F461468

General Info

Members Datasets Scaffolds Average Seq Length
542 250 1084 68

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10205177|Ga0081538_102051772
Length 63
Sequence MTYVIAGSCIKDDSCIEVCPVDCIHPKPGAPDFETAEQLKYDYALELNAQFFAERSTAERTAA

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
152 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
153 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
154 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
155 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
156 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
157 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
172 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
173 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
174 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
175 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
176 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
177 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
178 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
179 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
180 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
181 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
182 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
194 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
195 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
196 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
200 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
227 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
238 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 8.12
Rhizosphere 90.41
Stem 0
Stem Tuber 0
Unclassified 1.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10205177 3300005981 Bacteria 803
2 JGI24737J22298_10159985 3300001990 Bacteria 665
3 JGI24743J22301_10008825 3300001991 Bacteria 1776
4 JGI24735J21928_10162046 3300002067 Bacteria 646
5 JGI24738J21930_10087502 3300002075 Bacteria 656
6 JGI24738J21930_10102184 3300002075 Bacteria 612
7 JGI24744J21845_10104299 3300002077 Bacteria 524
8 JGI24742J22300_10130370 3300002244 Bacteria 501
9 JGI25406J46586_10004944 3300003203 Bacteria 6190
10 JGI25407J50210_10115794 3300003373 Bacteria 661
11 Ga0070658_11266277 3300005327 Bacteria 641
12 Ga0070676_10148377 3300005328 Bacteria 1499
13 Ga0070690_100316724 3300005330 Bacteria 1123
14 Ga0070666_11081258 3300005335 Bacteria 596
15 Ga0070680_101028289 3300005336 Bacteria 712
16 Ga0070680_101448989 3300005336 Bacteria 595
17 Ga0070682_100129037 3300005337 Bacteria 1709
18 Ga0070682_101493141 3300005337 Bacteria 581
19 Ga0070682_101804706 3300005337 Bacteria 534
20 Ga0070682_101890135 3300005337 Bacteria 523
21 Ga0068868_100072847 3300005338 Bacteria 2741
22 Ga0068868_100096562 3300005338 Bacteria 2387
23 Ga0068868_100413022 3300005338 Bacteria 1167
24 Ga0070689_100046183 3300005340 Bacteria 3355
25 Ga0070689_100476138 3300005340 Bacteria 1066
26 Ga0070691_10763555 3300005341 Bacteria 586
27 Ga0070691_10908471 3300005341 Bacteria 543
28 Ga0070687_100063024 3300005343 Bacteria 1965
29 Ga0070661_101457799 3300005344 Bacteria 577
30 Ga0070692_10059327 3300005345 Bacteria 2011
31 Ga0070692_10089281 3300005345 Bacteria 1673
32 Ga0070668_100007911 3300005347 Bacteria 7894
33 Ga0070668_100403391 3300005347 Bacteria 1168
34 Ga0070668_100690006 3300005347 Bacteria 900
35 Ga0070669_100064888 3300005353 Bacteria 2689
36 Ga0070669_100412883 3300005353 Bacteria 1107
37 Ga0070671_100252901 3300005355 Bacteria 1497
38 Ga0070671_101898246 3300005355 Bacteria 530
39 Ga0070674_100052909 3300005356 Bacteria 2802
40 Ga0070674_100168092 3300005356 Bacteria 1670
41 Ga0070674_102077731 3300005356 Bacteria 518
42 Ga0070688_100133364 3300005365 Bacteria 1679
43 Ga0070688_100782619 3300005365 Bacteria 745
44 Ga0070659_100047733 3300005366 Bacteria 3360
45 Ga0070667_101557743 3300005367 Bacteria 621
46 Ga0070667_102149482 3300005367 Bacteria 526
47 Ga0070701_10062491 3300005438 Bacteria 1968
48 Ga0070700_100215775 3300005441 Bacteria 1356
49 Ga0070700_100733827 3300005441 Bacteria 789
50 Ga0070694_101911412 3300005444 Bacteria 507
51 Ga0070663_101299564 3300005455 Bacteria 642
52 Ga0070678_100203557 3300005456 Bacteria 1635
53 Ga0070662_100413472 3300005457 Bacteria 1115
54 Ga0070662_100538828 3300005457 Bacteria 977
55 Ga0070681_10784221 3300005458 Bacteria 870
56 Ga0068867_100491191 3300005459 Bacteria 1053
57 Ga0070685_10122167 3300005466 Bacteria 1618
58 Ga0070679_100802236 3300005530 Bacteria 885
59 Ga0070684_100723334 3300005535 Bacteria 929
60 Ga0070684_101414853 3300005535 Bacteria 655
61 Ga0068853_100586636 3300005539 Bacteria 1058
62 Ga0068853_102502565 3300005539 Bacteria 500
63 Ga0070686_100372944 3300005544 Bacteria 1078
64 Ga0070686_100640288 3300005544 Bacteria 842
65 Ga0070686_100846078 3300005544 Bacteria 740
66 Ga0070686_101348291 3300005544 Bacteria 597
67 Ga0070686_101579292 3300005544 Bacteria 555
68 Ga0070695_100991812 3300005545 Bacteria 683
69 Ga0070693_100123846 3300005547 Bacteria 1607
70 Ga0070693_100296886 3300005547 Bacteria 1088
71 Ga0070664_100289125 3300005564 Bacteria 1479
72 Ga0068857_100775026 3300005577 Bacteria 915
73 Ga0068857_101853153 3300005577 Bacteria 591
74 Ga0068854_100068630 3300005578 Bacteria 2586
75 Ga0068854_100130777 3300005578 Bacteria 1916
76 Ga0068854_100201769 3300005578 Bacteria 1564
77 Ga0068854_101538885 3300005578 Bacteria 605
78 Ga0068854_101554345 3300005578 Bacteria 602
79 Ga0068856_102113991 3300005614 Bacteria 572
80 Ga0070702_100110837 3300005615 Bacteria 1701
81 Ga0070702_100570016 3300005615 Bacteria 844
82 Ga0068852_100035549 3300005616 Bacteria 4158
83 Ga0068852_100268543 3300005616 Bacteria 1641
84 Ga0068859_100036222 3300005617 Bacteria 4953
85 Ga0068864_100631220 3300005618 Bacteria 1042
86 Ga0068864_100717441 3300005618 Bacteria 978
87 Ga0068866_10059904 3300005718 Bacteria 1972
88 Ga0068861_100009315 3300005719 Bacteria 6776
89 Ga0068861_100062645 3300005719 Bacteria 2857
90 Ga0068861_100192020 3300005719 Bacteria 1708
91 Ga0068861_100796160 3300005719 Bacteria 887
92 Ga0068861_101479884 3300005719 Bacteria 666
93 Ga0068851_10425219 3300005834 Bacteria 785
94 Ga0068870_10231240 3300005840 Bacteria 1137
95 Ga0068870_10322696 3300005840 Bacteria 982
96 Ga0068863_100691158 3300005841 Bacteria 1014
97 Ga0068858_100508259 3300005842 Bacteria 1164
98 Ga0068858_100552774 3300005842 Bacteria 1114
99 Ga0068860_100299213 3300005843 Bacteria 1576
100 Ga0068860_101742852 3300005843 Bacteria 645
101 Ga0081455_10003758 3300005937 Bacteria 17335
102 Ga0081455_10064656 3300005937 Bacteria 3062
103 Ga0081455_10224008 3300005937 Bacteria 1392
104 Ga0081455_10423855 3300005937 Bacteria 917
105 Ga0081538_10000126 3300005981 Bacteria 77929
106 Ga0081538_10008051 3300005981 Bacteria 9009
107 Ga0081538_10012427 3300005981 Bacteria 6823
108 Ga0081538_10013509 3300005981 Bacteria 6458
109 Ga0081538_10017851 3300005981 Bacteria 5361
110 Ga0081538_10021840 3300005981 Bacteria 4656
111 Ga0081538_10022410 3300005981 Bacteria 4577
112 Ga0081538_10066422 3300005981 Bacteria 2022
113 Ga0081538_10308645 3300005981 Bacteria 579
114 Ga0081538_10377793 3300005981 Bacteria 511
115 Ga0081539_10001486 3300005985 Bacteria 39689
116 Ga0081539_10011379 3300005985 Bacteria 7042
117 Ga0075363_100376291 3300006048 Bacteria 832
118 Ga0075432_10365614 3300006058 Bacteria 615
119 Ga0070716_101011040 3300006173 Bacteria 658
120 Ga0075428_100029656 3300006844 Bacteria 6053
121 Ga0075428_100098023 3300006844 Bacteria 3196
122 Ga0075428_100845827 3300006844 Bacteria 972
123 Ga0075430_100619656 3300006846 Bacteria 893
124 Ga0075431_100429861 3300006847 Bacteria 1319
125 Ga0075431_101182225 3300006847 Unclassified 728
126 Ga0075433_10222960 3300006852 Bacteria 1675
127 Ga0075433_10553984 3300006852 Bacteria 1011
128 Ga0075434_100045857 3300006871 Bacteria 4337
129 Ga0075434_101956165 3300006871 Bacteria 592
130 Ga0075429_100304034 3300006880 Bacteria 1397
131 Ga0075429_100831229 3300006880 Bacteria 809
132 Ga0075429_101089657 3300006880 Bacteria 698
133 Ga0068865_100167869 3300006881 Bacteria 1679
134 Ga0068865_100230519 3300006881 Bacteria 1453
135 Ga0068865_101250348 3300006881 Bacteria 659
136 Ga0075436_100027197 3300006914 Bacteria 3937
137 Ga0097620_100036222 3300006931 Bacteria 4953
138 Ga0075435_100043519 3300007076 Bacteria 3594
139 Ga0075435_102016577 3300007076 Bacteria 507
140 Ga0111539_10005603 3300009094 Bacteria 16241
141 Ga0111539_10047099 3300009094 Bacteria 5155
142 Ga0111539_10144155 3300009094 Bacteria 2788
143 Ga0111539_10439754 3300009094 Bacteria 1519
144 Ga0111539_11085289 3300009094 Bacteria 930
145 Ga0111539_11600482 3300009094 Bacteria 755
146 Ga0111539_12325569 3300009094 Bacteria 622
147 Ga0105245_10000364 3300009098 Bacteria 42393
148 Ga0105245_10888430 3300009098 Bacteria 932
149 Ga0105245_10961076 3300009098 Bacteria 898
150 Ga0105245_12200304 3300009098 Bacteria 605
151 Ga0105247_10014385 3300009101 Bacteria 4748
152 Ga0114129_10014555 3300009147 Bacteria 11209
153 Ga0114129_10145378 3300009147 Bacteria 3248
154 Ga0114129_10776118 3300009147 Bacteria 1225
155 Ga0114129_10793102 3300009147 Bacteria 1209
156 Ga0114129_10834057 3300009147 Bacteria 1173
157 Ga0114129_11280979 3300009147 Bacteria 909
158 Ga0114129_12736631 3300009147 Bacteria 587
159 Ga0105243_10065073 3300009148 Bacteria 2927
160 Ga0105243_10267657 3300009148 Bacteria 1533
161 Ga0105243_10416693 3300009148 Bacteria 1251
162 Ga0105243_10549184 3300009148 Bacteria 1103
163 Ga0105243_11200813 3300009148 Bacteria 772
164 Ga0105243_11465476 3300009148 Bacteria 705
165 Ga0105241_11172463 3300009174 Bacteria 726
166 Ga0105241_11179531 3300009174 Bacteria 724
167 Ga0105241_12348525 3300009174 Bacteria 531
168 Ga0105242_10093353 3300009176 Bacteria 2537
169 Ga0105242_10107612 3300009176 Bacteria 2372
170 Ga0105242_12064720 3300009176 Bacteria 613
171 Ga0105248_10460421 3300009177 Bacteria 1434
172 Ga0105248_11059091 3300009177 Bacteria 916
173 Ga0105237_10416569 3300009545 Bacteria 1349
174 Ga0105238_11084642 3300009551 Bacteria 823
175 Ga0105238_11538012 3300009551 Bacteria 694
176 Ga0105249_10012387 3300009553 Bacteria 7516
177 Ga0105249_10080805 3300009553 Bacteria 3021
178 Ga0105249_10089354 3300009553 Bacteria 2879
179 Ga0105249_10404717 3300009553 Bacteria 1396
180 Ga0105249_11654569 3300009553 Bacteria 713
181 Ga0105249_12408342 3300009553 Bacteria 599
182 Ga0105239_10090351 3300010375 Bacteria 3379
183 Ga0105239_11499061 3300010375 Bacteria 779
184 Ga0105239_11720584 3300010375 Bacteria 726
185 Ga0105239_13498493 3300010375 Bacteria 510
186 Ga0105246_10571330 3300011119 Bacteria 972
187 Ga0105246_10837760 3300011119 Bacteria 819
188 Ga0105246_11800099 3300011119 Bacteria 585
189 Ga0157371_11188688 3300013102 Bacteria 587
190 Ga0157374_11190293 3300013296 Bacteria 783
191 Ga0157378_11485824 3300013297 Bacteria 722
192 Ga0157378_12892149 3300013297 Bacteria 532
193 Ga0163162_10269740 3300013306 Bacteria 1833
194 Ga0163162_10444015 3300013306 Bacteria 1429
195 Ga0163162_10777211 3300013306 Bacteria 1076
196 Ga0157372_10178666 3300013307 Bacteria 2457
197 Ga0157372_11273973 3300013307 Bacteria 849
198 Ga0157372_12561388 3300013307 Bacteria 585
199 Ga0157375_10138618 3300013308 Bacteria 2558
200 Ga0157375_10867649 3300013308 Bacteria 1048
201 Ga0157375_11254475 3300013308 Bacteria 870
202 Ga0157375_12499898 3300013308 Bacteria 617
203 Ga0163163_10299492 3300014325 Bacteria 1661
204 Ga0163163_10333676 3300014325 Bacteria 1571
205 Ga0157380_10240652 3300014326 Bacteria 1631
206 Ga0157380_10387452 3300014326 Bacteria 1321
207 Ga0157380_10881568 3300014326 Bacteria 919
208 Ga0157377_10232417 3300014745 Bacteria 1186
209 Ga0157377_10292128 3300014745 Bacteria 1072
210 Ga0157377_11285408 3300014745 Bacteria 571
211 Ga0163161_11832289 3300017792 Bacteria 540
212 Ga0213873_10005365 3300021358 Bacteria 2456
213 Ga0213875_10368835 3300021388 Unclassified 683
214 Ga0207642_10023299 3300025899 Bacteria 2471
215 Ga0207642_10750806 3300025899 Bacteria 618
216 Ga0207710_10186091 3300025900 Bacteria 1021
217 Ga0207688_10038905 3300025901 Bacteria 2641
218 Ga0207688_10042054 3300025901 Bacteria 2543
219 Ga0207688_10062735 3300025901 Bacteria 2095
220 Ga0207688_10154520 3300025901 Bacteria 1357
221 Ga0207647_10362346 3300025904 Bacteria 820
222 Ga0207654_10954599 3300025911 Bacteria 623
223 Ga0207707_10998367 3300025912 Bacteria 687
224 Ga0207660_11645306 3300025917 Bacteria 517
225 Ga0207662_10277888 3300025918 Bacteria 1107
226 Ga0207657_10062270 3300025919 Bacteria 3195
227 Ga0207681_10056824 3300025923 Bacteria 2671
228 Ga0207681_11318875 3300025923 Bacteria 606
229 Ga0207681_11632114 3300025923 Bacteria 539
230 Ga0207650_10372575 3300025925 Bacteria 1178
231 Ga0207650_11103682 3300025925 Bacteria 675
232 Ga0207687_10110436 3300025927 Bacteria 2039
233 Ga0207644_10253577 3300025931 Bacteria 1405
234 Ga0207690_10058748 3300025932 Bacteria 2603
235 Ga0207690_11106979 3300025932 Bacteria 660
236 Ga0207706_10002947 3300025933 Bacteria 16436
237 Ga0207706_10140471 3300025933 Bacteria 2125
238 Ga0207706_10901980 3300025933 Bacteria 746
239 Ga0207686_10031435 3300025934 Bacteria 3152
240 Ga0207686_11579537 3300025934 Bacteria 542
241 Ga0207709_10050503 3300025935 Bacteria 2544
242 Ga0207709_10254132 3300025935 Bacteria 1285
243 Ga0207670_10072832 3300025936 Bacteria 2380
244 Ga0207704_10082833 3300025938 Bacteria 2080
245 Ga0207704_10184377 3300025938 Bacteria 1511
246 Ga0207665_10798760 3300025939 Bacteria 745
247 Ga0207691_10403047 3300025940 Bacteria 1166
248 Ga0207711_10676523 3300025941 Bacteria 963
249 Ga0207712_10087236 3300025961 Bacteria 2288
250 Ga0207712_10124444 3300025961 Bacteria 1956
251 Ga0207712_10240098 3300025961 Bacteria 1459
252 Ga0207712_10428825 3300025961 Bacteria 1117
253 Ga0207668_10047788 3300025972 Bacteria 2932
254 Ga0207668_10345639 3300025972 Bacteria 1242
255 Ga0207668_11429080 3300025972 Bacteria 624
256 Ga0207668_11623239 3300025972 Bacteria 584
257 Ga0207668_11777676 3300025972 Bacteria 556
258 Ga0207640_10093294 3300025981 Bacteria 2091
259 Ga0207640_10254831 3300025981 Bacteria 1364
260 Ga0207640_10460822 3300025981 Bacteria 1050
261 Ga0207677_10246655 3300026023 Bacteria 1448
262 Ga0207677_10276935 3300026023 Bacteria 1375
263 Ga0207677_10391770 3300026023 Bacteria 1175
264 Ga0207677_10425943 3300026023 Bacteria 1131
265 Ga0207703_10262517 3300026035 Bacteria 1561
266 Ga0207703_10331503 3300026035 Bacteria 1396
267 Ga0207639_10092975 3300026041 Bacteria 2417
268 Ga0207639_10725256 3300026041 Bacteria 923
269 Ga0207678_10507295 3300026067 Bacteria 1052
270 Ga0207708_10006994 3300026075 Bacteria 8342
271 Ga0207708_10012116 3300026075 Bacteria 6429
272 Ga0207708_11101530 3300026075 Bacteria 692
273 Ga0207702_10116261 3300026078 Bacteria 2387
274 Ga0207641_10396903 3300026088 Bacteria 1324
275 Ga0207648_10157196 3300026089 Bacteria 2007
276 Ga0207648_10220645 3300026089 Bacteria 1685
277 Ga0207648_11171630 3300026089 Bacteria 721
278 Ga0207676_10135080 3300026095 Bacteria 2103
279 Ga0207676_10231552 3300026095 Bacteria 1652
280 Ga0207676_10388723 3300026095 Bacteria 1301
281 Ga0207676_11444864 3300026095 Bacteria 684
282 Ga0207674_10013112 3300026116 Bacteria 9224
283 Ga0207674_10289982 3300026116 Bacteria 1585
284 Ga0207674_10611690 3300026116 Bacteria 1052
285 Ga0207675_100002818 3300026118 Bacteria 17096
286 Ga0207675_100014057 3300026118 Bacteria 7466
287 Ga0207675_100115134 3300026118 Bacteria 2540
288 Ga0207675_101493674 3300026118 Bacteria 696
289 Ga0207683_10119806 3300026121 Bacteria 2361
290 Ga0207683_11404194 3300026121 Bacteria 645
291 Ga0207698_10095626 3300026142 Bacteria 2446
292 Ga0207698_10247893 3300026142 Bacteria 1628
293 Ga0207698_11231484 3300026142 Bacteria 763
294 Ga0209998_10164786 3300027717 Bacteria 573
295 Ga0207428_10119144 3300027907 Bacteria 2026
296 Ga0207428_10146156 3300027907 Bacteria 1802
297 Ga0207428_10689579 3300027907 Bacteria 731
298 Ga0207428_11315228 3300027907 Bacteria 501
299 Ga0307408_100042386 3300031548 Bacteria 3233
300 Ga0307408_101190814 3300031548 Bacteria 710
301 Ga0307405_10324568 3300031731 Bacteria 1177
302 Ga0307405_10418375 3300031731 Bacteria 1054
303 Ga0307405_10547007 3300031731 Bacteria 936
304 Ga0307405_10652326 3300031731 Bacteria 866
305 Ga0307405_11268978 3300031731 Bacteria 640
306 Ga0307413_10072254 3300031824 Bacteria 2177
307 Ga0307413_10318861 3300031824 Bacteria 1186
308 Ga0307413_10854884 3300031824 Bacteria 769
309 Ga0307413_11422825 3300031824 Bacteria 610
310 Ga0307410_10097221 3300031852 Bacteria 2103
311 Ga0307410_10199200 3300031852 Bacteria 1528
312 Ga0307410_10812333 3300031852 Bacteria 796
313 Ga0307410_11414820 3300031852 Bacteria 611
314 Ga0307406_10003973 3300031901 Bacteria 8041
315 Ga0307406_10150511 3300031901 Bacteria 1659
316 Ga0307406_10285633 3300031901 Bacteria 1261
317 Ga0307406_10373279 3300031901 Bacteria 1122
318 Ga0307406_10531982 3300031901 Bacteria 958
319 Ga0307406_10580283 3300031901 Bacteria 922
320 Ga0307406_10659670 3300031901 Bacteria 869
321 Ga0307407_10011959 3300031903 Bacteria 4154
322 Ga0307407_10027380 3300031903 Bacteria 3033
323 Ga0307407_10353122 3300031903 Bacteria 1042
324 Ga0307407_11000859 3300031903 Bacteria 646
325 Ga0307407_11003240 3300031903 Bacteria 645
326 Ga0307407_11236035 3300031903 Bacteria 584
327 Ga0307407_11387948 3300031903 Bacteria 553
328 Ga0307412_10862567 3300031911 Bacteria 791
329 Ga0307412_11421186 3300031911 Bacteria 628
330 Ga0307412_11729010 3300031911 Bacteria 574
331 Ga0307409_100004137 3300031995 Bacteria 8072
332 Ga0307409_100058247 3300031995 Bacteria 2999
333 Ga0307409_100070477 3300031995 Bacteria 2775
334 Ga0307409_100191801 3300031995 Bacteria 1819
335 Ga0307409_101300822 3300031995 Bacteria 752
336 Ga0307409_101347606 3300031995 Bacteria 739
337 Ga0307409_102949194 3300031995 Bacteria 502
338 Ga0307416_100009929 3300032002 Bacteria 6262
339 Ga0307416_100066617 3300032002 Bacteria 2966
340 Ga0307416_100091703 3300032002 Bacteria 2610
341 Ga0307416_100253804 3300032002 Bacteria 1714
342 Ga0307416_100289250 3300032002 Bacteria 1621
343 Ga0307416_101335256 3300032002 Bacteria 823
344 Ga0307416_101702903 3300032002 Bacteria 735
345 Ga0307416_102465290 3300032002 Archaea 619
346 Ga0307416_102896283 3300032002 Bacteria 574
347 Ga0307416_102987908 3300032002 Bacteria 566
348 Ga0307414_10092146 3300032004 Bacteria 2255
349 Ga0307414_10176902 3300032004 Bacteria 1712
350 Ga0307414_10227432 3300032004 Bacteria 1536
351 Ga0307411_10146821 3300032005 Bacteria 1747
352 Ga0307411_10800806 3300032005 Bacteria 830
353 Ga0307411_11134884 3300032005 Bacteria 706
354 Ga0307411_11771710 3300032005 Bacteria 573
355 Ga0307415_100357090 3300032126 Bacteria 1232
356 Ga0307415_100366179 3300032126 Bacteria 1219
357 Ga0307415_100624458 3300032126 Bacteria 962
358 Ga0307415_101354378 3300032126 Bacteria 676
359 Ga0307415_102269251 3300032126 Bacteria 532
360 Ga0373958_0109027 3300034819 Bacteria 658
361 Ga0373959_0009427 3300034820 Bacteria 1684
362 Ga0373938_0253216 3300034957 Bacteria 504
363 Ga0373940_0048770 3300035088 Bacteria 1184
364 Ga0373949_0015212 3300035090 Bacteria 1717
365 Ga0373932_0376777 3300035112 Bacteria 545
366 Ga0373939_0287315 3300035114 Bacteria 651
367 Ga0373960_0045848 3300035121 Bacteria 1281
368 Ga0373943_0631133 3300035170 Bacteria 632
369 Ga0373962_0085879 3300035242 Bacteria 962
370 Ga0373931_0170476 3300035691 Bacteria 1282
371 Ga0373931_0718648 3300035691 Bacteria 661
372 Ga0373935_1456720 3300035692 Bacteria 512
373 Ga0373947_0166366 3300035725 Bacteria 1429
374 Ga0373925_1317870 3300037068 Bacteria 592
375 Ga0395899_0837025 3300037312 Bacteria 566
376 Ga0395900_0069922 3300037418 Bacteria 3609
377 Ga0395900_1248172 3300037418 Bacteria 658
378 Ga0395898_0396282 3300037466 Bacteria 1316
379 Ga0395898_1123260 3300037466 Bacteria 719
380 Ga0395905_0773781 3300037471 Bacteria 863
381 Ga0436364_0735068 3300037853 Unclassified 683
382 Ga0395901_0035621 3300038443 Bacteria 5143
383 Ga0395901_0951361 3300038443 Bacteria 838
384 Ga0395901_1389895 3300038443 Bacteria 661
385 Ga0395901_1514283 3300038443 Bacteria 626
386 Ga0436363_0559538 3300039450 Bacteria 1339
387 Ga0436363_0623404 3300039450 Bacteria 1244
388 Ga0436362_1215078 3300039453 Bacteria 2564
389 Ga0451833_0159979 3300041491 Bacteria 588
390 Ga0439448_0053221 3300042005 Bacteria 1328
391 Ga0439450_144647 3300042008 Bacteria 621
392 Ga0439455_0109044 3300042012 Bacteria 769
393 Ga0450915_000383 3300042119 Bacteria 1541
394 Ga0450902_036479 3300042137 Bacteria 832
395 Ga0439459_0027718 3300042438 Bacteria 1132
396 Ga0439460_0087694 3300042461 Bacteria 985
397 Ga0439440_0013341 3300042993 Bacteria 1760
398 Ga0466965_0103033 3300044683 Bacteria 1461
399 Ga0466965_0144184 3300044683 Bacteria 1242
400 Ga0466966_0120298 3300044684 Bacteria 1613
401 Ga0466966_0151597 3300044684 Bacteria 1414
402 Ga0466961_0156108 3300044693 Bacteria 1423
403 Ga0466961_0475573 3300044693 Bacteria 755
404 Ga0466961_0579428 3300044693 Bacteria 675
405 Ga0466963_0029162 3300044694 Bacteria 3549
406 Ga0466963_0138786 3300044694 Bacteria 1683
407 Ga0466971_0037629 3300044719 Bacteria 2169
408 Ga0466971_0599042 3300044719 Bacteria 549
409 Ga0466970_0152802 3300044765 Bacteria 1275
410 Ga0466970_0653450 3300044765 Bacteria 612
411 Ga0466957_0079781 3300044842 Bacteria 2037
412 Ga0466957_0096294 3300044842 Bacteria 1860
413 Ga0466960_0138981 3300044901 Bacteria 1289
414 Ga0466960_0229792 3300044901 Bacteria 1024
415 Ga0466960_0302520 3300044901 Bacteria 902
416 Ga0466959_0075078 3300045049 Bacteria 2443
417 Ga0466959_0095823 3300045049 Bacteria 2128
418 Ga0466959_0219150 3300045049 Bacteria 1320
419 Ga0466959_0402866 3300045049 Bacteria 930
420 Ga0466959_0508717 3300045049 Bacteria 814
421 Ga0466959_0854736 3300045049 Bacteria 607
422 Ga0466959_0952664 3300045049 Bacteria 572
423 Ga0466958_0008108 3300045836 Bacteria 5812
424 Ga0466958_0135575 3300045836 Bacteria 1548
425 Ga0466958_0327102 3300045836 Bacteria 985
426 Ga0466967_0772379 3300045976 Bacteria 953
427 Ga0466967_0773935 3300045976 Bacteria 952
428 Ga0466967_0989608 3300045976 Bacteria 837
429 Ga0466967_1643525 3300045976 Bacteria 640
430 Ga0495605_0285244 3300046474 Bacteria 701
431 Ga0495616_0449304 3300046513 Unclassified 522
432 Ga0495644_0282852 3300046523 Bacteria 647
433 Ga0495597_0333592 3300046542 Bacteria 584
434 Ga0495588_0635541 3300046674 Bacteria 559
435 Ga0495669_0409684 3300046684 Unclassified 657
436 Ga0495669_0627839 3300046684 Bacteria 522
437 Ga0495589_0539913 3300046794 Bacteria 532
438 Ga0495660_0472669 3300046810 Unclassified 539
439 Ga0496100_0040748 3300048903 Bacteria 2957
440 Ga0496100_0202589 3300048903 Bacteria 1447
441 Ga0496100_1208861 3300048903 Bacteria 596
442 Ga0496101_0010609 3300048904 Bacteria 6086
443 Ga0496101_0278353 3300048904 Bacteria 1307
444 Ga0496101_0507896 3300048904 Bacteria 952
445 Ga0496101_1555201 3300048904 Bacteria 514
446 Ga0496102_0058053 3300048905 Bacteria 3535
447 Ga0496102_0393961 3300048905 Bacteria 1302
448 Ga0496102_1119072 3300048905 Bacteria 707
449 Ga0496103_0181883 3300048906 Bacteria 1351
450 Ga0496103_0734896 3300048906 Bacteria 625
451 Ga0496104_0104612 3300048907 Bacteria 2712
452 Ga0496104_0179104 3300048907 Bacteria 2030
453 Ga0496104_1252028 3300048907 Bacteria 645
454 Ga0496105_0157259 3300048908 Bacteria 1866
455 Ga0496105_0206246 3300048908 Bacteria 1603
456 Ga0496106_0009701 3300048909 Bacteria 7108
457 Ga0496106_0012826 3300048909 Bacteria 6186
458 Ga0496106_0067915 3300048909 Bacteria 2718
459 Ga0496106_0867251 3300048909 Bacteria 714
460 Ga0496107_0038933 3300048910 Bacteria 3410
461 Ga0496107_0131142 3300048910 Bacteria 1850
462 Ga0496107_0201605 3300048910 Bacteria 1479
463 Ga0496107_1290760 3300048910 Bacteria 522
464 Ga0496108_0053603 3300048911 Bacteria 3382
465 Ga0496108_0144960 3300048911 Bacteria 2047
466 Ga0496108_0968994 3300048911 Bacteria 727
467 Ga0496109_0089920 3300048912 Bacteria 2839
468 Ga0496109_1747195 3300048912 Bacteria 555
469 Ga0496110_0038447 3300048913 Bacteria 4164
470 Ga0496110_0096246 3300048913 Bacteria 2653
471 Ga0496111_0022321 3300048914 Bacteria 4429
472 Ga0496111_0691211 3300048914 Bacteria 742
473 Ga0496112_0068502 3300048915 Bacteria 3504
474 Ga0496112_0076993 3300048915 Bacteria 3298
475 Ga0496112_1294800 3300048915 Bacteria 644
476 Ga0496113_0051525 3300048916 Bacteria 3072
477 Ga0496113_0096352 3300048916 Bacteria 2287
478 Ga0496114_0067431 3300048917 Bacteria 3002
479 Ga0496114_0253721 3300048917 Bacteria 1548
480 Ga0496115_0070982 3300048918 Bacteria 2824
481 Ga0496115_0120580 3300048918 Bacteria 2158
482 Ga0496115_1219027 3300048918 Bacteria 564
483 Ga0501031_0333912 3300049568 Bacteria 981
484 Ga0501031_0551761 3300049568 Bacteria 742
485 Ga0501036_0176276 3300049572 Bacteria 1800
486 Ga0501036_0284800 3300049572 Bacteria 1383
487 Ga0501037_0369395 3300049573 Bacteria 987
488 Ga0501038_0544052 3300049574 Bacteria 884
489 Ga0501038_1183107 3300049574 Bacteria 556
490 Ga0501039_0145839 3300049575 Bacteria 1860
491 Ga0501039_1239093 3300049575 Bacteria 576
492 Ga0501040_0050099 3300049576 Bacteria 2856
493 Ga0501040_0143588 3300049576 Bacteria 1682
494 Ga0501041_0103563 3300049577 Bacteria 1763
495 Ga0501041_0317591 3300049577 Bacteria 982
496 Ga0501042_0077831 3300049578 Bacteria 2375
497 Ga0501048_0254898 3300049582 Bacteria 1246
498 Ga0501067_0527892 3300049583 Bacteria 661
499 Ga0501071_0251110 3300049587 Bacteria 1335
500 Ga0501071_0377622 3300049587 Bacteria 1080
501 Ga0501072_0567749 3300049588 Bacteria 895
502 Ga0501074_1140104 3300049590 Bacteria 547
503 Ga0501075_0146068 3300049591 Bacteria 1802
504 Ga0501075_0466125 3300049591 Bacteria 963
505 Ga0501075_0799653 3300049591 Bacteria 718
506 Ga0501076_0554047 3300049592 Bacteria 948
507 Ga0501076_1246602 3300049592 Bacteria 612
508 Ga0501077_0670657 3300049593 Bacteria 666
509 Ga0501079_0956520 3300049741 Bacteria 674
510 Ga0501080_1044656 3300049742 Bacteria 707
511 Ga0501081_0109008 3300049743 Bacteria 1964
512 Ga0501081_0134848 3300049743 Bacteria 1767
513 Ga0501045_0657860 3300049824 Bacteria 774
514 Ga0501045_1126810 3300049824 Bacteria 573
515 nmdc:mga03n38_660802_c1 3300050490 Bacteria 600
516 nmdc:mga0yw44_319433_c1 3300050492 Bacteria 1042
517 nmdc:mga05p37_47173_c1 3300050507 Bacteria 5298
518 nmdc:mga05p37_656710_c1 3300050507 Bacteria 1173
519 nmdc:mga05p37_835441_c1 3300050507 Bacteria 1002
520 nmdc:mga05p37_903596_c1 3300050507 Bacteria 952
521 nmdc:mga0qj67_139689_c1 3300050509 Bacteria 1964
522 nmdc:mga06r32_286663_c1 3300050510 Bacteria 1633
523 nmdc:mga06r32_35693_c1 3300050510 Bacteria 4692
524 nmdc:mga08y16_1333878_c1 3300050511 Bacteria 683
525 nmdc:mga08y16_16995_c1 3300050511 Bacteria 7661
526 nmdc:mga08y16_20153_c1 3300050511 Bacteria 7037
527 nmdc:mga08y16_239165_c1 3300050511 Bacteria 1877
528 nmdc:mga08y16_474837_c1 3300050511 Bacteria 1273
529 nmdc:mga0n895_1628026_c1 3300050512 Bacteria 609
530 nmdc:mga0n895_256457_c1 3300050512 Bacteria 1775
531 nmdc:mga0n895_859729_c1 3300050512 Bacteria 894
532 nmdc:mga0rr50_172827_c1 3300050513 Bacteria 1762
533 nmdc:mga08x19_240898_c1 3300050514 Bacteria 1247
534 nmdc:mga0a205_107544_c1 3300050515 Bacteria 2687
535 nmdc:mga0a205_273302_c1 3300050515 Bacteria 1566
536 nmdc:mga0a205_93154_c1 3300050515 Bacteria 2911
537 Ga0495655_0040630 3300053083 Bacteria 1185
538 Ga0495655_0109663 3300053083 Bacteria 828
539 Ga0495655_0118855 3300053083 Bacteria 802
540 Ga0501084_0893266 3300054114 Bacteria 747
541 Ga0501082_0766785 3300060353 Bacteria 844
542 Ga0466962_0027224 3300061719 Bacteria 2744
543 Ga0081538_10205177
544 JGI24737J22298_10159985
545 JGI24743J22301_10008825
546 JGI24735J21928_10162046
547 JGI24738J21930_10087502
548 JGI24738J21930_10102184
549 JGI24744J21845_10104299
550 JGI24742J22300_10130370
551 JGI25406J46586_10004944
552 JGI25407J50210_10115794
553 Ga0070658_11266277
554 Ga0070676_10148377
555 Ga0070690_100316724
556 Ga0070666_11081258
557 Ga0070680_101028289
558 Ga0070680_101448989
559 Ga0070682_100129037
560 Ga0070682_101493141
561 Ga0070682_101804706
562 Ga0070682_101890135
563 Ga0068868_100072847
564 Ga0068868_100096562
565 Ga0068868_100413022
566 Ga0070689_100046183
567 Ga0070689_100476138
568 Ga0070691_10763555
569 Ga0070691_10908471
570 Ga0070687_100063024
571 Ga0070661_101457799
572 Ga0070692_10059327
573 Ga0070692_10089281
574 Ga0070668_100007911
575 Ga0070668_100403391
576 Ga0070668_100690006
577 Ga0070669_100064888
578 Ga0070669_100412883
579 Ga0070671_100252901
580 Ga0070671_101898246
581 Ga0070674_100052909
582 Ga0070674_100168092
583 Ga0070674_102077731
584 Ga0070688_100133364
585 Ga0070688_100782619
586 Ga0070659_100047733
587 Ga0070667_101557743
588 Ga0070667_102149482
589 Ga0070701_10062491
590 Ga0070700_100215775
591 Ga0070700_100733827
592 Ga0070694_101911412
593 Ga0070663_101299564
594 Ga0070678_100203557
595 Ga0070662_100413472
596 Ga0070662_100538828
597 Ga0070681_10784221
598 Ga0068867_100491191
599 Ga0070685_10122167
600 Ga0070679_100802236
601 Ga0070684_100723334
602 Ga0070684_101414853
603 Ga0068853_100586636
604 Ga0068853_102502565
605 Ga0070686_100372944
606 Ga0070686_100640288
607 Ga0070686_100846078
608 Ga0070686_101348291
609 Ga0070686_101579292
610 Ga0070695_100991812
611 Ga0070693_100123846
612 Ga0070693_100296886
613 Ga0070664_100289125
614 Ga0068857_100775026
615 Ga0068857_101853153
616 Ga0068854_100068630
617 Ga0068854_100130777
618 Ga0068854_100201769
619 Ga0068854_101538885
620 Ga0068854_101554345
621 Ga0068856_102113991
622 Ga0070702_100110837
623 Ga0070702_100570016
624 Ga0068852_100035549
625 Ga0068852_100268543
626 Ga0068859_100036222
627 Ga0068864_100631220
628 Ga0068864_100717441
629 Ga0068866_10059904
630 Ga0068861_100009315
631 Ga0068861_100062645
632 Ga0068861_100192020
633 Ga0068861_100796160
634 Ga0068861_101479884
635 Ga0068851_10425219
636 Ga0068870_10231240
637 Ga0068870_10322696
638 Ga0068863_100691158
639 Ga0068858_100508259
640 Ga0068858_100552774
641 Ga0068860_100299213
642 Ga0068860_101742852
643 Ga0081455_10003758
644 Ga0081455_10064656
645 Ga0081455_10224008
646 Ga0081455_10423855
647 Ga0081538_10000126
648 Ga0081538_10008051
649 Ga0081538_10012427
650 Ga0081538_10013509
651 Ga0081538_10017851
652 Ga0081538_10021840
653 Ga0081538_10022410
654 Ga0081538_10066422
655 Ga0081538_10308645
656 Ga0081538_10377793
657 Ga0081539_10001486
658 Ga0081539_10011379
659 Ga0075363_100376291
660 Ga0075432_10365614
661 Ga0070716_101011040
662 Ga0075428_100029656
663 Ga0075428_100098023
664 Ga0075428_100845827
665 Ga0075430_100619656
666 Ga0075431_100429861
667 Ga0075431_101182225
668 Ga0075433_10222960
669 Ga0075433_10553984
670 Ga0075434_100045857
671 Ga0075434_101956165
672 Ga0075429_100304034
673 Ga0075429_100831229
674 Ga0075429_101089657
675 Ga0068865_100167869
676 Ga0068865_100230519
677 Ga0068865_101250348
678 Ga0075436_100027197
679 Ga0097620_100036222
680 Ga0075435_100043519
681 Ga0075435_102016577
682 Ga0111539_10005603
683 Ga0111539_10047099
684 Ga0111539_10144155
685 Ga0111539_10439754
686 Ga0111539_11085289
687 Ga0111539_11600482
688 Ga0111539_12325569
689 Ga0105245_10000364
690 Ga0105245_10888430
691 Ga0105245_10961076
692 Ga0105245_12200304
693 Ga0105247_10014385
694 Ga0114129_10014555
695 Ga0114129_10145378
696 Ga0114129_10776118
697 Ga0114129_10793102
698 Ga0114129_10834057
699 Ga0114129_11280979
700 Ga0114129_12736631
701 Ga0105243_10065073
702 Ga0105243_10267657
703 Ga0105243_10416693
704 Ga0105243_10549184
705 Ga0105243_11200813
706 Ga0105243_11465476
707 Ga0105241_11172463
708 Ga0105241_11179531
709 Ga0105241_12348525
710 Ga0105242_10093353
711 Ga0105242_10107612
712 Ga0105242_12064720
713 Ga0105248_10460421
714 Ga0105248_11059091
715 Ga0105237_10416569
716 Ga0105238_11084642
717 Ga0105238_11538012
718 Ga0105249_10012387
719 Ga0105249_10080805
720 Ga0105249_10089354
721 Ga0105249_10404717
722 Ga0105249_11654569
723 Ga0105249_12408342
724 Ga0105239_10090351
725 Ga0105239_11499061
726 Ga0105239_11720584
727 Ga0105239_13498493
728 Ga0105246_10571330
729 Ga0105246_10837760
730 Ga0105246_11800099
731 Ga0157371_11188688
732 Ga0157374_11190293
733 Ga0157378_11485824
734 Ga0157378_12892149
735 Ga0163162_10269740
736 Ga0163162_10444015
737 Ga0163162_10777211
738 Ga0157372_10178666
739 Ga0157372_11273973
740 Ga0157372_12561388
741 Ga0157375_10138618
742 Ga0157375_10867649
743 Ga0157375_11254475
744 Ga0157375_12499898
745 Ga0163163_10299492
746 Ga0163163_10333676
747 Ga0157380_10240652
748 Ga0157380_10387452
749 Ga0157380_10881568
750 Ga0157377_10232417
751 Ga0157377_10292128
752 Ga0157377_11285408
753 Ga0163161_11832289
754 Ga0213873_10005365
755 Ga0213875_10368835
756 Ga0207642_10023299
757 Ga0207642_10750806
758 Ga0207710_10186091
759 Ga0207688_10038905
760 Ga0207688_10042054
761 Ga0207688_10062735
762 Ga0207688_10154520
763 Ga0207647_10362346
764 Ga0207654_10954599
765 Ga0207707_10998367
766 Ga0207660_11645306
767 Ga0207662_10277888
768 Ga0207657_10062270
769 Ga0207681_10056824
770 Ga0207681_11318875
771 Ga0207681_11632114
772 Ga0207650_10372575
773 Ga0207650_11103682
774 Ga0207687_10110436
775 Ga0207644_10253577
776 Ga0207690_10058748
777 Ga0207690_11106979
778 Ga0207706_10002947
779 Ga0207706_10140471
780 Ga0207706_10901980
781 Ga0207686_10031435
782 Ga0207686_11579537
783 Ga0207709_10050503
784 Ga0207709_10254132
785 Ga0207670_10072832
786 Ga0207704_10082833
787 Ga0207704_10184377
788 Ga0207665_10798760
789 Ga0207691_10403047
790 Ga0207711_10676523
791 Ga0207712_10087236
792 Ga0207712_10124444
793 Ga0207712_10240098
794 Ga0207712_10428825
795 Ga0207668_10047788
796 Ga0207668_10345639
797 Ga0207668_11429080
798 Ga0207668_11623239
799 Ga0207668_11777676
800 Ga0207640_10093294
801 Ga0207640_10254831
802 Ga0207640_10460822
803 Ga0207677_10246655
804 Ga0207677_10276935
805 Ga0207677_10391770
806 Ga0207677_10425943
807 Ga0207703_10262517
808 Ga0207703_10331503
809 Ga0207639_10092975
810 Ga0207639_10725256
811 Ga0207678_10507295
812 Ga0207708_10006994
813 Ga0207708_10012116
814 Ga0207708_11101530
815 Ga0207702_10116261
816 Ga0207641_10396903
817 Ga0207648_10157196
818 Ga0207648_10220645
819 Ga0207648_11171630
820 Ga0207676_10135080
821 Ga0207676_10231552
822 Ga0207676_10388723
823 Ga0207676_11444864
824 Ga0207674_10013112
825 Ga0207674_10289982
826 Ga0207674_10611690
827 Ga0207675_100002818
828 Ga0207675_100014057
829 Ga0207675_100115134
830 Ga0207675_101493674
831 Ga0207683_10119806
832 Ga0207683_11404194
833 Ga0207698_10095626
834 Ga0207698_10247893
835 Ga0207698_11231484
836 Ga0209998_10164786
837 Ga0207428_10119144
838 Ga0207428_10146156
839 Ga0207428_10689579
840 Ga0207428_11315228
841 Ga0307408_100042386
842 Ga0307408_101190814
843 Ga0307405_10324568
844 Ga0307405_10418375
845 Ga0307405_10547007
846 Ga0307405_10652326
847 Ga0307405_11268978
848 Ga0307413_10072254
849 Ga0307413_10318861
850 Ga0307413_10854884
851 Ga0307413_11422825
852 Ga0307410_10097221
853 Ga0307410_10199200
854 Ga0307410_10812333
855 Ga0307410_11414820
856 Ga0307406_10003973
857 Ga0307406_10150511
858 Ga0307406_10285633
859 Ga0307406_10373279
860 Ga0307406_10531982
861 Ga0307406_10580283
862 Ga0307406_10659670
863 Ga0307407_10011959
864 Ga0307407_10027380
865 Ga0307407_10353122
866 Ga0307407_11000859
867 Ga0307407_11003240
868 Ga0307407_11236035
869 Ga0307407_11387948
870 Ga0307412_10862567
871 Ga0307412_11421186
872 Ga0307412_11729010
873 Ga0307409_100004137
874 Ga0307409_100058247
875 Ga0307409_100070477
876 Ga0307409_100191801
877 Ga0307409_101300822
878 Ga0307409_101347606
879 Ga0307409_102949194
880 Ga0307416_100009929
881 Ga0307416_100066617
882 Ga0307416_100091703
883 Ga0307416_100253804
884 Ga0307416_100289250
885 Ga0307416_101335256
886 Ga0307416_101702903
887 Ga0307416_102465290
888 Ga0307416_102896283
889 Ga0307416_102987908
890 Ga0307414_10092146
891 Ga0307414_10176902
892 Ga0307414_10227432
893 Ga0307411_10146821
894 Ga0307411_10800806
895 Ga0307411_11134884
896 Ga0307411_11771710
897 Ga0307415_100357090
898 Ga0307415_100366179
899 Ga0307415_100624458
900 Ga0307415_101354378
901 Ga0307415_102269251
902 Ga0373958_0109027
903 Ga0373959_0009427
904 Ga0373938_0253216
905 Ga0373940_0048770
906 Ga0373949_0015212
907 Ga0373932_0376777
908 Ga0373939_0287315
909 Ga0373960_0045848
910 Ga0373943_0631133
911 Ga0373962_0085879
912 Ga0373931_0170476
913 Ga0373931_0718648
914 Ga0373935_1456720
915 Ga0373947_0166366
916 Ga0373925_1317870
917 Ga0395899_0837025
918 Ga0395900_0069922
919 Ga0395900_1248172
920 Ga0395898_0396282
921 Ga0395898_1123260
922 Ga0395905_0773781
923 Ga0436364_0735068
924 Ga0395901_0035621
925 Ga0395901_0951361
926 Ga0395901_1389895
927 Ga0395901_1514283
928 Ga0436363_0559538
929 Ga0436363_0623404
930 Ga0436362_1215078
931 Ga0451833_0159979
932 Ga0439448_0053221
933 Ga0439450_144647
934 Ga0439455_0109044
935 Ga0450915_000383
936 Ga0450902_036479
937 Ga0439459_0027718
938 Ga0439460_0087694
939 Ga0439440_0013341
940 Ga0466965_0103033
941 Ga0466965_0144184
942 Ga0466966_0120298
943 Ga0466966_0151597
944 Ga0466961_0156108
945 Ga0466961_0475573
946 Ga0466961_0579428
947 Ga0466963_0029162
948 Ga0466963_0138786
949 Ga0466971_0037629
950 Ga0466971_0599042
951 Ga0466970_0152802
952 Ga0466970_0653450
953 Ga0466957_0079781
954 Ga0466957_0096294
955 Ga0466960_0138981
956 Ga0466960_0229792
957 Ga0466960_0302520
958 Ga0466959_0075078
959 Ga0466959_0095823
960 Ga0466959_0219150
961 Ga0466959_0402866
962 Ga0466959_0508717
963 Ga0466959_0854736
964 Ga0466959_0952664
965 Ga0466958_0008108
966 Ga0466958_0135575
967 Ga0466958_0327102
968 Ga0466967_0772379
969 Ga0466967_0773935
970 Ga0466967_0989608
971 Ga0466967_1643525
972 Ga0495605_0285244
973 Ga0495616_0449304
974 Ga0495644_0282852
975 Ga0495597_0333592
976 Ga0495588_0635541
977 Ga0495669_0409684
978 Ga0495669_0627839
979 Ga0495589_0539913
980 Ga0495660_0472669
981 Ga0496100_0040748
982 Ga0496100_0202589
983 Ga0496100_1208861
984 Ga0496101_0010609
985 Ga0496101_0278353
986 Ga0496101_0507896
987 Ga0496101_1555201
988 Ga0496102_0058053
989 Ga0496102_0393961
990 Ga0496102_1119072
991 Ga0496103_0181883
992 Ga0496103_0734896
993 Ga0496104_0104612
994 Ga0496104_0179104
995 Ga0496104_1252028
996 Ga0496105_0157259
997 Ga0496105_0206246
998 Ga0496106_0009701
999 Ga0496106_0012826
1000 Ga0496106_0067915
1001 Ga0496106_0867251
1002 Ga0496107_0038933
1003 Ga0496107_0131142
1004 Ga0496107_0201605
1005 Ga0496107_1290760
1006 Ga0496108_0053603
1007 Ga0496108_0144960
1008 Ga0496108_0968994
1009 Ga0496109_0089920
1010 Ga0496109_1747195
1011 Ga0496110_0038447
1012 Ga0496110_0096246
1013 Ga0496111_0022321
1014 Ga0496111_0691211
1015 Ga0496112_0068502
1016 Ga0496112_0076993
1017 Ga0496112_1294800
1018 Ga0496113_0051525
1019 Ga0496113_0096352
1020 Ga0496114_0067431
1021 Ga0496114_0253721
1022 Ga0496115_0070982
1023 Ga0496115_0120580
1024 Ga0496115_1219027
1025 Ga0501031_0333912
1026 Ga0501031_0551761
1027 Ga0501036_0176276
1028 Ga0501036_0284800
1029 Ga0501037_0369395
1030 Ga0501038_0544052
1031 Ga0501038_1183107
1032 Ga0501039_0145839
1033 Ga0501039_1239093
1034 Ga0501040_0050099
1035 Ga0501040_0143588
1036 Ga0501041_0103563
1037 Ga0501041_0317591
1038 Ga0501042_0077831
1039 Ga0501048_0254898
1040 Ga0501067_0527892
1041 Ga0501071_0251110
1042 Ga0501071_0377622
1043 Ga0501072_0567749
1044 Ga0501074_1140104
1045 Ga0501075_0146068
1046 Ga0501075_0466125
1047 Ga0501075_0799653
1048 Ga0501076_0554047
1049 Ga0501076_1246602
1050 Ga0501077_0670657
1051 Ga0501079_0956520
1052 Ga0501080_1044656
1053 Ga0501081_0109008
1054 Ga0501081_0134848
1055 Ga0501045_0657860
1056 Ga0501045_1126810
1057 nmdc:mga03n38_660802_c1
1058 nmdc:mga0yw44_319433_c1
1059 nmdc:mga05p37_47173_c1
1060 nmdc:mga05p37_656710_c1
1061 nmdc:mga05p37_835441_c1
1062 nmdc:mga05p37_903596_c1
1063 nmdc:mga0qj67_139689_c1
1064 nmdc:mga06r32_286663_c1
1065 nmdc:mga06r32_35693_c1
1066 nmdc:mga08y16_1333878_c1
1067 nmdc:mga08y16_16995_c1
1068 nmdc:mga08y16_20153_c1
1069 nmdc:mga08y16_239165_c1
1070 nmdc:mga08y16_474837_c1
1071 nmdc:mga0n895_1628026_c1
1072 nmdc:mga0n895_256457_c1
1073 nmdc:mga0n895_859729_c1
1074 nmdc:mga0rr50_172827_c1
1075 nmdc:mga08x19_240898_c1
1076 nmdc:mga0a205_107544_c1
1077 nmdc:mga0a205_273302_c1
1078 nmdc:mga0a205_93154_c1
1079 Ga0495655_0040630
1080 Ga0495655_0109663
1081 Ga0495655_0118855
1082 Ga0501084_0893266
1083 Ga0501082_0766785
1084 Ga0466962_0027224

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map