3300044694 | Bacteria | 16002 |
| 233 | Ga0466963_0001838 | 3300044694 | Bacteria | 11561 |
| 234 | Ga0466963_0003853 | 3300044694 | Bacteria | 8655 |
| 235 | Ga0466963_0009192 | 3300044694 | Bacteria | 5945 |
| 236 | Ga0466963_0025294 | 3300044694 | Bacteria | 3785 |
| 237 | Ga0466963_0025676 | 3300044694 | Bacteria | 3759 |
| 238 | Ga0466963_0030170 | 3300044694 | Bacteria | 3496 |
| 239 | Ga0466963_0060633 | 3300044694 | Bacteria | 2527 |
| 240 | Ga0466963_0079639 | 3300044694 | Bacteria | 2216 |
| 241 | Ga0466963_0121591 | 3300044694 | Bacteria | 1797 |
| 242 | Ga0466963_0244644 | 3300044694 | Bacteria | 1258 |
| 243 | Ga0466963_0416576 | 3300044694 | Bacteria | 947 |
| 244 | Ga0466963_0416846 | 3300044694 | Unclassified | 947 |
| 245 | Ga0466964_0001912 | 3300044706 | Bacteria | 7283 |
| 246 | Ga0466964_0022215 | 3300044706 | Bacteria | 2459 |
| 247 | Ga0466964_0024735 | 3300044706 | Bacteria | 2341 |
| 248 | Ga0466964_0029435 | 3300044706 | Bacteria | 2168 |
| 249 | Ga0466964_0047700 | 3300044706 | Bacteria | 1749 |
| 250 | Ga0466964_0070680 | 3300044706 | Bacteria | 1475 |
| 251 | Ga0466964_0168101 | 3300044706 | Bacteria | 1030 |
| 252 | Ga0466971_0036428 | 3300044719 | Bacteria | 2206 |
| 253 | Ga0466971_0114609 | 3300044719 | Bacteria | 1245 |
| 254 | Ga0466971_0119701 | 3300044719 | Bacteria | 1218 |
| 255 | Ga0466968_0004057 | 3300044735 | Bacteria | 5447 |
| 256 | Ga0466968_0005768 | 3300044735 | Bacteria | 4645 |
| 257 | Ga0466968_0081933 | 3300044735 | Bacteria | 1419 |
| 258 | Ga0466968_0261321 | 3300044735 | Bacteria | 824 |
| 259 | Ga0466970_0008974 | 3300044765 | Bacteria | 5042 |
| 260 | Ga0466970_0041046 | 3300044765 | Bacteria | 2458 |
| 261 | Ga0466970_0063407 | 3300044765 | Bacteria | 1981 |
| 262 | Ga0466970_0111797 | 3300044765 | Bacteria | 1492 |
| 263 | Ga0466957_0005434 | 3300044842 | Bacteria | 7155 |
| 264 | Ga0466957_0005656 | 3300044842 | Bacteria | 7031 |
| 265 | Ga0466957_0005906 | 3300044842 | Bacteria | 6904 |
| 266 | Ga0466957_0023327 | 3300044842 | Bacteria | 3658 |
| 267 | Ga0466957_0095753 | 3300044842 | Bacteria | 1865 |
| 268 | Ga0466957_0178321 | 3300044842 | Bacteria | 1387 |
| 269 | Ga0466957_0179175 | 3300044842 | Bacteria | 1383 |
| 270 | Ga0466957_0241041 | 3300044842 | Bacteria | 1200 |
| 271 | Ga0466957_0594027 | 3300044842 | Unclassified | 774 |
| 272 | Ga0466957_0621525 | 3300044842 | Bacteria | 758 |
| 273 | Ga0466960_0053571 | 3300044901 | Bacteria | 1956 |
| 274 | Ga0466959_0005205 | 3300045049 | Bacteria | 8873 |
| 275 | Ga0466959_0010134 | 3300045049 | Bacteria | 6723 |
| 276 | Ga0466959_0016759 | 3300045049 | Bacteria | 5361 |
| 277 | Ga0466959_0028279 | 3300045049 | Bacteria | 4157 |
| 278 | Ga0466959_0077381 | 3300045049 | Bacteria | 2401 |
| 279 | Ga0466959_0154727 | 3300045049 | Bacteria | 1614 |
| 280 | Ga0466958_0004089 | 3300045836 | Bacteria | 7659 |
| 281 | Ga0466958_0006924 | 3300045836 | Bacteria | 6204 |
| 282 | Ga0466958_0017282 | 3300045836 | Bacteria | 4166 |
| 283 | Ga0466958_0026569 | 3300045836 | Bacteria | 3422 |
| 284 | Ga0466958_0027210 | 3300045836 | Bacteria | 3384 |
| 285 | Ga0466958_0038544 | 3300045836 | Bacteria | 2868 |
| 286 | Ga0466958_0090793 | 3300045836 | Bacteria | 1890 |
| 287 | Ga0466958_0275674 | 3300045836 | Bacteria | 1077 |
| 288 | Ga0466958_0363178 | 3300045836 | Bacteria | 933 |
| 289 | Ga0466967_0002083 | 3300045976 | Bacteria | 12245 |
| 290 | Ga0466967_0002624 | 3300045976 | Bacteria | 11319 |
| 291 | Ga0466967_0003633 | 3300045976 | Bacteria | 10137 |
| 292 | Ga0466967_0006217 | 3300045976 | Bacteria | 8416 |
| 293 | Ga0466967_0006777 | 3300045976 | Bacteria | 8159 |
| 294 | Ga0466967_0013645 | 3300045976 | Bacteria | 6289 |
| 295 | Ga0466967_0016530 | 3300045976 | Bacteria | 5823 |
| 296 | Ga0466967_0019387 | 3300045976 | Bacteria | 5469 |
| 297 | Ga0466967_0021549 | 3300045976 | Bacteria | 5239 |
| 298 | Ga0466967_0029858 | 3300045976 | Bacteria | 4568 |
| 299 | Ga0466967_0032377 | 3300045976 | Bacteria | 4414 |
| 300 | Ga0466967_0032674 | 3300045976 | Bacteria | 4397 |
| 301 | Ga0466967_0036195 | 3300045976 | Bacteria | 4211 |
| 302 | Ga0466967_0046083 | 3300045976 | Bacteria | 3793 |
| 303 | Ga0466967_0080331 | 3300045976 | Bacteria | 2942 |
| 304 | Ga0466967_0093129 | 3300045976 | Bacteria | 2741 |
| 305 | Ga0466967_0120044 | 3300045976 | Bacteria | 2427 |
| 306 | Ga0466967_0143918 | 3300045976 | Bacteria | 2222 |
| 307 | Ga0466967_0230322 | 3300045976 | Bacteria | 1764 |
| 308 | Ga0466967_0303599 | 3300045976 | Bacteria | 1536 |
| 309 | Ga0466967_0316554 | 3300045976 | Bacteria | 1504 |
| 310 | Ga0466967_0458128 | 3300045976 | Bacteria | 1247 |
| 311 | Ga0466967_0754179 | 3300045976 | Bacteria | 965 |
| 312 | Ga0466967_0777110 | 3300045976 | Bacteria | 950 |
| 313 | Ga0466967_1150879 | 3300045976 | Unclassified | 773 |
| 314 | Ga0495592_0000048 | 3300046454 | Bacteria | 114599 |
| 315 | Ga0495603_0074044 | 3300046455 | Bacteria | 2000 |
| 316 | Ga0495629_0008464 | 3300046459 | Bacteria | 7574 |
| 317 | Ga0495629_0040913 | 3300046459 | Bacteria | 3261 |
| 318 | Ga0495641_0034701 | 3300046461 | Bacteria | 2383 |
| 319 | Ga0495641_0077170 | 3300046461 | Bacteria | 1493 |
| 320 | Ga0495651_0000049 | 3300046462 | Bacteria | 88249 |
| 321 | Ga0495651_0006492 | 3300046462 | Bacteria | 8938 |
| 322 | Ga0495653_0000489 | 3300046463 | Bacteria | 30700 |
| 323 | Ga0495653_0015091 | 3300046463 | Bacteria | 6296 |
| 324 | Ga0495653_0044965 | 3300046463 | Bacteria | 3425 |
| 325 | Ga0495580_0129767 | 3300046472 | Bacteria | 1749 |
| 326 | Ga0495582_0012341 | 3300046473 | Bacteria | 4706 |
| 327 | Ga0495582_0162572 | 3300046473 | Bacteria | 1270 |
| 328 | Ga0495605_0260803 | 3300046474 | Bacteria | 740 |
| 329 | Ga0495639_0011148 | 3300046475 | Bacteria | 3871 |
| 330 | Ga0495662_0003087 | 3300046476 | Bacteria | 8397 |
| 331 | Ga0495662_0004812 | 3300046476 | Bacteria | 6766 |
| 332 | Ga0495664_0013872 | 3300046477 | Bacteria | 4568 |
| 333 | Ga0495664_0102468 | 3300046477 | Bacteria | 1725 |
| 334 | Ga0495664_0135775 | 3300046477 | Bacteria | 1490 |
| 335 | Ga0495664_0367702 | 3300046477 | Bacteria | 865 |
| 336 | Ga0495584_0254534 | 3300046491 | Unclassified | 893 |
| 337 | Ga0495607_0200265 | 3300046501 | Bacteria | 989 |
| 338 | Ga0495608_0003026 | 3300046511 | Bacteria | 11997 |
| 339 | Ga0495608_0026243 | 3300046511 | Bacteria | 3973 |
| 340 | Ga0495616_0150592 | 3300046513 | Bacteria | 1053 |
| 341 | Ga0495618_0007049 | 3300046514 | Bacteria | 6808 |
| 342 | Ga0495618_0012943 | 3300046514 | Bacteria | 5071 |
| 343 | Ga0495618_0031726 | 3300046514 | Bacteria | 3307 |
| 344 | Ga0495628_0000026 | 3300046516 | Bacteria | 127398 |
| 345 | Ga0495628_0514278 | 3300046516 | Unclassified | 863 |
| 346 | Ga0495630_0002498 | 3300046517 | Bacteria | 12751 |
| 347 | Ga0495630_0003344 | 3300046517 | Bacteria | 11166 |
| 348 | Ga0495630_0132189 | 3300046517 | Bacteria | 1895 |
| 349 | Ga0495630_0302385 | 3300046517 | Bacteria | 1222 |
| 350 | Ga0495630_0574240 | 3300046517 | Unclassified | 864 |
| 351 | Ga0495637_0095149 | 3300046520 | Bacteria | 1170 |
| 352 | Ga0495666_0044138 | 3300046526 | Bacteria | 2152 |
| 353 | Ga0495666_0085585 | 3300046526 | Bacteria | 1489 |
| 354 | Ga0495652_0000172 | 3300046529 | Bacteria | 74042 |
| 355 | Ga0495652_0042823 | 3300046529 | Bacteria | 3903 |
| 356 | Ga0495652_0238916 | 3300046529 | Bacteria | 1353 |
| 357 | Ga0495665_0000302 | 3300046531 | Bacteria | 24900 |
| 358 | Ga0495640_0022308 | 3300046533 | Bacteria | 4628 |
| 359 | Ga0495640_0044868 | 3300046533 | Bacteria | 3071 |
| 360 | Ga0495586_0006885 | 3300046535 | Bacteria | 6058 |
| 361 | Ga0495586_0108297 | 3300046535 | Bacteria | 1545 |
| 362 | Ga0495587_0000362 | 3300046536 | Bacteria | 32677 |
| 363 | Ga0495587_0244074 | 3300046536 | Bacteria | 1010 |
| 364 | Ga0495645_0000016 | 3300046543 | Bacteria | 158415 |
| 365 | Ga0495645_0163568 | 3300046543 | Bacteria | 1537 |
| 366 | Ga0495667_0024995 | 3300046559 | Bacteria | 4025 |
| 367 | Ga0495667_0070898 | 3300046559 | Bacteria | 2273 |
| 368 | Ga0495667_0283225 | 3300046559 | Bacteria | 1052 |
| 369 | Ga0495634_0028217 | 3300046642 | Bacteria | 3897 |
| 370 | Ga0495634_0068413 | 3300046642 | Bacteria | 2346 |
| 371 | Ga0495634_0197656 | 3300046642 | Bacteria | 1250 |
| 372 | Ga0495635_0017038 | 3300046663 | Bacteria | 5075 |
| 373 | Ga0495635_0040109 | 3300046663 | Bacteria | 3236 |
| 374 | Ga0495657_0002580 | 3300046675 | Bacteria | 15174 |
| 375 | Ga0495599_0000016 | 3300046678 | Bacteria | 169605 |
| 376 | Ga0495623_0000046 | 3300046679 | Bacteria | 74571 |
| 377 | Ga0495646_0030936 | 3300046680 | Bacteria | 3340 |
| 378 | Ga0495646_0074684 | 3300046680 | Bacteria | 1989 |
| 379 | Ga0495647_0001614 | 3300046681 | Bacteria | 6959 |
| 380 | Ga0495658_0001696 | 3300046683 | Bacteria | 11445 |
| 381 | Ga0495658_0075836 | 3300046683 | Bacteria | 1963 |
| 382 | Ga0495613_0023808 | 3300046689 | Bacteria | 4562 |
| 383 | Ga0495613_0032662 | 3300046689 | Bacteria | 3867 |
| 384 | Ga0495613_0072674 | 3300046689 | Bacteria | 2507 |
| 385 | Ga0495613_0199166 | 3300046689 | Bacteria | 1412 |
| 386 | Ga0495624_0002088 | 3300046690 | Bacteria | 15229 |
| 387 | Ga0495589_0195954 | 3300046794 | Bacteria | 955 |
| 388 | Ga0495600_0022147 | 3300046809 | Bacteria | 4078 |
| 389 | Ga0495600_0094192 | 3300046809 | Bacteria | 1953 |
| 390 | Ga0495600_0195189 | 3300046809 | Bacteria | 1301 |
| 391 | Ga0495600_0205512 | 3300046809 | Bacteria | 1263 |
| 392 | Ga0495581_0003449 | 3300047315 | Bacteria | 9081 |
| 393 | Ga0495604_0000004 | 3300047317 | Bacteria | 456385 |
| 394 | Ga0495674_0021545 | 3300047319 | Bacteria | 5959 |
| 395 | Ga0495674_0089149 | 3300047319 | Bacteria | 2637 |
| 396 | Ga0495674_0876007 | 3300047319 | Bacteria | 694 |
| 397 | Ga0495676_0002477 | 3300047321 | Bacteria | 16420 |
| 398 | Ga0495676_0386501 | 3300047321 | Bacteria | 930 |
| 399 | Ga0495680_0002487 | 3300047322 | Bacteria | 18843 |
| 400 | Ga0495680_0004330 | 3300047322 | Bacteria | 13597 |
| 401 | Ga0495680_0009560 | 3300047322 | Bacteria | 8711 |
| 402 | Ga0495680_0051255 | 3300047322 | Bacteria | 3224 |
| 403 | Ga0495675_0000079 | 3300047444 | Bacteria | 68947 |
| 404 | Ga0495684_0011237 | 3300047471 | Bacteria | 6919 |
| 405 | Ga0495684_0031240 | 3300047471 | Bacteria | 4088 |
| 406 | Ga0495684_0167091 | 3300047471 | Bacteria | 1638 |
| 407 | Ga0495684_0397962 | 3300047471 | Unclassified | 967 |
| 408 | Ga0495593_0000866 | 3300047673 | Bacteria | 17530 |
| 409 | Ga0495602_0000351 | 3300048088 | Bacteria | 42756 |
| 410 | Ga0495602_0116056 | 3300048088 | Bacteria | 2164 |
| 411 | Ga0495614_0000905 | 3300048089 | Bacteria | 12610 |
| 412 | Ga0496100_0106908 | 3300048903 | Bacteria | 1937 |
| 413 | Ga0496100_0289719 | 3300048903 | Bacteria | 1223 |
| 414 | Ga0496100_0351283 | 3300048903 | Bacteria | 1114 |
| 415 | Ga0496101_0008498 | 3300048904 | Bacteria | 6709 |
| 416 | Ga0496101_0080455 | 3300048904 | Bacteria | 2407 |
| 417 | Ga0496101_0853305 | 3300048904 | Bacteria | 717 |
| 418 | Ga0496102_0010196 | 3300048905 | Bacteria | 8076 |
| 419 | Ga0496102_0026078 | 3300048905 | Bacteria | 5209 |
| 420 | Ga0496102_0106448 | 3300048905 | Bacteria | 2610 |
| 421 | Ga0496103_0033189 | 3300048906 | Bacteria | 3153 |
| 422 | Ga0496103_0066187 | 3300048906 | Bacteria | 2255 |
| 423 | Ga0496103_0304385 | 3300048906 | Bacteria | 1025 |
| 424 | Ga0496104_0140810 | 3300048907 | Bacteria | 2317 |
| 425 | Ga0496105_0015631 | 3300048908 | Bacteria | 6053 |
| 426 | Ga0496105_0345833 | 3300048908 | Bacteria | 1188 |
| 427 | Ga0496105_0353771 | 3300048908 | Unclassified | 1173 |
| 428 | Ga0496106_0007968 | 3300048909 | Bacteria | 7826 |
| 429 | Ga0496106_0008527 | 3300048909 | Bacteria | 7579 |
| 430 | Ga0496106_0149050 | 3300048909 | Unclassified | 1844 |
| 431 | Ga0496106_0476701 | 3300048909 | Bacteria | 1002 |
| 432 | Ga0496107_0001671 | 3300048910 | Bacteria | 13872 |
| 433 | Ga0496107_0002716 | 3300048910 | Bacteria | 11605 |
| 434 | Ga0496107_0103562 | 3300048910 | Bacteria | 2088 |
| 435 | Ga0496107_0151347 | 3300048910 | Bacteria | 1716 |
| 436 | Ga0496107_0221870 | 3300048910 | Bacteria | 1406 |
| 437 | Ga0496107_0332504 | 3300048910 | Bacteria | 1130 |
| 438 | Ga0496107_0646943 | 3300048910 | Bacteria | 779 |
| 439 | Ga0496108_0041055 | 3300048911 | Bacteria | 3860 |
| 440 | Ga0496108_0273870 | 3300048911 | Bacteria | 1469 |
| 441 | Ga0496108_0550471 | 3300048911 | Bacteria | 1006 |
| 442 | Ga0496108_0716893 | 3300048911 | Bacteria | 867 |
| 443 | Ga0496109_0104959 | 3300048912 | Unclassified | 2624 |
| 444 | Ga0496109_0153397 | 3300048912 | Bacteria | 2157 |
| 445 | Ga0496109_0168199 | 3300048912 | Bacteria | 2056 |
| 446 | Ga0496109_0743735 | 3300048912 | Bacteria | 918 |
| 447 | Ga0496110_0044469 | 3300048913 | Bacteria | 3878 |
| 448 | Ga0496110_0106583 | 3300048913 | Bacteria | 2515 |
| 449 | Ga0496110_0177278 | 3300048913 | Bacteria | 1935 |
| 450 | Ga0496111_0026782 | 3300048914 | Bacteria | 4073 |
| 451 | Ga0496111_0039638 | 3300048914 | Bacteria | 3379 |
| 452 | Ga0496112_0011153 | 3300048915 | Bacteria | 8195 |
| 453 | Ga0496112_0020174 | 3300048915 | Bacteria | 6312 |
| 454 | Ga0496112_0033616 | 3300048915 | Bacteria | 4986 |
| 455 | Ga0496112_0042652 | 3300048915 | Bacteria | 4439 |
| 456 | Ga0496112_0103035 | 3300048915 | Bacteria | 2824 |
| 457 | Ga0496112_0163738 | 3300048915 | Bacteria | 2190 |
| 458 | Ga0496112_0295549 | 3300048915 | Bacteria | 1566 |
| 459 | Ga0496112_0690951 | 3300048915 | Unclassified | 949 |
| 460 | Ga0496112_0720711 | 3300048915 | Unclassified | 925 |
| 461 | Ga0496112_0776438 | 3300048915 | Bacteria | 883 |
| 462 | Ga0496113_0362131 | 3300048916 | Bacteria | 1164 |
| 463 | Ga0496113_0800276 | 3300048916 | Bacteria | 749 |
| 464 | Ga0496113_0848292 | 3300048916 | Archaea | 724 |
| 465 | Ga0496114_0003060 | 3300048917 | Bacteria | 12810 |
| 466 | Ga0496114_0020009 | 3300048917 | Bacteria | 5429 |
| 467 | Ga0496114_0033121 | 3300048917 | Bacteria | 4256 |
| 468 | Ga0496114_0116697 | 3300048917 | Bacteria | 2292 |
| 469 | Ga0496114_0608056 | 3300048917 | Bacteria | 964 |
| 470 | Ga0496115_0021438 | 3300048918 | Bacteria | 4992 |
| 471 | Ga0496115_0043733 | 3300048918 | Bacteria | 3572 |
| 472 | Ga0496115_0273610 | 3300048918 | Unclassified | 1387 |
| 473 | Ga0501031_0003678 | 3300049568 | Bacteria | 9864 |
| 474 | Ga0501033_0241462 | 3300049570 | Bacteria | 1281 |
| 475 | Ga0501036_0139206 | 3300049572 | Unclassified | 2048 |
| 476 | Ga0501036_0268197 | 3300049572 | Bacteria | 1429 |
| 477 | Ga0501037_0077719 | 3300049573 | Bacteria | 2408 |
| 478 | Ga0501038_0140574 | 3300049574 | Bacteria | 1975 |
| 479 | Ga0501039_0008508 | 3300049575 | Bacteria | 7824 |
| 480 | Ga0501039_0023446 | 3300049575 | Bacteria | 4737 |
| 481 | Ga0501039_0209284 | 3300049575 | Unclassified | 1534 |
| 482 | Ga0501040_0103933 | 3300049576 | Bacteria | 1983 |
| 483 | Ga0501041_0002266 | 3300049577 | Bacteria | 10878 |
| 484 | Ga0501042_0006144 | 3300049578 | Bacteria | 7785 |
| 485 | Ga0501043_0061616 | 3300049579 | Bacteria | 2946 |
| 486 | Ga0501043_0123399 | 3300049579 | Bacteria | 2031 |
| 487 | Ga0501046_0005369 | 3300049580 | Bacteria | 11457 |
| 488 | Ga0501046_0008523 | 3300049580 | Bacteria | 8929 |
| 489 | Ga0501048_0041015 | 3300049582 | Bacteria | 3316 |
| 490 | Ga0501048_0101442 | 3300049582 | Bacteria | 2030 |
| 491 | Ga0501067_0001089 | 3300049583 | Bacteria | 14641 |
| 492 | Ga0501067_0027151 | 3300049583 | Bacteria | 3172 |
| 493 | Ga0501067_0175336 | 3300049583 | Bacteria | 1194 |
| 494 | Ga0501068_0054040 | 3300049584 | Bacteria | 2433 |
| 495 | Ga0501068_0131396 | 3300049584 | Unclassified | 1565 |
| 496 | Ga0501069_0007329 | 3300049585 | Bacteria | 5789 |
| 497 | Ga0501069_0011706 | 3300049585 | Bacteria | 4651 |
| 498 | Ga0501070_0051547 | 3300049586 | Bacteria | 3416 |
| 499 | Ga0501071_0155981 | 3300049587 | Bacteria | 1704 |
| 500 | Ga0501071_0317234 | 3300049587 | Unclassified | 1183 |
| 501 | Ga0501072_0024115 | 3300049588 | Bacteria | 4729 |
| 502 | Ga0501072_0081132 | 3300049588 | Bacteria | 2571 |
| 503 | Ga0501072_0115095 | 3300049588 | Bacteria | 2141 |
| 504 | Ga0501074_0009862 | 3300049590 | Bacteria | 6937 |
| 505 | Ga0501074_0014444 | 3300049590 | Bacteria | 5746 |
| 506 | Ga0501074_0249982 | 3300049590 | Bacteria | 1261 |
| 507 | Ga0501075_0002405 | 3300049591 | Bacteria | 12439 |
| 508 | Ga0501075_0031056 | 3300049591 | Bacteria | 3962 |
| 509 | Ga0501076_0001810 | 3300049592 | Bacteria | 14505 |
| 510 | Ga0501076_0609840 | 3300049592 | Bacteria | 900 |
| 511 | Ga0501077_0002518 | 3300049593 | Bacteria | 10975 |
| 512 | Ga0501077_0089547 | 3300049593 | Bacteria | 1950 |
| 513 | Ga0501079_0000969 | 3300049741 | Bacteria | 19800 |
| 514 | Ga0501035_0179695 | 3300049822 | Bacteria | 1823 |
| 515 | Ga0501045_0000658 | 3300049824 | Bacteria | 21935 |
| 516 | Ga0501045_0055371 | 3300049824 | Bacteria | 2901 |
| 517 | nmdc:mga05p37_5262_c1 | 3300050507 | Bacteria | 15187 |
| 518 | nmdc:mga05p37_752471_c1 | 3300050507 | Unclassified | 1074 |
| 519 | nmdc:mga0a205_118931_c1 | 3300050515 | Bacteria | 2541 |
| 520 | Ga0495601_0000896 | 3300053077 | Bacteria | 16243 |
| 521 | Ga0495601_0006440 | 3300053077 | Bacteria | 6868 |
| 522 | Ga0495601_0226374 | 3300053077 | Bacteria | 1221 |
| 523 | Ga0495601_0477326 | 3300053077 | Bacteria | 805 |
| 524 | Ga0495612_0021572 | 3300053078 | Bacteria | 2583 |
| 525 | Ga0495595_0006199 | 3300053084 | Bacteria | 4866 |
| 526 | Ga0495595_0024266 | 3300053084 | Bacteria | 2678 |
| 527 | Ga0495619_0000199 | 3300053085 | Bacteria | 43846 |
| 528 | Ga0495619_0019394 | 3300053085 | Bacteria | 4322 |
| 529 | Ga0495619_0293543 | 3300053085 | Unclassified | 1126 |
| 530 | Ga0500566_0283372 | 3300053094 | Bacteria | 788 |
| 531 | Ga0501084_0069667 | 3300054114 | Bacteria | 2945 |
| 532 | Ga0501084_0080041 | 3300054114 | Bacteria | 2739 |
| 533 | Ga0501084_0160072 | 3300054114 | Bacteria | 1899 |
| 534 | Ga0501082_0005040 | 3300060353 | Bacteria | 11518 |
| 535 | Ga0466962_0004475 | 3300061719 | Bacteria | 6699 |
| 536 | Ga0466962_0027520 | 3300061719 | Bacteria | 2728 |
| 537 | Ga0466962_0051936 | 3300061719 | Bacteria | 1960 |
| 538 | Ga0466962_0053860 | 3300061719 | Bacteria | 1922 |
| 539 | Ga0530510_0015624 | 3300061734 | Bacteria | 5364 |
| 540 | Ga0530510_0064428 | 3300061734 | Bacteria | 2654 |
| 541 | Ga0530510_0215992 | 3300061734 | Unclassified | 1425 |
| 542 | Ga0530510_0608094 | 3300061734 | Bacteria | 831 |
| 543 | Ga0163163_10203175 | |||
| 544 | Ga0070658_10009017 | |||
| 545 | Ga0070658_10068850 | |||
| 546 | Ga0070683_100002427 | |||
| 547 | Ga0070683_100556482 | |||
| 548 | Ga0070680_100114449 | |||
| 549 | Ga0070680_100315429 | |||
| 550 | Ga0070660_100057861 | |||
| 551 | Ga0070660_100087713 | |||
| 552 | Ga0070691_10044034 | |||
| 553 | Ga0070687_100052997 | |||
| 554 | Ga0070692_10020665 | |||
| 555 | Ga0070692_10272610 | |||
| 556 | Ga0070674_100156760 | |||
| 557 | Ga0070659_100144505 | |||
| 558 | Ga0070703_10018902 | |||
| 559 | Ga0070709_10037851 | |||
| 560 | Ga0070709_10091773 | |||
| 561 | Ga0070714_100009012 | |||
| 562 | Ga0070714_100079377 | |||
| 563 | Ga0070714_100222906 | |||
| 564 | Ga0070713_100001098 | |||
| 565 | Ga0070713_100038848 | |||
| 566 | Ga0070710_10005679 | |||
| 567 | Ga0070711_100242922 | |||
| 568 | Ga0070711_100362402 | |||
| 569 | Ga0070705_100156163 | |||
| 570 | Ga0070700_100032289 | |||
| 571 | Ga0070694_100008952 | |||
| 572 | Ga0070708_100093723 | |||
| 573 | Ga0070663_100447344 | |||
| 574 | Ga0070678_100162937 | |||
| 575 | Ga0070662_100037003 | |||
| 576 | Ga0070681_10019349 | |||
| 577 | Ga0070681_10097344 | |||
| 578 | Ga0070681_10693538 | |||
| 579 | Ga0068867_100570962 | |||
| 580 | Ga0070707_100000749 | |||
| 581 | Ga0070707_100205788 | |||
| 582 | Ga0070707_100381827 | |||
| 583 | Ga0070679_100027666 | |||
| 584 | Ga0070679_100042702 | |||
| 585 | Ga0070679_100257203 | |||
| 586 | Ga0070679_100393545 | |||
| 587 | Ga0070684_100236451 | |||
| 588 | Ga0070684_100309684 | |||
| 589 | Ga0070684_100371053 | |||
| 590 | Ga0070672_100178069 | |||
| 591 | Ga0070686_100050586 | |||
| 592 | Ga0070686_100060386 | |||
| 593 | Ga0070695_100003203 | |||
| 594 | Ga0070695_100965286 | |||
| 595 | Ga0070693_100044515 | |||
| 596 | Ga0070693_100418837 | |||
| 597 | Ga0070704_100045627 | |||
| 598 | Ga0068855_100019171 | |||
| 599 | Ga0068855_100102195 | |||
| 600 | Ga0068855_100220786 | |||
| 601 | Ga0068855_101396503 | |||
| 602 | Ga0068854_100071306 | |||
| 603 | Ga0068856_100145985 | |||
| 604 | Ga0070702_100029742 | |||
| 605 | Ga0070702_100717155 | |||
| 606 | Ga0068852_100036839 | |||
| 607 | Ga0068852_100053017 | |||
| 608 | Ga0068866_10086096 | |||
| 609 | Ga0068863_100337998 | |||
| 610 | Ga0068863_101266469 | |||
| 611 | Ga0081455_10063697 | |||
| 612 | Ga0070717_10002024 | |||
| 613 | Ga0070717_10023413 | |||
| 614 | Ga0070715_10068393 | |||
| 615 | Ga0070716_100000887 | |||
| 616 | Ga0070712_100186316 | |||
| 617 | Ga0068865_100038506 | |||
| 618 | Ga0068865_100041379 | |||
| 619 | Ga0105240_10039050 | |||
| 620 | Ga0105240_10046296 | |||
| 621 | Ga0105245_10082482 | |||
| 622 | Ga0105245_10225211 | |||
| 623 | Ga0105245_10293047 | |||
| 624 | Ga0105247_10202884 | |||
| 625 | Ga0114129_10011894 | |||
| 626 | Ga0114129_10042966 | |||
| 627 | Ga0105242_10029085 | |||
| 628 | Ga0105242_10031008 | |||
| 629 | Ga0105248_10575473 | |||
| 630 | Ga0105237_10016749 | |||
| 631 | Ga0105237_10491075 | |||
| 632 | Ga0105239_10051457 | |||
| 633 | Ga0105239_10102355 | |||
| 634 | Ga0157373_10441905 | |||
| 635 | Ga0157371_10087104 | |||
| 636 | Ga0157370_10035172 | |||
| 637 | Ga0157370_10369253 | |||
| 638 | Ga0157369_10003856 | |||
| 639 | Ga0157369_10004745 | |||
| 640 | Ga0157369_10036917 | |||
| 641 | Ga0157369_11689488 | |||
| 642 | Ga0157374_10106257 | |||
| 643 | Ga0163162_10098693 | |||
| 644 | Ga0157372_10014906 | |||
| 645 | Ga0157372_10271293 | |||
| 646 | Ga0157372_10408770 | |||
| 647 | Ga0157372_10608653 | |||
| 648 | Ga0157375_10020375 | |||
| 649 | Ga0157375_10036660 | |||
| 650 | Ga0182008_10214083 | |||
| 651 | Ga0157377_10031174 | |||
| 652 | Ga0182006_1111053 | |||
| 653 | Ga0197907_10360204 | |||
| 654 | Ga0206356_10246410 | |||
| 655 | Ga0206356_11202385 | |||
| 656 | Ga0206354_10017572 | |||
| 657 | Ga0206354_10378999 | |||
| 658 | Ga0206354_11247209 | |||
| 659 | Ga0206353_10364087 | |||
| 660 | Ga0206353_10493581 | |||
| 661 | Ga0206353_10784609 | |||
| 662 | Ga0206353_11077977 | |||
| 663 | Ga0207647_10115875 | |||
| 664 | Ga0207685_10010023 | |||
| 665 | Ga0207699_10061518 | |||
| 666 | Ga0207705_10021764 | |||
| 667 | Ga0207707_10038600 | |||
| 668 | Ga0207707_10056252 | |||
| 669 | Ga0207707_10079792 | |||
| 670 | Ga0207707_10093626 | |||
| 671 | Ga0207707_10205086 | |||
| 672 | Ga0207695_10045245 | |||
| 673 | Ga0207695_10146804 | |||
| 674 | Ga0207671_10031005 | |||
| 675 | Ga0207693_10019641 | |||
| 676 | Ga0207693_10544690 | |||
| 677 | Ga0207663_10197815 | |||
| 678 | Ga0207660_10316665 | |||
| 679 | Ga0207662_10043228 | |||
| 680 | Ga0207657_10003291 | |||
| 681 | Ga0207657_10030717 | |||
| 682 | Ga0207657_10198914 | |||
| 683 | Ga0207652_10138191 | |||
| 684 | Ga0207652_10190419 | |||
| 685 | Ga0207652_10287135 | |||
| 686 | Ga0207652_10616095 | |||
| 687 | Ga0207646_10051191 | |||
| 688 | Ga0207687_10103494 | |||
| 689 | Ga0207687_10181252 | |||
| 690 | Ga0207700_10192558 | |||
| 691 | Ga0207664_10081546 | |||
| 692 | Ga0207664_10167730 | |||
| 693 | Ga0207644_10039387 | |||
| 694 | Ga0207644_10152795 | |||
| 695 | Ga0207690_10045841 | |||
| 696 | Ga0207706_10031007 | |||
| 697 | Ga0207706_10054727 | |||
| 698 | Ga0207669_10038470 | |||
| 699 | Ga0207665_10003486 | |||
| 700 | Ga0207691_10211846 | |||
| 701 | Ga0207661_10015788 | |||
| 702 | Ga0207667_10076075 | |||
| 703 | Ga0207667_10091144 | |||
| 704 | Ga0207651_10120768 | |||
| 705 | Ga0207712_10072953 | |||
| 706 | Ga0207677_10248539 | |||
| 707 | Ga0207677_10341522 | |||
| 708 | Ga0207678_10573707 | |||
| 709 | Ga0207708_10012727 | |||
| 710 | Ga0207702_10328971 | |||
| 711 | Ga0207641_11119347 | |||
| 712 | Ga0207648_10012668 | |||
| 713 | Ga0207675_100176226 | |||
| 714 | Ga0207683_10076589 | |||
| 715 | Ga0207683_10300014 | |||
| 716 | Ga0265323_10087312 | |||
| 717 | Ga0265322_10003224 | |||
| 718 | Ga0265338_10043154 | |||
| 719 | Ga0265328_10123118 | |||
| 720 | Ga0265325_10045261 | |||
| 721 | Ga0265340_10018357 | |||
| 722 | Ga0265339_10045257 | |||
| 723 | Ga0265316_10004699 | |||
| 724 | Ga0265313_10007060 | |||
| 725 | Ga0265314_10066576 | |||
| 726 | Ga0307409_100071805 | |||
| 727 | Ga0307416_100062006 | |||
| 728 | Ga0373951_0057952 | |||
| 729 | Ga0373956_0287857 | |||
| 730 | Ga0373943_0108718 | |||
| 731 | Ga0373931_0061703 | |||
| 732 | Ga0373935_0014166 | |||
| 733 | Ga0373927_0165066 | |||
| 734 | Ga0373947_0001659 | |||
| 735 | Ga0373947_0103398 | |||
| 736 | Ga0373937_0001461 | |||
| 737 | Ga0373937_0747976 | |||
| 738 | Ga0373925_0004134 | |||
| 739 | Ga0395899_0035527 | |||
| 740 | Ga0395899_0106153 | |||
| 741 | Ga0395900_0186055 | |||
| 742 | Ga0395900_0364627 | |||
| 743 | Ga0395900_0562148 | |||
| 744 | Ga0395898_0021626 | |||
| 745 | Ga0395898_0104077 | |||
| 746 | Ga0395898_0124506 | |||
| 747 | Ga0395898_0150864 | |||
| 748 | Ga0395898_0293228 | |||
| 749 | Ga0395898_0361849 | |||
| 750 | Ga0395898_0577305 | |||
| 751 | Ga0395905_0062832 | |||
| 752 | Ga0395901_0043049 | |||
| 753 | Ga0395901_0054499 | |||
| 754 | Ga0395901_0357978 | |||
| 755 | Ga0395901_0770187 | |||
| 756 | Ga0439466_0110990 | |||
| 757 | Ga0439465_0039439 | |||
| 758 | Ga0439432_028288 | |||
| 759 | Ga0450907_006322 | |||
| 760 | Ga0450910_022159 | |||
| 761 | Ga0466969_0284762 | |||
| 762 | Ga0466972_0087557 | |||
| 763 | Ga0466965_0125556 | |||
| 764 | Ga0466965_0173609 | |||
| 765 | Ga0466965_0224688 | |||
| 766 | Ga0466966_0017793 | |||
| 767 | Ga0466966_0097261 | |||
| 768 | Ga0466966_0244192 | |||
| 769 | Ga0466961_0011827 | |||
| 770 | Ga0466961_0017835 | |||
| 771 | Ga0466961_0022341 | |||
| 772 | Ga0466961_0045125 | |||
| 773 | Ga0466963_0000400 | |||
| 774 | Ga0466963_0000752 | |||
| 775 | Ga0466963_0001838 | |||
| 776 | Ga0466963_0003853 | |||
| 777 | Ga0466963_0009192 | |||
| 778 | Ga0466963_0025294 | |||
| 779 | Ga0466963_0025676 | |||
| 780 | Ga0466963_0030170 | |||
| 781 | Ga0466963_0060633 | |||
| 782 | Ga0466963_0079639 | |||
| 783 | Ga0466963_0121591 | |||
| 784 | Ga0466963_0244644 | |||
| 785 | Ga0466963_0416576 | |||
| 786 | Ga0466963_0416846 | |||
| 787 | Ga0466964_0001912 | |||
| 788 | Ga0466964_0022215 | |||
| 789 | Ga0466964_0024735 | |||
| 790 | Ga0466964_0029435 | |||
| 791 | Ga0466964_0047700 | |||
| 792 | Ga0466964_0070680 | |||
| 793 | Ga0466964_0168101 | |||
| 794 | Ga0466971_0036428 | |||
| 795 | Ga0466971_0114609 | |||
| 796 | Ga0466971_0119701 | |||
| 797 | Ga0466968_0004057 | |||
| 798 | Ga0466968_0005768 | |||
| 799 | Ga0466968_0081933 | |||
| 800 | Ga0466968_0261321 | |||
| 801 | Ga0466970_0008974 | |||
| 802 | Ga0466970_0041046 | |||
| 803 | Ga0466970_0063407 | |||
| 804 | Ga0466970_0111797 | |||
| 805 | Ga0466957_0005434 | |||
| 806 | Ga0466957_0005656 | |||
| 807 | Ga0466957_0005906 | |||
| 808 | Ga0466957_0023327 | |||
| 809 | Ga0466957_0095753 | |||
| 810 | Ga0466957_0178321 | |||
| 811 | Ga0466957_0179175 | |||
| 812 | Ga0466957_0241041 | |||
| 813 | Ga0466957_0594027 | |||
| 814 | Ga0466957_0621525 | |||
| 815 | Ga0466960_0053571 | |||
| 816 | Ga0466959_0005205 | |||
| 817 | Ga0466959_0010134 | |||
| 818 | Ga0466959_0016759 | |||
| 819 | Ga0466959_0028279 | |||
| 820 | Ga0466959_0077381 | |||
| 821 | Ga0466959_0154727 | |||
| 822 | Ga0466958_0004089 | |||
| 823 | Ga0466958_0006924 | |||
| 824 | Ga0466958_0017282 | |||
| 825 | Ga0466958_0026569 | |||
| 826 | Ga0466958_0027210 | |||
| 827 | Ga0466958_0038544 | |||
| 828 | Ga0466958_0090793 | |||
| 829 | Ga0466958_0275674 | |||
| 830 | Ga0466958_0363178 | |||
| 831 | Ga0466967_0002083 | |||
| 832 | Ga0466967_0002624 | |||
| 833 | Ga0466967_0003633 | |||
| 834 | Ga0466967_0006217 | |||
| 835 | Ga0466967_0006777 | |||
| 836 | Ga0466967_0013645 | |||
| 837 | Ga0466967_0016530 | |||
| 838 | Ga0466967_0019387 | |||
| 839 | Ga0466967_0021549 | |||
| 840 | Ga0466967_0029858 | |||
| 841 | Ga0466967_0032377 | |||
| 842 | Ga0466967_0032674 | |||
| 843 | Ga0466967_0036195 | |||
| 844 | Ga0466967_0046083 | |||
| 845 | Ga0466967_0080331 | |||
| 846 | Ga0466967_0093129 | |||
| 847 | Ga0466967_0120044 | |||
| 848 | Ga0466967_0143918 | |||
| 849 | Ga0466967_0230322 | |||
| 850 | Ga0466967_0303599 | |||
| 851 | Ga0466967_0316554 | |||
| 852 | Ga0466967_0458128 | |||
| 853 | Ga0466967_0754179 | |||
| 854 | Ga0466967_0777110 | |||
| 855 | Ga0466967_1150879 | |||
| 856 | Ga0495592_0000048 | |||
| 857 | Ga0495603_0074044 | |||
| 858 | Ga0495629_0008464 | |||
| 859 | Ga0495629_0040913 | |||
| 860 | Ga0495641_0034701 | |||
| 861 | Ga0495641_0077170 | |||
| 862 | Ga0495651_0000049 | |||
| 863 | Ga0495651_0006492 | |||
| 864 | Ga0495653_0000489 | |||
| 865 | Ga0495653_0015091 | |||
| 866 | Ga0495653_0044965 | |||
| 867 | Ga0495580_0129767 | |||
| 868 | Ga0495582_0012341 | |||
| 869 | Ga0495582_0162572 | |||
| 870 | Ga0495605_0260803 | |||
| 871 | Ga0495639_0011148 | |||
| 872 | Ga0495662_0003087 | |||
| 873 | Ga0495662_0004812 | |||
| 874 | Ga0495664_0013872 | |||
| 875 | Ga0495664_0102468 | |||
| 876 | Ga0495664_0135775 | |||
| 877 | Ga0495664_0367702 | |||
| 878 | Ga0495584_0254534 | |||
| 879 | Ga0495607_0200265 | |||
| 880 | Ga0495608_0003026 | |||
| 881 | Ga0495608_0026243 | |||
| 882 | Ga0495616_0150592 | |||
| 883 | Ga0495618_0007049 | |||
| 884 | Ga0495618_0012943 | |||
| 885 | Ga0495618_0031726 | |||
| 886 | Ga0495628_0000026 | |||
| 887 | Ga0495628_0514278 | |||
| 888 | Ga0495630_0002498 | |||
| 889 | Ga0495630_0003344 | |||
| 890 | Ga0495630_0132189 | |||
| 891 | Ga0495630_0302385 | |||
| 892 | Ga0495630_0574240 | |||
| 893 | Ga0495637_0095149 | |||
| 894 | Ga0495666_0044138 | |||
| 895 | Ga0495666_0085585 | |||
| 896 | Ga0495652_0000172 | |||
| 897 | Ga0495652_0042823 | |||
| 898 | Ga0495652_0238916 | |||
| 899 | Ga0495665_0000302 | |||
| 900 | Ga0495640_0022308 | |||
| 901 | Ga0495640_0044868 | |||
| 902 | Ga0495586_0006885 | |||
| 903 | Ga0495586_0108297 | |||
| 904 | Ga0495587_0000362 | |||
| 905 | Ga0495587_0244074 | |||
| 906 | Ga0495645_0000016 | |||
| 907 | Ga0495645_0163568 | |||
| 908 | Ga0495667_0024995 | |||
| 909 | Ga0495667_0070898 | |||
| 910 | Ga0495667_0283225 | |||
| 911 | Ga0495634_0028217 | |||
| 912 | Ga0495634_0068413 | |||
| 913 | Ga0495634_0197656 | |||
| 914 | Ga0495635_0017038 | |||
| 915 | Ga0495635_0040109 | |||
| 916 | Ga0495657_0002580 | |||
| 917 | Ga0495599_0000016 | |||
| 918 | Ga0495623_0000046 | |||
| 919 | Ga0495646_0030936 | |||
| 920 | Ga0495646_0074684 | |||
| 921 | Ga0495647_0001614 | |||
| 922 | Ga0495658_0001696 | |||
| 923 | Ga0495658_0075836 | |||
| 924 | Ga0495613_0023808 | |||
| 925 | Ga0495613_0032662 | |||
| 926 | Ga0495613_0072674 | |||
| 927 | Ga0495613_0199166 | |||
| 928 | Ga0495624_0002088 | |||
| 929 | Ga0495589_0195954 | |||
| 930 | Ga0495600_0022147 | |||
| 931 | Ga0495600_0094192 | |||
| 932 | Ga0495600_0195189 | |||
| 933 | Ga0495600_0205512 | |||
| 934 | Ga0495581_0003449 | |||
| 935 | Ga0495604_0000004 | |||
| 936 | Ga0495674_0021545 | |||
| 937 | Ga0495674_0089149 | |||
| 938 | Ga0495674_0876007 | |||
| 939 | Ga0495676_0002477 | |||
| 940 | Ga0495676_0386501 | |||
| 941 | Ga0495680_0002487 | |||
| 942 | Ga0495680_0004330 | |||
| 943 | Ga0495680_0009560 | |||
| 944 | Ga0495680_0051255 | |||
| 945 | Ga0495675_0000079 | |||
| 946 | Ga0495684_0011237 | |||
| 947 | Ga0495684_0031240 | |||
| 948 | Ga0495684_0167091 | |||
| 949 | Ga0495684_0397962 | |||
| 950 | Ga0495593_0000866 | |||
| 951 | Ga0495602_0000351 | |||
| 952 | Ga0495602_0116056 | |||
| 953 | Ga0495614_0000905 | |||
| 954 | Ga0496100_0106908 | |||
| 955 | Ga0496100_0289719 | |||
| 956 | Ga0496100_0351283 | |||
| 957 | Ga0496101_0008498 | |||
| 958 | Ga0496101_0080455 | |||
| 959 | Ga0496101_0853305 | |||
| 960 | Ga0496102_0010196 | |||
| 961 | Ga0496102_0026078 | |||
| 962 | Ga0496102_0106448 | |||
| 963 | Ga0496103_0033189 | |||
| 964 | Ga0496103_0066187 | |||
| 965 | Ga0496103_0304385 | |||
| 966 | Ga0496104_0140810 | |||
| 967 | Ga0496105_0015631 | |||
| 968 | Ga0496105_0345833 | |||
| 969 | Ga0496105_0353771 | |||
| 970 | Ga0496106_0007968 | |||
| 971 | Ga0496106_0008527 | |||
| 972 | Ga0496106_0149050 | |||
| 973 | Ga0496106_0476701 | |||
| 974 | Ga0496107_0001671 | |||
| 975 | Ga0496107_0002716 | |||
| 976 | Ga0496107_0103562 | |||
| 977 | Ga0496107_0151347 | |||
| 978 | Ga0496107_0221870 | |||
| 979 | Ga0496107_0332504 | |||
| 980 | Ga0496107_0646943 | |||
| 981 | Ga0496108_0041055 | |||
| 982 | Ga0496108_0273870 | |||
| 983 | Ga0496108_0550471 | |||
| 984 | Ga0496108_0716893 | |||
| 985 | Ga0496109_0104959 | |||
| 986 | Ga0496109_0153397 | |||
| 987 | Ga0496109_0168199 | |||
| 988 | Ga0496109_0743735 | |||
| 989 | Ga0496110_0044469 | |||
| 990 | Ga0496110_0106583 | |||
| 991 | Ga0496110_0177278 | |||
| 992 | Ga0496111_0026782 | |||
| 993 | Ga0496111_0039638 | |||
| 994 | Ga0496112_0011153 | |||
| 995 | Ga0496112_0020174 | |||
| 996 | Ga0496112_0033616 | |||
| 997 | Ga0496112_0042652 | |||
| 998 | Ga0496112_0103035 | |||
| 999 | Ga0496112_0163738 | |||
| 1000 | Ga0496112_0295549 | |||
| 1001 | Ga0496112_0690951 | |||
| 1002 | Ga0496112_0720711 | |||
| 1003 | Ga0496112_0776438 | |||
| 1004 | Ga0496113_0362131 | |||
| 1005 | Ga0496113_0800276 | |||
| 1006 | Ga0496113_0848292 | |||
| 1007 | Ga0496114_0003060 | |||
| 1008 | Ga0496114_0020009 | |||
| 1009 | Ga0496114_0033121 | |||
| 1010 | Ga0496114_0116697 | |||
| 1011 | Ga0496114_0608056 | |||
| 1012 | Ga0496115_0021438 | |||
| 1013 | Ga0496115_0043733 | |||
| 1014 | Ga0496115_0273610 | |||
| 1015 | Ga0501031_0003678 | |||
| 1016 | Ga0501033_0241462 | |||
| 1017 | Ga0501036_0139206 | |||
| 1018 | Ga0501036_0268197 | |||
| 1019 | Ga0501037_0077719 | |||
| 1020 | Ga0501038_0140574 | |||
| 1021 | Ga0501039_0008508 | |||
| 1022 | Ga0501039_0023446 | |||
| 1023 | Ga0501039_0209284 | |||
| 1024 | Ga0501040_0103933 | |||
| 1025 | Ga0501041_0002266 | |||
| 1026 | Ga0501042_0006144 | |||
| 1027 | Ga0501043_0061616 | |||
| 1028 | Ga0501043_0123399 | |||
| 1029 | Ga0501046_0005369 | |||
| 1030 | Ga0501046_0008523 | |||
| 1031 | Ga0501048_0041015 | |||
| 1032 | Ga0501048_0101442 | |||
| 1033 | Ga0501067_0001089 | |||
| 1034 | Ga0501067_0027151 | |||
| 1035 | Ga0501067_0175336 | |||
| 1036 | Ga0501068_0054040 | |||
| 1037 | Ga0501068_0131396 | |||
| 1038 | Ga0501069_0007329 | |||
| 1039 | Ga0501069_0011706 | |||
| 1040 | Ga0501070_0051547 | |||
| 1041 | Ga0501071_0155981 | |||
| 1042 | Ga0501071_0317234 | |||
| 1043 | Ga0501072_0024115 | |||
| 1044 | Ga0501072_0081132 | |||
| 1045 | Ga0501072_0115095 | |||
| 1046 | Ga0501074_0009862 | |||
| 1047 | Ga0501074_0014444 | |||
| 1048 | Ga0501074_0249982 | |||
| 1049 | Ga0501075_0002405 | |||
| 1050 | Ga0501075_0031056 | |||
| 1051 | Ga0501076_0001810 | |||
| 1052 | Ga0501076_0609840 | |||
| 1053 | Ga0501077_0002518 | |||
| 1054 | Ga0501077_0089547 | |||
| 1055 | Ga0501079_0000969 | |||
| 1056 | Ga0501035_0179695 | |||
| 1057 | Ga0501045_0000658 | |||
| 1058 | Ga0501045_0055371 | |||
| 1059 | nmdc:mga05p37_5262_c1 | |||
| 1060 | nmdc:mga05p37_752471_c1 | |||
| 1061 | nmdc:mga0a205_118931_c1 | |||
| 1062 | Ga0495601_0000896 | |||
| 1063 | Ga0495601_0006440 | |||
| 1064 | Ga0495601_0226374 | |||
| 1065 | Ga0495601_0477326 | |||
| 1066 | Ga0495612_0021572 | |||
| 1067 | Ga0495595_0006199 | |||
| 1068 | Ga0495595_0024266 | |||
| 1069 | Ga0495619_0000199 | |||
| 1070 | Ga0495619_0019394 | |||
| 1071 | Ga0495619_0293543 | |||
| 1072 | Ga0500566_0283372 | |||
| 1073 | Ga0501084_0069667 | |||
| 1074 | Ga0501084_0080041 | |||
| 1075 | Ga0501084_0160072 | |||
| 1076 | Ga0501082_0005040 | |||
| 1077 | Ga0466962_0004475 | |||
| 1078 | Ga0466962_0027520 | |||
| 1079 | Ga0466962_0051936 | |||
| 1080 | Ga0466962_0053860 | |||
| 1081 | Ga0530510_0015624 | |||
| 1082 | Ga0530510_0064428 | |||
| 1083 | Ga0530510_0215992 | |||
| 1084 | Ga0530510_0608094 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3vpr-assembly2.cif.gz_C | crystal structure of a tetr family transcriptional regulator pfmr from thermus thermophilus hb8 | 0.8671 | 15 | 198 |
| 3vpr-assembly2.cif.gz_C | crystal structure of a tetr family transcriptional regulator pfmr from thermus thermophilus hb8 | 0.854 | 15 | 198 |
| 3lhq-assembly1.cif.gz_B | dna-binding transcriptional repressor acrr from salmonella typhimurium. | 0.8449 | 10 | 193 |
| 5mym-assembly2.cif.gz_C | structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with compound gsk2032710a at 2.28a resolution | 0.8434 | 9 | 191 |
| 3f1b-assembly1.cif.gz_A-2 | the crystal structure of a tetr-like transcriptional regulator from rhodococcus sp. rha1. | 0.8394 | 11 | 191 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3whbA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 1.004 | 10 | 53 | 1.10.10.60 |
| 3whcD01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 1.003 | 11 | 53 | 1.10.10.60 |
| 1vi0B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9994 | 15 | 53 | 1.10.10.60 |
| 5gpaA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9965 | 11 | 53 | 1.10.10.60 |
| 3whcC01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9934 | 10 | 53 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538MU75-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.929 | 2 | 198 |
GO:0000976
GO:0003700 |
| AF-A0A7W0U8P0-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.9286 | 2 | 195 |
GO:0000976
GO:0003700 |
| AF-A0A538JXR9-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.9262 | 1 | 198 |
GO:0000976
GO:0003700 |
| AF-A0A7C2NB36-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.925 | 4 | 195 |
GO:0000976
GO:0003700 |
| AF-A0A3A0FC21-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.9238 | 1 | 195 |
GO:0000976
GO:0003700 |