F461392

General Info

Members Datasets Scaffolds Average Seq Length
541 234 541 93

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_1478899|Ga0395900_1478899_47_364
Length 105
Sequence MSALLTPEEIQQALRDLPDWTLDGSLIVVNYSFRDFSDALIFVNTVAQEAEQLNHHPDIDIRYNKVRMLLTSHDSGGITRRDTRMAKQISEIYSESKRSDFDTVN

Samples

Sample ID Description Type Environment
1 2088090002 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
153 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
154 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
159 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
164 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
177 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
178 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
179 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
180 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.15
Metatranscriptomes 1.85
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 3.33
Rhizosphere 94.82
Stem 0
Stem Tuber 0
Unclassified 1.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNA_F6ESG4R02GBA9Z 2088090002 Unclassified 508
2 rootH2_10028640 3300003320 Unclassified 4061
3 rootH2_10250896 3300003320 Bacteria 2132
4 rootH2_10303074 3300003320 Bacteria 1077
5 JGI25405J52794_10001170 3300003911 Bacteria 4238
6 Ga0065715_10008377 3300005293 Bacteria 3021
7 Ga0070658_10023085 3300005327 Unclassified 4994
8 Ga0070658_10077834 3300005327 Unclassified 2721
9 Ga0070658_10345660 3300005327 Viruses 1273
10 Ga0070658_11276068 3300005327 Unclassified 638
11 Ga0070658_11840278 3300005327 Bacteria 523
12 Ga0070676_10017129 3300005328 Bacteria 4009
13 Ga0070683_100012643 3300005329 Bacteria 7338
14 Ga0070683_100078010 3300005329 Bacteria 3098
15 Ga0070683_100143339 3300005329 Unclassified 2263
16 Ga0070683_100149286 3300005329 Bacteria 2216
17 Ga0070683_100185631 3300005329 Bacteria 1974
18 Ga0070683_100951879 3300005329 Unclassified 824
19 Ga0070670_100141994 3300005331 Bacteria 2077
20 Ga0070670_100144513 3300005331 Bacteria 2058
21 Ga0070670_100556625 3300005331 Bacteria 1023
22 Ga0068869_100000547 3300005334 Bacteria 21002
23 Ga0068869_100756063 3300005334 Bacteria 832
24 Ga0070666_10033873 3300005335 Bacteria 3383
25 Ga0070666_10170650 3300005335 Bacteria 1523
26 Ga0070682_100393363 3300005337 Bacteria 1046
27 Ga0070682_101092389 3300005337 Unclassified 667
28 Ga0070682_101382862 3300005337 Unclassified 601
29 Ga0068868_100012614 3300005338 Bacteria 6180
30 Ga0068868_100878521 3300005338 Bacteria 813
31 Ga0070691_10792679 3300005341 Bacteria 576
32 Ga0070661_100001158 3300005344 Bacteria 18566
33 Ga0070661_100229945 3300005344 Bacteria 1425
34 Ga0070661_101050818 3300005344 Unclassified 677
35 Ga0070669_100746205 3300005353 Bacteria 829
36 Ga0070675_100150933 3300005354 Bacteria 1992
37 Ga0070671_100000913 3300005355 Bacteria 21571
38 Ga0070671_100173229 3300005355 Bacteria 1825
39 Ga0070673_100272722 3300005364 Bacteria 1481
40 Ga0070673_100939375 3300005364 Unclassified 803
41 Ga0070667_100008178 3300005367 Bacteria 8671
42 Ga0070667_100104105 3300005367 Bacteria 2454
43 Ga0070709_10444215 3300005434 Unclassified 976
44 Ga0070714_100315957 3300005435 Unclassified 1460
45 Ga0070714_100771470 3300005435 Bacteria 930
46 Ga0070714_102165587 3300005435 Unclassified 542
47 Ga0070713_100002588 3300005436 Bacteria 11836
48 Ga0070713_100228197 3300005436 Bacteria 1692
49 Ga0070713_100572400 3300005436 Bacteria 1071
50 Ga0070711_100083726 3300005439 Unclassified 2280
51 Ga0070708_100045529 3300005445 Bacteria 3865
52 Ga0070708_101528059 3300005445 Bacteria 622
53 Ga0070663_100870700 3300005455 Bacteria 776
54 Ga0070678_100014837 3300005456 Bacteria 4930
55 Ga0070662_100025148 3300005457 Bacteria 4109
56 Ga0070681_10560808 3300005458 Unclassified 1056
57 Ga0070681_11265328 3300005458 Bacteria 660
58 Ga0070681_11874233 3300005458 Unclassified 527
59 Ga0068867_100116760 3300005459 Bacteria 2057
60 Ga0070706_100022637 3300005467 Bacteria 5787
61 Ga0070706_100032432 3300005467 Bacteria 4818
62 Ga0070706_101020459 3300005467 Unclassified 763
63 Ga0070707_100077683 3300005468 Bacteria 3203
64 Ga0070698_100006879 3300005471 Bacteria 12320
65 Ga0070684_100001799 3300005535 Bacteria 15680
66 Ga0070684_100048961 3300005535 Bacteria 3667
67 Ga0070684_100067058 3300005535 Bacteria 3151
68 Ga0070684_100737055 3300005535 Unclassified 919
69 Ga0070697_100374245 3300005536 Bacteria 1233
70 Ga0068853_100009903 3300005539 Bacteria 7695
71 Ga0068853_100028794 3300005539 Bacteria 4674
72 Ga0068853_100074863 3300005539 Bacteria 2954
73 Ga0068853_100183515 3300005539 Bacteria 1898
74 Ga0068853_100324663 3300005539 Bacteria 1427
75 Ga0068853_101746298 3300005539 Unclassified 603
76 Ga0070672_100003630 3300005543 Bacteria 10014
77 Ga0070672_101128068 3300005543 Unclassified 697
78 Ga0070693_100160316 3300005547 Bacteria 1432
79 Ga0070665_100010329 3300005548 Bacteria 9445
80 Ga0070665_100176450 3300005548 Bacteria 2138
81 Ga0070665_100219971 3300005548 Bacteria 1899
82 Ga0070665_101289352 3300005548 Unclassified 740
83 Ga0068855_100012881 3300005563 Bacteria 10090
84 Ga0068855_100064019 3300005563 Bacteria 4289
85 Ga0068855_100078597 3300005563 Bacteria 3827
86 Ga0068855_100295111 3300005563 Bacteria 1796
87 Ga0068855_101931468 3300005563 Unclassified 597
88 Ga0070664_100463853 3300005564 Bacteria 1164
89 Ga0070664_100576324 3300005564 Bacteria 1042
90 Ga0070664_100634650 3300005564 Bacteria 992
91 Ga0068857_100000391 3300005577 Bacteria 30759
92 Ga0068857_100126927 3300005577 Bacteria 2299
93 Ga0068857_100218938 3300005577 Bacteria 1738
94 Ga0068857_100665242 3300005577 Bacteria 988
95 Ga0068854_100018648 3300005578 Bacteria 4662
96 Ga0068854_100226039 3300005578 Bacteria 1483
97 Ga0068854_100300694 3300005578 Bacteria 1298
98 Ga0068856_100003157 3300005614 Bacteria 16800
99 Ga0068856_100072082 3300005614 Bacteria 3420
100 Ga0068856_100074313 3300005614 Bacteria 3365
101 Ga0068856_101591281 3300005614 Bacteria 667
102 Ga0068856_101736398 3300005614 Bacteria 636
103 Ga0070702_101282546 3300005615 Unclassified 594
104 Ga0068852_100000397 3300005616 Bacteria 29177
105 Ga0068852_100029408 3300005616 Bacteria 4514
106 Ga0068852_100064898 3300005616 Unclassified 3184
107 Ga0068852_100076679 3300005616 Bacteria 2952
108 Ga0068852_100168724 3300005616 Bacteria 2050
109 Ga0068852_100228042 3300005616 Bacteria 1775
110 Ga0068852_100718286 3300005616 Unclassified 1010
111 Ga0068852_100982108 3300005616 Unclassified 863
112 Ga0068859_100116949 3300005617 Unclassified 2731
113 Ga0068859_100143413 3300005617 Bacteria 2462
114 Ga0068864_100000424 3300005618 Bacteria 36475
115 Ga0068864_100187212 3300005618 Bacteria 1896
116 Ga0068866_10934256 3300005718 Bacteria 612
117 Ga0068851_10001032 3300005834 Bacteria 12097
118 Ga0068851_10019359 3300005834 Bacteria 3288
119 Ga0068851_10021457 3300005834 Bacteria 3136
120 Ga0068851_10027638 3300005834 Unclassified 2797
121 Ga0068851_10050746 3300005834 Bacteria 2107
122 Ga0068851_10737292 3300005834 Unclassified 609
123 Ga0068851_10857794 3300005834 Unclassified 567
124 Ga0068863_100004144 3300005841 Bacteria 14324
125 Ga0068863_102587506 3300005841 Unclassified 516
126 Ga0068858_100004796 3300005842 Bacteria 13249
127 Ga0068858_100126502 3300005842 Bacteria 2393
128 Ga0068858_101769439 3300005842 Bacteria 610
129 Ga0068860_100003785 3300005843 Bacteria 15568
130 Ga0068860_100175373 3300005843 Bacteria 2072
131 Ga0068862_100046185 3300005844 Unclassified 3716
132 Ga0081455_10010007 3300005937 Bacteria 9693
133 Ga0081455_10032038 3300005937 Bacteria 4744
134 Ga0081539_10007120 3300005985 Bacteria 10338
135 Ga0070717_10488087 3300006028 Bacteria 1112
136 Ga0070717_11082957 3300006028 Unclassified 730
137 Ga0070717_11520104 3300006028 Unclassified 607
138 Ga0070716_100252784 3300006173 Bacteria 1202
139 Ga0097621_100034317 3300006237 Bacteria 4047
140 Ga0097621_100061643 3300006237 Unclassified 3077
141 Ga0097621_100355660 3300006237 Bacteria 1303
142 Ga0068871_100000467 3300006358 Bacteria 27676
143 Ga0068871_100013303 3300006358 Bacteria 6105
144 Ga0068871_100301983 3300006358 Bacteria 1405
145 Ga0075433_10972814 3300006852 Unclassified 740
146 Ga0068865_100164121 3300006881 Bacteria 1697
147 Ga0097620_100116947 3300006931 Unclassified 2731
148 Ga0097620_100143415 3300006931 Bacteria 2462
149 Ga0105240_10000022 3300009093 Bacteria 387911
150 Ga0105240_10001487 3300009093 Bacteria 39890
151 Ga0105240_10001689 3300009093 Bacteria 37381
152 Ga0105240_10004882 3300009093 Bacteria 20177
153 Ga0105240_10006707 3300009093 Bacteria 16865
154 Ga0105240_10060000 3300009093 Bacteria 4744
155 Ga0105240_10220119 3300009093 Bacteria 2212
156 Ga0105240_10283790 3300009093 Unclassified 1901
157 Ga0105240_10335577 3300009093 Bacteria 1718
158 Ga0105240_11801350 3300009093 Bacteria 638
159 Ga0105245_10001275 3300009098 Bacteria 22730
160 Ga0105245_10061460 3300009098 Bacteria 3387
161 Ga0105245_10073223 3300009098 Bacteria 3114
162 Ga0105245_10188716 3300009098 Unclassified 1973
163 Ga0105245_11824590 3300009098 Bacteria 661
164 Ga0105247_10035758 3300009101 Unclassified 3029
165 Ga0105247_10232434 3300009101 Unclassified 1253
166 Ga0105247_10288270 3300009101 Bacteria 1135
167 Ga0114129_10006405 3300009147 Bacteria 16690
168 Ga0105241_10000043 3300009174 Bacteria 105124
169 Ga0105241_10000790 3300009174 Bacteria 24067
170 Ga0105241_10001172 3300009174 Bacteria 19967
171 Ga0105241_10016720 3300009174 Bacteria 5383
172 Ga0105241_10061356 3300009174 Bacteria 2895
173 Ga0105241_10098112 3300009174 Bacteria 2324
174 Ga0105241_11714570 3300009174 Unclassified 611
175 Ga0105242_10142562 3300009176 Bacteria 2081
176 Ga0105242_10564990 3300009176 Bacteria 1093
177 Ga0105248_10001095 3300009177 Bacteria 29976
178 Ga0105248_10011728 3300009177 Bacteria 9664
179 Ga0105248_10186825 3300009177 Bacteria 2335
180 Ga0105248_11710312 3300009177 Bacteria 713
181 Ga0105237_10026359 3300009545 Bacteria 5940
182 Ga0105237_10037235 3300009545 Bacteria 4919
183 Ga0105237_10132860 3300009545 Bacteria 2483
184 Ga0105237_10204243 3300009545 Bacteria 1976
185 Ga0105237_10706904 3300009545 Bacteria 1014
186 Ga0105238_10000801 3300009551 Bacteria 32620
187 Ga0105238_10001399 3300009551 Bacteria 24200
188 Ga0105238_10002233 3300009551 Bacteria 19538
189 Ga0105238_10006437 3300009551 Bacteria 11684
190 Ga0105238_10153060 3300009551 Bacteria 2281
191 Ga0105238_10168020 3300009551 Bacteria 2169
192 Ga0105238_10532198 3300009551 Bacteria 1178
193 Ga0105249_10062108 3300009553 Unclassified 3430
194 Ga0105249_10179277 3300009553 Bacteria 2060
195 Ga0105249_11953297 3300009553 Bacteria 659
196 Ga0105239_10003395 3300010375 Bacteria 19535
197 Ga0105239_10012987 3300010375 Bacteria 9265
198 Ga0105239_10086852 3300010375 Unclassified 3448
199 Ga0105239_10420565 3300010375 Unclassified 1514
200 Ga0105239_11133403 3300010375 Unclassified 901
201 Ga0105239_11256892 3300010375 Unclassified 854
202 Ga0105239_11785461 3300010375 Unclassified 712
203 Ga0105239_13255921 3300010375 Unclassified 529
204 Ga0105246_10080812 3300011119 Unclassified 2315
205 Ga0105246_10177218 3300011119 Bacteria 1638
206 Ga0157373_10115501 3300013100 Bacteria 1887
207 Ga0157371_11541434 3300013102 Bacteria 519
208 Ga0157370_10241249 3300013104 Bacteria 1672
209 Ga0157370_10491960 3300013104 Bacteria 1127
210 Ga0157370_11980478 3300013104 Bacteria 522
211 Ga0157369_10001425 3300013105 Bacteria 29348
212 Ga0157369_10013330 3300013105 Bacteria 9298
213 Ga0157369_10032369 3300013105 Bacteria 5752
214 Ga0157369_10044917 3300013105 Unclassified 4807
215 Ga0157369_10151774 3300013105 Bacteria 2448
216 Ga0157369_10219644 3300013105 Unclassified 1990
217 Ga0157369_10938077 3300013105 Bacteria 887
218 Ga0157369_11573965 3300013105 Unclassified 668
219 Ga0157374_10071948 3300013296 Bacteria 3262
220 Ga0157374_10083575 3300013296 Bacteria 3033
221 Ga0157374_10132451 3300013296 Unclassified 2413
222 Ga0157374_10430890 3300013296 Bacteria 1318
223 Ga0157374_10604152 3300013296 Bacteria 1107
224 Ga0157374_10856183 3300013296 Bacteria 926
225 Ga0157374_10884046 3300013296 Bacteria 911
226 Ga0157374_11232691 3300013296 Unclassified 770
227 Ga0157374_11382718 3300013296 Bacteria 726
228 Ga0157378_10021006 3300013297 Bacteria 5744
229 Ga0157378_10048720 3300013297 Bacteria 3767
230 Ga0157378_10095155 3300013297 Unclassified 2712
231 Ga0157378_10129296 3300013297 Bacteria 2336
232 Ga0157378_11532680 3300013297 Unclassified 711
233 Ga0157378_12119442 3300013297 Unclassified 613
234 Ga0157378_12711352 3300013297 Bacteria 548
235 Ga0163162_10012929 3300013306 Bacteria 8149
236 Ga0163162_10281092 3300013306 Bacteria 1796
237 Ga0157372_10008695 3300013307 Bacteria 10782
238 Ga0157372_10039165 3300013307 Bacteria 5232
239 Ga0157372_10054972 3300013307 Bacteria 4444
240 Ga0157372_10138618 3300013307 Unclassified 2802
241 Ga0157372_10161647 3300013307 Bacteria 2588
242 Ga0157372_10234626 3300013307 Bacteria 2128
243 Ga0157372_10410556 3300013307 Bacteria 1578
244 Ga0157372_10739546 3300013307 Bacteria 1144
245 Ga0157372_10803327 3300013307 Unclassified 1093
246 Ga0157372_11418043 3300013307 Bacteria 801
247 Ga0157372_12178530 3300013307 Unclassified 637
248 Ga0157375_10018458 3300013308 Bacteria 6327
249 Ga0157375_10018613 3300013308 Bacteria 6301
250 Ga0157375_10236145 3300013308 Bacteria 1987
251 Ga0157375_11772190 3300013308 Bacteria 732
252 Ga0163163_10005695 3300014325 Bacteria 10804
253 Ga0163163_10282735 3300014325 Bacteria 1711
254 Ga0163163_11565882 3300014325 Unclassified 720
255 Ga0157379_10017883 3300014968 Bacteria 6246
256 Ga0157379_10251034 3300014968 Bacteria 1606
257 Ga0157379_10574740 3300014968 Bacteria 1050
258 Ga0157379_10659662 3300014968 Unclassified 980
259 Ga0157376_10000369 3300014969 Bacteria 29606
260 Ga0157376_10101513 3300014969 Bacteria 2514
261 Ga0157376_10111617 3300014969 Bacteria 2407
262 Ga0163161_10113188 3300017792 Bacteria 2031
263 Ga0197907_10939265 3300020069 Bacteria 1202
264 Ga0197907_10960766 3300020069 Bacteria 572
265 Ga0206349_1436852 3300020075 Bacteria 842
266 Ga0206351_10137195 3300020077 Bacteria 652
267 Ga0206351_10372312 3300020077 Bacteria 1248
268 Ga0206350_10557554 3300020080 Bacteria 1392
269 Ga0206350_11208427 3300020080 Bacteria 1056
270 Ga0206350_11210002 3300020080 Bacteria 1197
271 Ga0224712_10288208 3300022467 Bacteria 766
272 Ga0207697_10012275 3300025315 Bacteria 3597
273 Ga0207656_10002068 3300025321 Bacteria 6701
274 Ga0207656_10052368 3300025321 Bacteria 1768
275 Ga0207656_10122547 3300025321 Unclassified 1211
276 Ga0207656_10164114 3300025321 Bacteria 1059
277 Ga0207656_10303027 3300025321 Unclassified 791
278 Ga0207656_10338817 3300025321 Bacteria 749
279 Ga0207656_10589374 3300025321 Unclassified 567
280 Ga0207710_10005046 3300025900 Bacteria 5720
281 Ga0207710_10093947 3300025900 Bacteria 1407
282 Ga0207710_10126758 3300025900 Unclassified 1223
283 Ga0207680_10175940 3300025903 Bacteria 1444
284 Ga0207680_10217601 3300025903 Bacteria 1308
285 Ga0207647_10037418 3300025904 Bacteria 3077
286 Ga0207647_10135470 3300025904 Bacteria 1446
287 Ga0207699_10871575 3300025906 Unclassified 664
288 Ga0207645_10038537 3300025907 Bacteria 3064
289 Ga0207705_10539213 3300025909 Unclassified 907
290 Ga0207705_11040417 3300025909 Bacteria 632
291 Ga0207684_10022617 3300025910 Bacteria 5366
292 Ga0207684_10145246 3300025910 Bacteria 2040
293 Ga0207654_10000019 3300025911 Bacteria 171031
294 Ga0207654_10001893 3300025911 Bacteria 10853
295 Ga0207654_10011130 3300025911 Bacteria 4579
296 Ga0207654_10085894 3300025911 Bacteria 1906
297 Ga0207654_10203416 3300025911 Bacteria 1305
298 Ga0207654_11160207 3300025911 Unclassified 563
299 Ga0207707_10990207 3300025912 Bacteria 690
300 Ga0207695_10000022 3300025913 Bacteria 659090
301 Ga0207695_10000108 3300025913 Bacteria 252306
302 Ga0207695_10000871 3300025913 Bacteria 54947
303 Ga0207695_10001287 3300025913 Bacteria 42580
304 Ga0207695_10002583 3300025913 Bacteria 26559
305 Ga0207695_10007296 3300025913 Bacteria 14115
306 Ga0207695_10165741 3300025913 Unclassified 2138
307 Ga0207695_10530693 3300025913 Bacteria 1058
308 Ga0207695_10758063 3300025913 Bacteria 851
309 Ga0207671_10001258 3300025914 Bacteria 29873
310 Ga0207671_10002967 3300025914 Bacteria 17438
311 Ga0207671_10034212 3300025914 Bacteria 3777
312 Ga0207671_10263219 3300025914 Bacteria 1357
313 Ga0207693_10939301 3300025915 Unclassified 662
314 Ga0207663_10055635 3300025916 Unclassified 2484
315 Ga0207660_10946679 3300025917 Bacteria 703
316 Ga0207660_10959360 3300025917 Bacteria 698
317 Ga0207657_10486419 3300025919 Unclassified 967
318 Ga0207657_10515714 3300025919 Bacteria 936
319 Ga0207649_10015265 3300025920 Bacteria 4316
320 Ga0207649_10198155 3300025920 Bacteria 1417
321 Ga0207649_10897963 3300025920 Unclassified 695
322 Ga0207649_11108117 3300025920 Bacteria 625
323 Ga0207646_10144251 3300025922 Bacteria 2145
324 Ga0207646_10665189 3300025922 Unclassified 932
325 Ga0207681_10418159 3300025923 Bacteria 1086
326 Ga0207694_10000325 3300025924 Bacteria 44875
327 Ga0207694_10000671 3300025924 Bacteria 30684
328 Ga0207694_10013980 3300025924 Bacteria 6052
329 Ga0207694_10045986 3300025924 Unclassified 3373
330 Ga0207694_10155434 3300025924 Bacteria 1844
331 Ga0207694_10444911 3300025924 Bacteria 1081
332 Ga0207650_10002547 3300025925 Bacteria 12635
333 Ga0207659_10067200 3300025926 Bacteria 2603
334 Ga0207687_10014077 3300025927 Bacteria 5231
335 Ga0207687_10071983 3300025927 Bacteria 2471
336 Ga0207687_10086096 3300025927 Bacteria 2281
337 Ga0207687_11097046 3300025927 Bacteria 683
338 Ga0207687_11181096 3300025927 Unclassified 658
339 Ga0207700_10000956 3300025928 Bacteria 16649
340 Ga0207700_10415537 3300025928 Unclassified 1181
341 Ga0207700_11345924 3300025928 Bacteria 636
342 Ga0207664_10204587 3300025929 Bacteria 1705
343 Ga0207664_10891350 3300025929 Unclassified 799
344 Ga0207664_11625222 3300025929 Unclassified 568
345 Ga0207644_10001595 3300025931 Bacteria 14640
346 Ga0207644_10012397 3300025931 Bacteria 5661
347 Ga0207706_10023576 3300025933 Bacteria 5525
348 Ga0207686_10604662 3300025934 Bacteria 863
349 Ga0207686_11107879 3300025934 Bacteria 646
350 Ga0207669_10391506 3300025937 Bacteria 1086
351 Ga0207704_10097988 3300025938 Bacteria 1946
352 Ga0207691_10002490 3300025940 Bacteria 18013
353 Ga0207711_10048925 3300025941 Unclassified 3618
354 Ga0207711_10062599 3300025941 Bacteria 3209
355 Ga0207711_10228240 3300025941 Bacteria 1705
356 Ga0207689_10000130 3300025942 Bacteria 63848
357 Ga0207689_10027632 3300025942 Bacteria 4748
358 Ga0207661_10036210 3300025944 Bacteria 3851
359 Ga0207661_10118937 3300025944 Bacteria 2247
360 Ga0207661_10488376 3300025944 Bacteria 1125
361 Ga0207661_10579038 3300025944 Unclassified 1029
362 Ga0207679_10175291 3300025945 Bacteria 1769
363 Ga0207679_10210201 3300025945 Bacteria 1631
364 Ga0207679_10316717 3300025945 Bacteria 1349
365 Ga0207679_11162764 3300025945 Bacteria 708
366 Ga0207667_10001508 3300025949 Bacteria 29221
367 Ga0207667_10004656 3300025949 Bacteria 16811
368 Ga0207667_10101220 3300025949 Bacteria 2972
369 Ga0207651_10102587 3300025960 Bacteria 2127
370 Ga0207712_10828397 3300025961 Bacteria 815
371 Ga0207712_10985529 3300025961 Bacteria 747
372 Ga0207712_11830639 3300025961 Unclassified 544
373 Ga0207668_10035315 3300025972 Bacteria 3327
374 Ga0207640_10011694 3300025981 Bacteria 4975
375 Ga0207640_10219520 3300025981 Bacteria 1454
376 Ga0207658_10015582 3300025986 Bacteria 5215
377 Ga0207658_11210393 3300025986 Bacteria 690
378 Ga0207677_10005672 3300026023 Bacteria 6791
379 Ga0207677_10009644 3300026023 Bacteria 5435
380 Ga0207677_10032881 3300026023 Bacteria 3339
381 Ga0207703_10009310 3300026035 Bacteria 7721
382 Ga0207703_10097333 3300026035 Bacteria 2486
383 Ga0207703_11285521 3300026035 Bacteria 704
384 Ga0207639_10000180 3300026041 Bacteria 49455
385 Ga0207639_10091164 3300026041 Bacteria 2440
386 Ga0207639_10106429 3300026041 Unclassified 2277
387 Ga0207639_10197060 3300026041 Bacteria 1724
388 Ga0207639_10238490 3300026041 Bacteria 1580
389 Ga0207639_10315987 3300026041 Bacteria 1385
390 Ga0207639_11320454 3300026041 Bacteria 677
391 Ga0207639_11327008 3300026041 Unclassified 675
392 Ga0207678_10260128 3300026067 Bacteria 1487
393 Ga0207678_11020842 3300026067 Unclassified 732
394 Ga0207702_10003238 3300026078 Bacteria 15038
395 Ga0207702_10041914 3300026078 Bacteria 3839
396 Ga0207702_10049794 3300026078 Bacteria 3535
397 Ga0207702_10060667 3300026078 Bacteria 3224
398 Ga0207641_10018193 3300026088 Bacteria 5760
399 Ga0207641_10678338 3300026088 Bacteria 1014
400 Ga0207648_10220642 3300026089 Bacteria 1685
401 Ga0207676_10042168 3300026095 Unclassified 3508
402 Ga0207676_10049083 3300026095 Bacteria 3281
403 Ga0207674_10000910 3300026116 Bacteria 38534
404 Ga0207674_10001536 3300026116 Bacteria 29733
405 Ga0207674_10260350 3300026116 Bacteria 1682
406 Ga0207675_101644814 3300026118 Unclassified 662
407 Ga0207683_10003953 3300026121 Bacteria 12862
408 Ga0207698_10000289 3300026142 Bacteria 30526
409 Ga0207698_10055869 3300026142 Bacteria 3045
410 Ga0207698_10062099 3300026142 Bacteria 2916
411 Ga0207698_10242316 3300026142 Bacteria 1644
412 Ga0207698_10452419 3300026142 Unclassified 1240
413 Ga0207698_10580917 3300026142 Bacteria 1102
414 Ga0207698_11274878 3300026142 Unclassified 749
415 Ga0207698_12319691 3300026142 Unclassified 548
416 Ga0268266_10016603 3300028379 Bacteria 6291
417 Ga0268266_10146846 3300028379 Bacteria 2121
418 Ga0268266_10290944 3300028379 Bacteria 1521
419 Ga0268266_11304103 3300028379 Unclassified 701
420 Ga0268265_10709928 3300028380 Unclassified 972
421 Ga0268264_10007648 3300028381 Bacteria 9007
422 Ga0268264_10073960 3300028381 Bacteria 2894
423 Ga0265338_10161718 3300028800 Bacteria 1728
424 Ga0265760_10378501 3300031090 Unclassified 509
425 Ga0265325_10386622 3300031241 Unclassified 614
426 Ga0265329_10212005 3300031242 Bacteria 639
427 Ga0265339_10000324 3300031249 Bacteria 38292
428 Ga0265316_10179949 3300031344 Bacteria 1574
429 Ga0265314_10008824 3300031711 Bacteria 8611
430 Ga0265314_10069846 3300031711 Bacteria 2356
431 Ga0265342_10112777 3300031712 Bacteria 1537
432 Ga0316576_10075087 3300031727 Bacteria 2500
433 Ga0316578_10054847 3300031728 Bacteria 2338
434 Ga0307414_10269968 3300032004 Unclassified 1424
435 Ga0373954_0504354 3300035118 Bacteria 599
436 Ga0373956_0295809 3300035119 Bacteria 771
437 Ga0373957_0309787 3300035120 Unclassified 670
438 Ga0316574_0399890 3300035398 Bacteria 865
439 Ga0373924_0341288 3300035410 Bacteria 667
440 Ga0373935_1117348 3300035692 Unclassified 587
441 Ga0373937_0054485 3300036401 Bacteria 3670
442 Ga0373937_0177449 3300036401 Bacteria 2000
443 Ga0373937_0836372 3300036401 Bacteria 869
444 Ga0316584_0772232 3300036712 Bacteria 654
445 Ga0373925_0270076 3300037068 Bacteria 1368
446 Ga0395899_0875701 3300037312 Bacteria 549
447 Ga0395900_0444131 3300037418 Bacteria 1254
448 Ga0395900_1478899 3300037418 Bacteria 592
449 Ga0395898_0520942 3300037466 Bacteria 1130
450 Ga0395905_0036044 3300037471 Bacteria 4646
451 Ga0395905_0093435 3300037471 Bacteria 2821
452 Ga0395905_0335955 3300037471 Unclassified 1402
453 Ga0395905_0553805 3300037471 Bacteria 1051
454 Ga0395905_0898370 3300037471 Unclassified 789
455 Ga0395905_1530944 3300037471 Bacteria 571
456 Ga0436364_0468724 3300037853 Bacteria 928
457 Ga0395901_0399763 3300038443 Bacteria 1412
458 Ga0395901_0899935 3300038443 Bacteria 867
459 Ga0395901_1026862 3300038443 Unclassified 799
460 Ga0436363_0173117 3300039450 Bacteria 667
461 Ga0451839_0222012 3300041496 Unclassified 583
462 Ga0451847_0630597 3300041503 Bacteria 615
463 Ga0451851_1177581 3300041507 Bacteria 768
464 Ga0453683_0552489 3300044673 Bacteria 749
465 Ga0466966_0562255 3300044684 Unclassified 686
466 Ga0466959_0428021 3300045049 Bacteria 898
467 Ga0466959_0577353 3300045049 Bacteria 757
468 Ga0451576_1523974 3300045051 Bacteria 694
469 Ga0466958_0116482 3300045836 Bacteria 1670
470 Ga0495629_0020147 3300046459 Bacteria 4762
471 Ga0495629_0104781 3300046459 Bacteria 1973
472 Ga0495629_0288273 3300046459 Bacteria 1126
473 Ga0495580_0619222 3300046472 Bacteria 714
474 Ga0495608_0277952 3300046511 Bacteria 1040
475 Ga0495652_0974296 3300046529 Bacteria 556
476 Ga0495652_1134925 3300046529 Unclassified 506
477 Ga0495665_0084260 3300046531 Bacteria 1671
478 Ga0495586_0302399 3300046535 Bacteria 917
479 Ga0495587_0187684 3300046536 Bacteria 1171
480 Ga0495645_0083957 3300046543 Bacteria 2282
481 Ga0495667_0384319 3300046559 Bacteria 885
482 Ga0495667_0858191 3300046559 Unclassified 558
483 Ga0495657_0706381 3300046675 Unclassified 579
484 Ga0495657_0789978 3300046675 Bacteria 543
485 Ga0495599_0299469 3300046678 Bacteria 971
486 Ga0495623_0123923 3300046679 Bacteria 1553
487 Ga0495623_0128808 3300046679 Bacteria 1518
488 Ga0495623_0612098 3300046679 Unclassified 565
489 Ga0495658_0659733 3300046683 Bacteria 670
490 Ga0495669_0021515 3300046684 Bacteria 2800
491 Ga0495613_0026749 3300046689 Unclassified 4297
492 Ga0495613_0121581 3300046689 Bacteria 1875
493 Ga0495600_0040357 3300046809 Bacteria 3039
494 Ga0495600_0888577 3300046809 Bacteria 526
495 Ga0495581_0349368 3300047315 Bacteria 863
496 Ga0495672_0001982 3300047320 Bacteria 19333
497 Ga0495684_0497899 3300047471 Bacteria 838
498 Ga0495602_0338471 3300048088 Bacteria 1089
499 Ga0495602_0371308 3300048088 Bacteria 1027
500 Ga0495602_0404478 3300048088 Bacteria 973
501 Ga0496100_0074736 3300048903 Unclassified 2271
502 Ga0496100_0208258 3300048903 Bacteria 1429
503 Ga0496100_1302456 3300048903 Unclassified 573
504 Ga0496102_1405813 3300048905 Unclassified 617
505 Ga0496104_0007097 3300048907 Bacteria 9875
506 Ga0496104_0412169 3300048907 Unclassified 1263
507 Ga0496104_1572272 3300048907 Unclassified 560
508 Ga0496105_0629229 3300048908 Unclassified 830
509 Ga0496105_1077354 3300048908 Bacteria 598
510 Ga0496107_0017766 3300048910 Bacteria 5005
511 Ga0496109_0095789 3300048912 Bacteria 2749
512 Ga0496112_0183091 3300048915 Bacteria 2059
513 Ga0496112_1791089 3300048915 Unclassified 526
514 Ga0496114_0015202 3300048917 Bacteria 6188
515 Ga0496114_0628914 3300048917 Unclassified 945
516 Ga0496115_0019162 3300048918 Bacteria 5263
517 Ga0496115_0052776 3300048918 Bacteria 3262
518 Ga0496115_0994439 3300048918 Bacteria 641
519 Ga0496126_0003167 3300048929 Bacteria 21188
520 Ga0501031_0096709 3300049568 Bacteria 1927
521 Ga0501032_0032958 3300049569 Bacteria 3550
522 Ga0501033_0010077 3300049570 Bacteria 7251
523 Ga0501034_0006678 3300049571 Bacteria 12374
524 Ga0501036_0001526 3300049572 Bacteria 17871
525 Ga0501038_0031468 3300049574 Bacteria 4688
526 Ga0501039_0415695 3300049575 Bacteria 1056
527 Ga0501043_0014657 3300049579 Bacteria 6137
528 Ga0501046_0012194 3300049580 Bacteria 7324
529 Ga0501048_0146224 3300049582 Bacteria 1672
530 Ga0501068_0130528 3300049584 Bacteria 1571
531 Ga0501070_0258061 3300049586 Bacteria 1425
532 Ga0501073_0092712 3300049589 Bacteria 2099
533 Ga0501073_1025172 3300049589 Bacteria 568
534 Ga0501074_0142476 3300049590 Bacteria 1714
535 Ga0501080_0635442 3300049742 Bacteria 945
536 Ga0501035_0015193 3300049822 Bacteria 7106
537 Ga0501044_0062717 3300049823 Bacteria 3798
538 Ga0501044_0163845 3300049823 Bacteria 2198
539 nmdc:mga03683_166749_c1 3300050489 Unclassified 999
540 nmdc:mga05p37_9008_c1 3300050507 Bacteria 11803
541 Ga0501084_1630284 3300054114 Bacteria 539

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013100 Ga0157373_10115501 Ga0157373_101155013 79
2 3300013104 Ga0157370_10241249 Ga0157370_102412493 79
3 3300028800 Ga0265338_10161718 Ga0265338_101617182 79
4 3300031242 Ga0265329_10212005 Ga0265329_102120051 79
5 3300031249 Ga0265339_10000324 Ga0265339_1000032430 79
6 3300031344 Ga0265316_10179949 Ga0265316_101799492 79
7 3300031711 Ga0265314_10008824 Ga0265314_100088244 79
8 3300031712 Ga0265342_10112777 Ga0265342_101127771 79
9 3300037471 Ga0395905_0553805 Ga0395905_0553805_753_1028 79
10 3300003320 rootH2_10028640 rootH2_100286403 80
11 3300003320 rootH2_10250896 rootH2_102508961 80
12 3300003320 rootH2_10303074 rootH2_103030741 80
13 3300005327 Ga0070658_10023085 Ga0070658_100230853 80
14 3300005327 Ga0070658_10077834 Ga0070658_100778342 80
15 3300005327 Ga0070658_10345660 Ga0070658_103456602 80
16 3300005327 Ga0070658_11840278 Ga0070658_118402781 80
17 3300005328 Ga0070676_10017129 Ga0070676_100171294 80
18 3300005329 Ga0070683_100012643 Ga0070683_1000126434 80
19 3300005329 Ga0070683_100078010 Ga0070683_1000780102 80
20 3300005329 Ga0070683_100143339 Ga0070683_1001433392 80
21 3300005329 Ga0070683_100149286 Ga0070683_1001492863 80
22 3300005329 Ga0070683_100185631 Ga0070683_1001856313 80
23 3300005331 Ga0070670_100144513 Ga0070670_1001445133 80
24 3300005331 Ga0070670_100556625 Ga0070670_1005566252 80
25 3300005334 Ga0068869_100000547 Ga0068869_1000005473 80
26 3300005334 Ga0068869_100756063 Ga0068869_1007560631 80
27 3300005335 Ga0070666_10033873 Ga0070666_100338733 80
28 3300005335 Ga0070666_10170650 Ga0070666_101706502 80
29 3300005337 Ga0070682_100393363 Ga0070682_1003933632 80
30 3300005337 Ga0070682_101092389 Ga0070682_1010923891 80
31 3300005337 Ga0070682_101382862 Ga0070682_1013828621 80
32 3300005338 Ga0068868_100012614 Ga0068868_1000126145 80
33 3300005338 Ga0068868_100878521 Ga0068868_1008785212 80
34 3300005341 Ga0070691_10792679 Ga0070691_107926791 80
35 3300005344 Ga0070661_100001158 Ga0070661_1000011584 80
36 3300005344 Ga0070661_100229945 Ga0070661_1002299452 80
37 3300005344 Ga0070661_101050818 Ga0070661_1010508181 80
38 3300005353 Ga0070669_100746205 Ga0070669_1007462051 80
39 3300005354 Ga0070675_100150933 Ga0070675_1001509332 80
40 3300005355 Ga0070671_100000913 Ga0070671_1000009133 80
41 3300005355 Ga0070671_100173229 Ga0070671_1001732293 80
42 3300005364 Ga0070673_100272722 Ga0070673_1002727222 80
43 3300005364 Ga0070673_100939375 Ga0070673_1009393752 80
44 3300005367 Ga0070667_100008178 Ga0070667_1000081786 80
45 3300005367 Ga0070667_100104105 Ga0070667_1001041052 80
46 3300005434 Ga0070709_10444215 Ga0070709_104442152 80
47 3300005435 Ga0070714_100315957 Ga0070714_1003159572 80
48 3300005435 Ga0070714_100771470 Ga0070714_1007714701 80
49 3300005435 Ga0070714_102165587 Ga0070714_1021655871 80
50 3300005436 Ga0070713_100002588 Ga0070713_1000025885 80
51 3300005439 Ga0070711_100083726 Ga0070711_1000837262 80
52 3300005455 Ga0070663_100870700 Ga0070663_1008707002 80
53 3300005456 Ga0070678_100014837 Ga0070678_1000148374 80
54 3300005457 Ga0070662_100025148 Ga0070662_1000251482 80
55 3300005458 Ga0070681_11265328 Ga0070681_112653282 80
56 3300005459 Ga0068867_100116760 Ga0068867_1001167601 80
57 3300005535 Ga0070684_100001799 Ga0070684_1000017995 80
58 3300005535 Ga0070684_100048961 Ga0070684_1000489612 80
59 3300005535 Ga0070684_100067058 Ga0070684_1000670584 80
60 3300005535 Ga0070684_100737055 Ga0070684_1007370552 80
61 3300005539 Ga0068853_100009903 Ga0068853_1000099032 80
62 3300005539 Ga0068853_100028794 Ga0068853_1000287945 80
63 3300005539 Ga0068853_100074863 Ga0068853_1000748633 80
64 3300005539 Ga0068853_100324663 Ga0068853_1003246632 80
65 3300005543 Ga0070672_100003630 Ga0070672_1000036308 80
66 3300005543 Ga0070672_101128068 Ga0070672_1011280682 80
67 3300005547 Ga0070693_100160316 Ga0070693_1001603161 80
68 3300005548 Ga0070665_100010329 Ga0070665_1000103297 80
69 3300005548 Ga0070665_100176450 Ga0070665_1001764501 80
70 3300005563 Ga0068855_100012881 Ga0068855_1000128814 80
71 3300005563 Ga0068855_100064019 Ga0068855_1000640194 80
72 3300005563 Ga0068855_100078597 Ga0068855_1000785973 80
73 3300005563 Ga0068855_100295111 Ga0068855_1002951113 80
74 3300005563 Ga0068855_101931468 Ga0068855_1019314682 80
75 3300005564 Ga0070664_100463853 Ga0070664_1004638531 80
76 3300005564 Ga0070664_100576324 Ga0070664_1005763241 80
77 3300005564 Ga0070664_100634650 Ga0070664_1006346502 80
78 3300005577 Ga0068857_100000391 Ga0068857_1000003915 80
79 3300005577 Ga0068857_100126927 Ga0068857_1001269272 80
80 3300005577 Ga0068857_100218938 Ga0068857_1002189381 80
81 3300005578 Ga0068854_100018648 Ga0068854_1000186483 80
82 3300005578 Ga0068854_100226039 Ga0068854_1002260392 80
83 3300005578 Ga0068854_100300694 Ga0068854_1003006943 80
84 3300005614 Ga0068856_100003157 Ga0068856_1000031579 80
85 3300005614 Ga0068856_100072082 Ga0068856_1000720823 80
86 3300005614 Ga0068856_100074313 Ga0068856_1000743133 80
87 3300005614 Ga0068856_101591281 Ga0068856_1015912811 80
88 3300005614 Ga0068856_101736398 Ga0068856_1017363982 80
89 3300005615 Ga0070702_101282546 Ga0070702_1012825461 80
90 3300005616 Ga0068852_100000397 Ga0068852_10000039720 80
91 3300005616 Ga0068852_100029408 Ga0068852_1000294082 80
92 3300005616 Ga0068852_100064898 Ga0068852_1000648983 80
93 3300005616 Ga0068852_100076679 Ga0068852_1000766793 80
94 3300005616 Ga0068852_100168724 Ga0068852_1001687242 80
95 3300005616 Ga0068852_100718286 Ga0068852_1007182861 80
96 3300005616 Ga0068852_100982108 Ga0068852_1009821082 80
97 3300005617 Ga0068859_100116949 Ga0068859_1001169492 80
98 3300005617 Ga0068859_100143413 Ga0068859_1001434133 80
99 3300005618 Ga0068864_100000424 Ga0068864_10000042420 80
100 3300005618 Ga0068864_100187212 Ga0068864_1001872121 80
101 3300005718 Ga0068866_10934256 Ga0068866_109342562 80
102 3300005834 Ga0068851_10001032 Ga0068851_100010326 80
103 3300005834 Ga0068851_10019359 Ga0068851_100193593 80
104 3300005834 Ga0068851_10021457 Ga0068851_100214573 80
105 3300005834 Ga0068851_10027638 Ga0068851_100276382 80
106 3300005834 Ga0068851_10050746 Ga0068851_100507462 80
107 3300005834 Ga0068851_10737292 Ga0068851_107372922 80
108 3300005841 Ga0068863_100004144 Ga0068863_1000041449 80
109 3300005841 Ga0068863_102587506 Ga0068863_1025875061 80
110 3300005842 Ga0068858_100004796 Ga0068858_1000047968 80
111 3300005842 Ga0068858_100126502 Ga0068858_1001265022 80
112 3300005842 Ga0068858_101769439 Ga0068858_1017694392 80
113 3300005843 Ga0068860_100003785 Ga0068860_1000037855 80
114 3300005843 Ga0068860_100175373 Ga0068860_1001753733 80
115 3300005844 Ga0068862_100046185 Ga0068862_1000461852 80
116 3300006028 Ga0070717_11082957 Ga0070717_110829571 80
117 3300006237 Ga0097621_100034317 Ga0097621_1000343174 80
118 3300006237 Ga0097621_100061643 Ga0097621_1000616434 80
119 3300006237 Ga0097621_100355660 Ga0097621_1003556602 80
120 3300006358 Ga0068871_100000467 Ga0068871_1000004675 80
121 3300006358 Ga0068871_100013303 Ga0068871_1000133034 80
122 3300006358 Ga0068871_100301983 Ga0068871_1003019832 80
123 3300006881 Ga0068865_100164121 Ga0068865_1001641212 80
124 3300006931 Ga0097620_100116947 Ga0097620_1001169473 80
125 3300006931 Ga0097620_100143415 Ga0097620_1001434153 80
126 3300009093 Ga0105240_10001487 Ga0105240_1000148715 80
127 3300009093 Ga0105240_10001689 Ga0105240_100016896 80
128 3300009093 Ga0105240_10004882 Ga0105240_1000488213 80
129 3300009093 Ga0105240_10006707 Ga0105240_100067074 80
130 3300009093 Ga0105240_10060000 Ga0105240_100600002 80
131 3300009093 Ga0105240_10283790 Ga0105240_102837903 80
132 3300009093 Ga0105240_10335577 Ga0105240_103355772 80
133 3300009098 Ga0105245_10001275 Ga0105245_1000127520 80
134 3300009098 Ga0105245_10061460 Ga0105245_100614604 80
135 3300009098 Ga0105245_10073223 Ga0105245_100732233 80
136 3300009098 Ga0105245_10188716 Ga0105245_101887161 80
137 3300009098 Ga0105245_11824590 Ga0105245_118245901 80
138 3300009101 Ga0105247_10035758 Ga0105247_100357582 80
139 3300009101 Ga0105247_10232434 Ga0105247_102324342 80
140 3300009101 Ga0105247_10288270 Ga0105247_102882702 80
141 3300009174 Ga0105241_10000043 Ga0105241_1000004333 80
142 3300009174 Ga0105241_10000790 Ga0105241_1000079020 80
143 3300009174 Ga0105241_10001172 Ga0105241_100011725 80
144 3300009174 Ga0105241_10016720 Ga0105241_100167202 80
145 3300009174 Ga0105241_10061356 Ga0105241_100613562 80
146 3300009174 Ga0105241_10098112 Ga0105241_100981122 80
147 3300009174 Ga0105241_11714570 Ga0105241_117145701 80
148 3300009176 Ga0105242_10142562 Ga0105242_101425623 80
149 3300009176 Ga0105242_10564990 Ga0105242_105649902 80
150 3300009177 Ga0105248_10001095 Ga0105248_1000109522 80
151 3300009177 Ga0105248_10011728 Ga0105248_100117286 80
152 3300009177 Ga0105248_10186825 Ga0105248_101868253 80
153 3300009177 Ga0105248_11710312 Ga0105248_117103121 80
154 3300009545 Ga0105237_10026359 Ga0105237_100263592 80
155 3300009545 Ga0105237_10037235 Ga0105237_100372354 80
156 3300009545 Ga0105237_10132860 Ga0105237_101328603 80
157 3300009545 Ga0105237_10204243 Ga0105237_102042432 80
158 3300009551 Ga0105238_10000801 Ga0105238_100008015 80
159 3300009551 Ga0105238_10001399 Ga0105238_1000139921 80
160 3300009551 Ga0105238_10002233 Ga0105238_100022335 80
161 3300009551 Ga0105238_10006437 Ga0105238_100064375 80
162 3300009551 Ga0105238_10168020 Ga0105238_101680202 80
163 3300009551 Ga0105238_10532198 Ga0105238_105321982 80
164 3300009553 Ga0105249_10062108 Ga0105249_100621083 80
165 3300009553 Ga0105249_10179277 Ga0105249_101792773 80
166 3300009553 Ga0105249_11953297 Ga0105249_119532971 80
167 3300010375 Ga0105239_10003395 Ga0105239_1000339515 80
168 3300010375 Ga0105239_10012987 Ga0105239_100129878 80
169 3300010375 Ga0105239_10086852 Ga0105239_100868524 80
170 3300010375 Ga0105239_11133403 Ga0105239_111334032 80
171 3300010375 Ga0105239_11256892 Ga0105239_112568921 80
172 3300010375 Ga0105239_13255921 Ga0105239_132559211 80
173 3300011119 Ga0105246_10080812 Ga0105246_100808123 80
174 3300011119 Ga0105246_10177218 Ga0105246_101772182 80
175 3300013102 Ga0157371_11541434 Ga0157371_115414341 80
176 3300013104 Ga0157370_10491960 Ga0157370_104919601 80
177 3300013104 Ga0157370_11980478 Ga0157370_119804781 80
178 3300013105 Ga0157369_10001425 Ga0157369_100014254 80
179 3300013105 Ga0157369_10013330 Ga0157369_100133304 80
180 3300013105 Ga0157369_10032369 Ga0157369_100323691 80
181 3300013105 Ga0157369_10044917 Ga0157369_100449174 80
182 3300013105 Ga0157369_10151774 Ga0157369_101517743 80
183 3300013105 Ga0157369_10219644 Ga0157369_102196443 80
184 3300013105 Ga0157369_10938077 Ga0157369_109380772 80
185 3300013105 Ga0157369_11573965 Ga0157369_115739652 80
186 3300013296 Ga0157374_10083575 Ga0157374_100835751 80
187 3300013296 Ga0157374_10132451 Ga0157374_101324513 80
188 3300013296 Ga0157374_10430890 Ga0157374_104308902 80
189 3300013296 Ga0157374_10604152 Ga0157374_106041522 80
190 3300013296 Ga0157374_10856183 Ga0157374_108561831 80
191 3300013296 Ga0157374_11232691 Ga0157374_112326912 80
192 3300013297 Ga0157378_10021006 Ga0157378_100210064 80
193 3300013297 Ga0157378_10048720 Ga0157378_100487202 80
194 3300013297 Ga0157378_10095155 Ga0157378_100951553 80
195 3300013297 Ga0157378_10129296 Ga0157378_101292962 80
196 3300013297 Ga0157378_11532680 Ga0157378_115326802 80
197 3300013297 Ga0157378_12711352 Ga0157378_127113522 80
198 3300013306 Ga0163162_10012929 Ga0163162_100129293 80
199 3300013306 Ga0163162_10281092 Ga0163162_102810923 80
200 3300013307 Ga0157372_10008695 Ga0157372_100086956 80
201 3300013307 Ga0157372_10039165 Ga0157372_100391654 80
202 3300013307 Ga0157372_10054972 Ga0157372_100549724 80
203 3300013307 Ga0157372_10138618 Ga0157372_101386183 80
204 3300013307 Ga0157372_10161647 Ga0157372_101616471 80
205 3300013307 Ga0157372_10234626 Ga0157372_102346263 80
206 3300013307 Ga0157372_10739546 Ga0157372_107395461 80
207 3300013307 Ga0157372_10803327 Ga0157372_108033273 80
208 3300013308 Ga0157375_10018458 Ga0157375_100184583 80
209 3300013308 Ga0157375_10018613 Ga0157375_100186134 80
210 3300013308 Ga0157375_10236145 Ga0157375_102361453 80
211 3300014325 Ga0163163_10005695 Ga0163163_100056955 80
212 3300014325 Ga0163163_10282735 Ga0163163_102827351 80
213 3300014325 Ga0163163_11565882 Ga0163163_115658821 80
214 3300014968 Ga0157379_10017883 Ga0157379_100178834 80
215 3300014968 Ga0157379_10251034 Ga0157379_102510341 80
216 3300014968 Ga0157379_10659662 Ga0157379_106596622 80
217 3300014969 Ga0157376_10000369 Ga0157376_1000036920 80
218 3300014969 Ga0157376_10101513 Ga0157376_101015133 80
219 3300014969 Ga0157376_10111617 Ga0157376_101116172 80
220 3300017792 Ga0163161_10113188 Ga0163161_101131882 80
221 3300022467 Ga0224712_10288208 Ga0224712_102882082 80
222 3300025315 Ga0207697_10012275 Ga0207697_100122753 80
223 3300025321 Ga0207656_10002068 Ga0207656_100020684 80
224 3300025321 Ga0207656_10052368 Ga0207656_100523681 80
225 3300025321 Ga0207656_10122547 Ga0207656_101225471 80
226 3300025321 Ga0207656_10164114 Ga0207656_101641141 80
227 3300025321 Ga0207656_10303027 Ga0207656_103030271 80
228 3300025321 Ga0207656_10338817 Ga0207656_103388171 80
229 3300025900 Ga0207710_10005046 Ga0207710_100050465 80
230 3300025900 Ga0207710_10093947 Ga0207710_100939472 80
231 3300025900 Ga0207710_10126758 Ga0207710_101267582 80
232 3300025903 Ga0207680_10175940 Ga0207680_101759402 80
233 3300025903 Ga0207680_10217601 Ga0207680_102176013 80
234 3300025904 Ga0207647_10037418 Ga0207647_100374183 80
235 3300025904 Ga0207647_10135470 Ga0207647_101354702 80
236 3300025906 Ga0207699_10871575 Ga0207699_108715751 80
237 3300025907 Ga0207645_10038537 Ga0207645_100385373 80
238 3300025909 Ga0207705_10539213 Ga0207705_105392131 80
239 3300025909 Ga0207705_11040417 Ga0207705_110404171 80
240 3300025911 Ga0207654_10000019 Ga0207654_1000001952 80
241 3300025911 Ga0207654_10001893 Ga0207654_100018933 80
242 3300025911 Ga0207654_10011130 Ga0207654_100111304 80
243 3300025911 Ga0207654_10085894 Ga0207654_100858942 80
244 3300025911 Ga0207654_10203416 Ga0207654_102034162 80
245 3300025911 Ga0207654_11160207 Ga0207654_111602071 80
246 3300025912 Ga0207707_10990207 Ga0207707_109902072 80
247 3300025913 Ga0207695_10000108 Ga0207695_10000108192 80
248 3300025913 Ga0207695_10000871 Ga0207695_1000087119 80
249 3300025913 Ga0207695_10001287 Ga0207695_1000128710 80
250 3300025913 Ga0207695_10002583 Ga0207695_1000258312 80
251 3300025913 Ga0207695_10007296 Ga0207695_100072964 80
252 3300025913 Ga0207695_10165741 Ga0207695_101657413 80
253 3300025913 Ga0207695_10758063 Ga0207695_107580632 80
254 3300025914 Ga0207671_10001258 Ga0207671_1000125820 80
255 3300025914 Ga0207671_10002967 Ga0207671_1000296710 80
256 3300025914 Ga0207671_10034212 Ga0207671_100342123 80
257 3300025914 Ga0207671_10263219 Ga0207671_102632192 80
258 3300025915 Ga0207693_10939301 Ga0207693_109393012 80
259 3300025916 Ga0207663_10055635 Ga0207663_100556352 80
260 3300025917 Ga0207660_10946679 Ga0207660_109466791 80
261 3300025917 Ga0207660_10959360 Ga0207660_109593602 80
262 3300025919 Ga0207657_10486419 Ga0207657_104864191 80
263 3300025920 Ga0207649_10015265 Ga0207649_100152653 80
264 3300025920 Ga0207649_10198155 Ga0207649_101981552 80
265 3300025920 Ga0207649_10897963 Ga0207649_108979631 80
266 3300025920 Ga0207649_11108117 Ga0207649_111081171 80
267 3300025923 Ga0207681_10418159 Ga0207681_104181592 80
268 3300025924 Ga0207694_10000325 Ga0207694_1000032525 80
269 3300025924 Ga0207694_10000671 Ga0207694_1000067115 80
270 3300025924 Ga0207694_10013980 Ga0207694_100139804 80
271 3300025924 Ga0207694_10045986 Ga0207694_100459864 80
272 3300025924 Ga0207694_10155434 Ga0207694_101554343 80
273 3300025925 Ga0207650_10002547 Ga0207650_100025478 80
274 3300025926 Ga0207659_10067200 Ga0207659_100672003 80
275 3300025927 Ga0207687_10014077 Ga0207687_100140771 80
276 3300025927 Ga0207687_10071983 Ga0207687_100719831 80
277 3300025927 Ga0207687_10086096 Ga0207687_100860962 80
278 3300025927 Ga0207687_11097046 Ga0207687_110970462 80
279 3300025927 Ga0207687_11181096 Ga0207687_111810961 80
280 3300025928 Ga0207700_10000956 Ga0207700_1000095613 80
281 3300025928 Ga0207700_10415537 Ga0207700_104155372 80
282 3300025929 Ga0207664_10204587 Ga0207664_102045872 80
283 3300025929 Ga0207664_11625222 Ga0207664_116252221 80
284 3300025931 Ga0207644_10001595 Ga0207644_100015954 80
285 3300025931 Ga0207644_10012397 Ga0207644_100123973 80
286 3300025933 Ga0207706_10023576 Ga0207706_100235765 80
287 3300025934 Ga0207686_10604662 Ga0207686_106046621 80
288 3300025934 Ga0207686_11107879 Ga0207686_111078791 80
289 3300025937 Ga0207669_10391506 Ga0207669_103915061 80
290 3300025938 Ga0207704_10097988 Ga0207704_100979883 80
291 3300025940 Ga0207691_10002490 Ga0207691_100024909 80
292 3300025941 Ga0207711_10048925 Ga0207711_100489253 80
293 3300025941 Ga0207711_10062599 Ga0207711_100625993 80
294 3300025941 Ga0207711_10228240 Ga0207711_102282403 80
295 3300025942 Ga0207689_10000130 Ga0207689_1000013021 80
296 3300025942 Ga0207689_10027632 Ga0207689_100276325 80
297 3300025944 Ga0207661_10036210 Ga0207661_100362102 80
298 3300025944 Ga0207661_10118937 Ga0207661_101189373 80
299 3300025944 Ga0207661_10488376 Ga0207661_104883762 80
300 3300025944 Ga0207661_10579038 Ga0207661_105790382 80
301 3300025945 Ga0207679_10175291 Ga0207679_101752913 80
302 3300025945 Ga0207679_10210201 Ga0207679_102102013 80
303 3300025945 Ga0207679_10316717 Ga0207679_103167173 80
304 3300025945 Ga0207679_11162764 Ga0207679_111627641 80
305 3300025949 Ga0207667_10001508 Ga0207667_1000150819 80
306 3300025949 Ga0207667_10004656 Ga0207667_100046564 80
307 3300025949 Ga0207667_10101220 Ga0207667_101012203 80
308 3300025960 Ga0207651_10102587 Ga0207651_101025873 80
309 3300025961 Ga0207712_10828397 Ga0207712_108283971 80
310 3300025961 Ga0207712_10985529 Ga0207712_109855292 80
311 3300025961 Ga0207712_11830639 Ga0207712_118306392 80
312 3300025972 Ga0207668_10035315 Ga0207668_100353151 80
313 3300025981 Ga0207640_10011694 Ga0207640_100116944 80
314 3300025981 Ga0207640_10219520 Ga0207640_102195201 80
315 3300025986 Ga0207658_10015582 Ga0207658_100155821 80
316 3300025986 Ga0207658_11210393 Ga0207658_112103931 80
317 3300026023 Ga0207677_10005672 Ga0207677_100056721 80
318 3300026023 Ga0207677_10009644 Ga0207677_100096445 80
319 3300026023 Ga0207677_10032881 Ga0207677_100328813 80
320 3300026035 Ga0207703_10009310 Ga0207703_100093104 80
321 3300026035 Ga0207703_10097333 Ga0207703_100973333 80
322 3300026035 Ga0207703_11285521 Ga0207703_112855212 80
323 3300026041 Ga0207639_10000180 Ga0207639_1000018010 80
324 3300026041 Ga0207639_10091164 Ga0207639_100911641 80
325 3300026041 Ga0207639_10106429 Ga0207639_101064293 80
326 3300026041 Ga0207639_10238490 Ga0207639_102384902 80
327 3300026041 Ga0207639_10315987 Ga0207639_103159872 80
328 3300026041 Ga0207639_11327008 Ga0207639_113270082 80
329 3300026067 Ga0207678_10260128 Ga0207678_102601281 80
330 3300026078 Ga0207702_10003238 Ga0207702_100032389 80
331 3300026078 Ga0207702_10041914 Ga0207702_100419142 80
332 3300026078 Ga0207702_10049794 Ga0207702_100497943 80
333 3300026078 Ga0207702_10060667 Ga0207702_100606671 80
334 3300026088 Ga0207641_10018193 Ga0207641_100181932 80
335 3300026088 Ga0207641_10678338 Ga0207641_106783382 80
336 3300026089 Ga0207648_10220642 Ga0207648_102206423 80
337 3300026095 Ga0207676_10042168 Ga0207676_100421683 80
338 3300026095 Ga0207676_10049083 Ga0207676_100490833 80
339 3300026116 Ga0207674_10000910 Ga0207674_100009107 80
340 3300026116 Ga0207674_10001536 Ga0207674_1000153618 80
341 3300026116 Ga0207674_10260350 Ga0207674_102603503 80
342 3300026118 Ga0207675_101644814 Ga0207675_1016448141 80
343 3300026121 Ga0207683_10003953 Ga0207683_100039537 80
344 3300026142 Ga0207698_10000289 Ga0207698_100002896 80
345 3300026142 Ga0207698_10055869 Ga0207698_100558693 80
346 3300026142 Ga0207698_10062099 Ga0207698_100620992 80
347 3300026142 Ga0207698_10242316 Ga0207698_102423162 80
348 3300026142 Ga0207698_10452419 Ga0207698_104524191 80
349 3300026142 Ga0207698_11274878 Ga0207698_112748782 80
350 3300026142 Ga0207698_12319691 Ga0207698_123196911 80
351 3300028379 Ga0268266_10016603 Ga0268266_100166032 80
352 3300028379 Ga0268266_10146846 Ga0268266_101468461 80
353 3300028380 Ga0268265_10709928 Ga0268265_107099282 80
354 3300028381 Ga0268264_10007648 Ga0268264_100076484 80
355 3300028381 Ga0268264_10073960 Ga0268264_100739603 80
356 3300031090 Ga0265760_10378501 Ga0265760_103785012 80
357 3300031241 Ga0265325_10386622 Ga0265325_103866221 80
358 3300031711 Ga0265314_10069846 Ga0265314_100698461 80
359 3300035118 Ga0373954_0504354 Ga0373954_0504354_274_552 80
360 3300035119 Ga0373956_0295809 Ga0373956_0295809_446_724 80
361 3300035120 Ga0373957_0309787 Ga0373957_0309787_299_577 80
362 3300035410 Ga0373924_0341288 Ga0373924_0341288_353_631 80
363 3300035692 Ga0373935_1117348 Ga0373935_1117348_235_513 80
364 3300036401 Ga0373937_0054485 Ga0373937_0054485_200_478 80
365 3300036401 Ga0373937_0177449 Ga0373937_0177449_703_981 80
366 3300036401 Ga0373937_0836372 Ga0373937_0836372_266_544 80
367 3300041496 Ga0451839_0222012 Ga0451839_0222012_134_412 80
368 3300044684 Ga0466966_0562255 Ga0466966_0562255_389_667 80
369 3300045836 Ga0466958_0116482 Ga0466958_0116482_71_349 80
370 3300046459 Ga0495629_0020147 Ga0495629_0020147_2354_2632 80
371 3300046459 Ga0495629_0104781 Ga0495629_0104781_1075_1353 80
372 3300046459 Ga0495629_0288273 Ga0495629_0288273_353_631 80
373 3300046472 Ga0495580_0619222 Ga0495580_0619222_165_443 80
374 3300046511 Ga0495608_0277952 Ga0495608_0277952_203_481 80
375 3300046529 Ga0495652_0974296 Ga0495652_0974296_159_437 80
376 3300046529 Ga0495652_1134925 Ga0495652_1134925_211_489 80
377 3300046531 Ga0495665_0084260 Ga0495665_0084260_575_853 80
378 3300046535 Ga0495586_0302399 Ga0495586_0302399_303_581 80
379 3300046536 Ga0495587_0187684 Ga0495587_0187684_396_674 80
380 3300046543 Ga0495645_0083957 Ga0495645_0083957_1647_1925 80
381 3300046559 Ga0495667_0384319 Ga0495667_0384319_204_482 80
382 3300046559 Ga0495667_0858191 Ga0495667_0858191_207_485 80
383 3300046675 Ga0495657_0706381 Ga0495657_0706381_257_535 80
384 3300046675 Ga0495657_0789978 Ga0495657_0789978_56_334 80
385 3300046678 Ga0495599_0299469 Ga0495599_0299469_186_464 80
386 3300046679 Ga0495623_0123923 Ga0495623_0123923_787_1065 80
387 3300046679 Ga0495623_0128808 Ga0495623_0128808_331_609 80
388 3300046679 Ga0495623_0612098 Ga0495623_0612098_47_325 80
389 3300046683 Ga0495658_0659733 Ga0495658_0659733_21_299 80
390 3300046684 Ga0495669_0021515 Ga0495669_0021515_397_675 80
391 3300046689 Ga0495613_0026749 Ga0495613_0026749_3991_4269 80
392 3300046689 Ga0495613_0121581 Ga0495613_0121581_357_635 80
393 3300046809 Ga0495600_0040357 Ga0495600_0040357_921_1199 80
394 3300046809 Ga0495600_0888577 Ga0495600_0888577_108_386 80
395 3300047315 Ga0495581_0349368 Ga0495581_0349368_136_414 80
396 3300047471 Ga0495684_0497899 Ga0495684_0497899_369_647 80
397 3300048088 Ga0495602_0338471 Ga0495602_0338471_397_675 80
398 3300048088 Ga0495602_0371308 Ga0495602_0371308_378_656 80
399 3300048088 Ga0495602_0404478 Ga0495602_0404478_356_634 80
400 3300048903 Ga0496100_0074736 Ga0496100_0074736_1927_2205 80
401 3300048903 Ga0496100_0208258 Ga0496100_0208258_320_598 80
402 3300048903 Ga0496100_1302456 Ga0496100_1302456_257_535 80
403 3300048905 Ga0496102_1405813 Ga0496102_1405813_128_406 80
404 3300048907 Ga0496104_0007097 Ga0496104_0007097_3869_4147 80
405 3300048907 Ga0496104_0412169 Ga0496104_0412169_743_1021 80
406 3300048908 Ga0496105_0629229 Ga0496105_0629229_67_345 80
407 3300048908 Ga0496105_1077354 Ga0496105_1077354_215_493 80
408 3300048910 Ga0496107_0017766 Ga0496107_0017766_147_425 80
409 3300048912 Ga0496109_0095789 Ga0496109_0095789_1663_1941 80
410 3300048917 Ga0496114_0015202 Ga0496114_0015202_816_1094 80
411 3300048918 Ga0496115_0019162 Ga0496115_0019162_3768_4046 80
412 3300048918 Ga0496115_0052776 Ga0496115_0052776_1110_1388 80
413 3300048918 Ga0496115_0994439 Ga0496115_0994439_153_431 80
414 3300048929 Ga0496126_0003167 Ga0496126_0003167_15775_16053 80
415 2088090002 CNA_F6ESG4R02GBA9Z CNA_00970800 81
416 3300003911 JGI25405J52794_10001170 JGI25405J52794_100011701 81
417 3300005293 Ga0065715_10008377 Ga0065715_100083773 81
418 3300005327 Ga0070658_11276068 Ga0070658_112760682 81
419 3300005329 Ga0070683_100951879 Ga0070683_1009518791 81
420 3300005331 Ga0070670_100141994 Ga0070670_1001419942 81
421 3300005436 Ga0070713_100228197 Ga0070713_1002281972 81
422 3300005436 Ga0070713_100572400 Ga0070713_1005724001 81
423 3300005445 Ga0070708_100045529 Ga0070708_1000455293 81
424 3300005445 Ga0070708_101528059 Ga0070708_1015280592 81
425 3300005458 Ga0070681_10560808 Ga0070681_105608082 81
426 3300005458 Ga0070681_11874233 Ga0070681_118742331 81
427 3300005467 Ga0070706_100022637 Ga0070706_1000226374 81
428 3300005467 Ga0070706_100032432 Ga0070706_1000324323 81
429 3300005467 Ga0070706_101020459 Ga0070706_1010204592 81
430 3300005468 Ga0070707_100077683 Ga0070707_1000776833 81
431 3300005471 Ga0070698_100006879 Ga0070698_1000068798 81
432 3300005536 Ga0070697_100374245 Ga0070697_1003742452 81
433 3300005539 Ga0068853_100183515 Ga0068853_1001835153 81
434 3300005539 Ga0068853_101746298 Ga0068853_1017462982 81
435 3300005548 Ga0070665_100219971 Ga0070665_1002199712 81
436 3300005548 Ga0070665_101289352 Ga0070665_1012893521 81
437 3300005577 Ga0068857_100665242 Ga0068857_1006652422 81
438 3300005616 Ga0068852_100228042 Ga0068852_1002280422 81
439 3300005834 Ga0068851_10857794 Ga0068851_108577942 81
440 3300005937 Ga0081455_10010007 Ga0081455_100100079 81
441 3300005937 Ga0081455_10032038 Ga0081455_100320385 81
442 3300005985 Ga0081539_10007120 Ga0081539_1000712010 81
443 3300006028 Ga0070717_10488087 Ga0070717_104880872 81
444 3300006028 Ga0070717_11520104 Ga0070717_115201041 81
445 3300006173 Ga0070716_100252784 Ga0070716_1002527842 81
446 3300006852 Ga0075433_10972814 Ga0075433_109728142 81
447 3300009093 Ga0105240_10000022 Ga0105240_10000022119 81
448 3300009093 Ga0105240_10220119 Ga0105240_102201193 81
449 3300009093 Ga0105240_11801350 Ga0105240_118013501 81
450 3300009147 Ga0114129_10006405 Ga0114129_100064057 81
451 3300009545 Ga0105237_10706904 Ga0105237_107069041 81
452 3300009551 Ga0105238_10153060 Ga0105238_101530603 81
453 3300010375 Ga0105239_10420565 Ga0105239_104205653 81
454 3300010375 Ga0105239_11785461 Ga0105239_117854611 81
455 3300013296 Ga0157374_10071948 Ga0157374_100719483 81
456 3300013296 Ga0157374_10884046 Ga0157374_108840462 81
457 3300013296 Ga0157374_11382718 Ga0157374_113827181 81
458 3300013297 Ga0157378_12119442 Ga0157378_121194422 81
459 3300013307 Ga0157372_10410556 Ga0157372_104105562 81
460 3300013307 Ga0157372_11418043 Ga0157372_114180431 81
461 3300013307 Ga0157372_12178530 Ga0157372_121785302 81
462 3300013308 Ga0157375_11772190 Ga0157375_117721902 81
463 3300014968 Ga0157379_10574740 Ga0157379_105747402 81
464 3300020069 Ga0197907_10939265 Ga0197907_109392652 81
465 3300020069 Ga0197907_10960766 Ga0197907_109607662 81
466 3300020075 Ga0206349_1436852 Ga0206349_14368522 81
467 3300020077 Ga0206351_10137195 Ga0206351_101371952 81
468 3300020077 Ga0206351_10372312 Ga0206351_103723122 81
469 3300020080 Ga0206350_10557554 Ga0206350_105575542 81
470 3300020080 Ga0206350_11208427 Ga0206350_112084272 81
471 3300020080 Ga0206350_11210002 Ga0206350_112100022 81
472 3300025321 Ga0207656_10589374 Ga0207656_105893742 81
473 3300025910 Ga0207684_10022617 Ga0207684_100226175 81
474 3300025910 Ga0207684_10145246 Ga0207684_101452461 81
475 3300025913 Ga0207695_10000022 Ga0207695_10000022400 81
476 3300025913 Ga0207695_10530693 Ga0207695_105306933 81
477 3300025919 Ga0207657_10515714 Ga0207657_105157142 81
478 3300025922 Ga0207646_10144251 Ga0207646_101442513 81
479 3300025922 Ga0207646_10665189 Ga0207646_106651891 81
480 3300025924 Ga0207694_10444911 Ga0207694_104449112 81
481 3300025928 Ga0207700_11345924 Ga0207700_113459241 81
482 3300025929 Ga0207664_10891350 Ga0207664_108913501 81
483 3300026041 Ga0207639_10197060 Ga0207639_101970603 81
484 3300026041 Ga0207639_11320454 Ga0207639_113204542 81
485 3300026067 Ga0207678_11020842 Ga0207678_110208422 81
486 3300026142 Ga0207698_10580917 Ga0207698_105809172 81
487 3300028379 Ga0268266_10290944 Ga0268266_102909443 81
488 3300028379 Ga0268266_11304103 Ga0268266_113041032 81
489 3300031727 Ga0316576_10075087 Ga0316576_100750873 81
490 3300031728 Ga0316578_10054847 Ga0316578_100548474 81
491 3300032004 Ga0307414_10269968 Ga0307414_102699683 81
492 3300035398 Ga0316574_0399890 Ga0316574_0399890_78_362 81
493 3300036712 Ga0316584_0772232 Ga0316584_0772232_218_502 81
494 3300037068 Ga0373925_0270076 Ga0373925_0270076_665_949 81
495 3300037312 Ga0395899_0875701 Ga0395899_0875701_92_400 81
496 3300037418 Ga0395900_0444131 Ga0395900_0444131_504_788 81
497 3300037418 Ga0395900_1478899 Ga0395900_1478899_47_364 81
498 3300037466 Ga0395898_0520942 Ga0395898_0520942_606_890 81
499 3300037471 Ga0395905_0036044 Ga0395905_0036044_597_899 81
500 3300037471 Ga0395905_0093435 Ga0395905_0093435_1656_1973 81
501 3300037471 Ga0395905_0335955 Ga0395905_0335955_1018_1326 81
502 3300037471 Ga0395905_0898370 Ga0395905_0898370_337_645 81
503 3300037471 Ga0395905_1530944 Ga0395905_1530944_106_390 81
504 3300037853 Ga0436364_0468724 Ga0436364_0468724_258_557 81
505 3300038443 Ga0395901_0399763 Ga0395901_0399763_824_1132 81
506 3300038443 Ga0395901_0899935 Ga0395901_0899935_260_544 81
507 3300038443 Ga0395901_1026862 Ga0395901_1026862_433_735 81
508 3300039450 Ga0436363_0173117 Ga0436363_0173117_83_382 81
509 3300041503 Ga0451847_0630597 Ga0451847_0630597_129_413 81
510 3300041507 Ga0451851_1177581 Ga0451851_1177581_15_299 81
511 3300044673 Ga0453683_0552489 Ga0453683_0552489_366_653 81
512 3300045049 Ga0466959_0428021 Ga0466959_0428021_454_753 81
513 3300045049 Ga0466959_0577353 Ga0466959_0577353_362_670 81
514 3300045051 Ga0451576_1523974 Ga0451576_1523974_355_681 81
515 3300047320 Ga0495672_0001982 Ga0495672_0001982_1135_1416 81
516 3300048907 Ga0496104_1572272 Ga0496104_1572272_10_297 81
517 3300048915 Ga0496112_0183091 Ga0496112_0183091_703_1008 81
518 3300048915 Ga0496112_1791089 Ga0496112_1791089_107_412 81
519 3300048917 Ga0496114_0628914 Ga0496114_0628914_596_886 81
520 3300049568 Ga0501031_0096709 Ga0501031_0096709_527_808 81
521 3300049569 Ga0501032_0032958 Ga0501032_0032958_303_584 81
522 3300049570 Ga0501033_0010077 Ga0501033_0010077_3125_3406 81
523 3300049571 Ga0501034_0006678 Ga0501034_0006678_2437_2718 81
524 3300049572 Ga0501036_0001526 Ga0501036_0001526_8872_9153 81
525 3300049574 Ga0501038_0031468 Ga0501038_0031468_1509_1790 81
526 3300049575 Ga0501039_0415695 Ga0501039_0415695_262_543 81
527 3300049579 Ga0501043_0014657 Ga0501043_0014657_3194_3475 81
528 3300049580 Ga0501046_0012194 Ga0501046_0012194_3198_3479 81
529 3300049582 Ga0501048_0146224 Ga0501048_0146224_644_925 81
530 3300049584 Ga0501068_0130528 Ga0501068_0130528_584_865 81
531 3300049586 Ga0501070_0258061 Ga0501070_0258061_35_316 81
532 3300049589 Ga0501073_0092712 Ga0501073_0092712_1423_1704 81
533 3300049589 Ga0501073_1025172 Ga0501073_1025172_190_471 81
534 3300049590 Ga0501074_0142476 Ga0501074_0142476_1264_1545 81
535 3300049742 Ga0501080_0635442 Ga0501080_0635442_73_354 81
536 3300049822 Ga0501035_0015193 Ga0501035_0015193_1417_1698 81
537 3300049823 Ga0501044_0062717 Ga0501044_0062717_3214_3495 81
538 3300049823 Ga0501044_0163845 Ga0501044_0163845_248_529 81
539 3300050489 nmdc:mga03683_166749_c1 nmdc:mga03683_166749_c1_362_649 81
540 3300050507 nmdc:mga05p37_9008_c1 nmdc:mga05p37_9008_c1_1037_1321 81
541 3300054114 Ga0501084_1630284 Ga0501084_1630284_48_329 81

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01329

Pterin_4a

Pterin 4 alpha carbinolamine dehydratase

3

92

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2v6u-assembly1.cif.gz_A high resolution crystal structure of pterin-4a-carbinolamine dehydratase from toxoplasma gondii 0.964 2 80
1usm-assembly1.cif.gz_A-2 dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant 0.9588 6 79
1uso-assembly1.cif.gz_A dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant 0.9569 7 79
4wil-assembly1.cif.gz_A crystal structure of dcoh2 s51t 0.9514 7 80
1ru0-assembly1.cif.gz_A crystal structure of dcoh2, a paralog of dcoh, the dimerization cofactor of hnf-1 0.9514 7 80
ID Description Score Start End Superfamily
af_Q5ACY8_6_110_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9729 7 81 3.30.1360.20
af_P9WI93_1_93_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9729 4 79 3.30.1360.20
af_O42658_1_95_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.971 7 80 3.30.1360.20
af_Q4CYK3_54_151_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9667 2 81 3.30.1360.20
af_C6S3E6_5_100_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.966 2 79 3.30.1360.20
ID Description Score Start End GO Terms
AF-A0A2V5T007-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 1.005 5 81 GO:0006729
GO:0008124
AF-A0A2V6ANW9-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 1.003 1 81 GO:0006729
GO:0008124
AF-A0A838FUV4-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 1.003 2 81 GO:0006729
GO:0008124
AF-A0A7V9ZYA0-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 1.002 2 81 GO:0006729
GO:0008124
AF-A0A2G9MS73-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 1.002 4 78 GO:0006729
GO:0008124

Feature Viewer

pLDDT pTM Quality
94.63 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map