F461392
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 541 | 234 | 541 | 93 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_1478899|Ga0395900_1478899_47_364 |
| Length | 105 |
| Sequence | MSALLTPEEIQQALRDLPDWTLDGSLIVVNYSFRDFSDALIFVNTVAQEAEQLNHHPDIDIRYNKVRMLLTSHDSGGITRRDTRMAKQISEIYSESKRSDFDTVN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2088090002 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 153 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 154 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 155 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 156 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 158 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 159 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 160 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 161 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 162 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 164 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 165 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 166 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 169 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 171 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 172 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 173 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 174 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 175 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 176 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 177 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 178 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 179 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 180 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 181 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 182 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 183 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 184 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 185 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 207 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 208 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 209 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 210 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 212 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 213 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 214 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 215 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 233 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.15 |
| Metatranscriptomes | 1.85 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.18 |
| Nodule | 0 |
| Rhizoplane | 3.33 |
| Rhizosphere | 94.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNA_F6ESG4R02GBA9Z | 2088090002 | Unclassified | 508 |
| 2 | rootH2_10028640 | 3300003320 | Unclassified | 4061 |
| 3 | rootH2_10250896 | 3300003320 | Bacteria | 2132 |
| 4 | rootH2_10303074 | 3300003320 | Bacteria | 1077 |
| 5 | JGI25405J52794_10001170 | 3300003911 | Bacteria | 4238 |
| 6 | Ga0065715_10008377 | 3300005293 | Bacteria | 3021 |
| 7 | Ga0070658_10023085 | 3300005327 | Unclassified | 4994 |
| 8 | Ga0070658_10077834 | 3300005327 | Unclassified | 2721 |
| 9 | Ga0070658_10345660 | 3300005327 | Viruses | 1273 |
| 10 | Ga0070658_11276068 | 3300005327 | Unclassified | 638 |
| 11 | Ga0070658_11840278 | 3300005327 | Bacteria | 523 |
| 12 | Ga0070676_10017129 | 3300005328 | Bacteria | 4009 |
| 13 | Ga0070683_100012643 | 3300005329 | Bacteria | 7338 |
| 14 | Ga0070683_100078010 | 3300005329 | Bacteria | 3098 |
| 15 | Ga0070683_100143339 | 3300005329 | Unclassified | 2263 |
| 16 | Ga0070683_100149286 | 3300005329 | Bacteria | 2216 |
| 17 | Ga0070683_100185631 | 3300005329 | Bacteria | 1974 |
| 18 | Ga0070683_100951879 | 3300005329 | Unclassified | 824 |
| 19 | Ga0070670_100141994 | 3300005331 | Bacteria | 2077 |
| 20 | Ga0070670_100144513 | 3300005331 | Bacteria | 2058 |
| 21 | Ga0070670_100556625 | 3300005331 | Bacteria | 1023 |
| 22 | Ga0068869_100000547 | 3300005334 | Bacteria | 21002 |
| 23 | Ga0068869_100756063 | 3300005334 | Bacteria | 832 |
| 24 | Ga0070666_10033873 | 3300005335 | Bacteria | 3383 |
| 25 | Ga0070666_10170650 | 3300005335 | Bacteria | 1523 |
| 26 | Ga0070682_100393363 | 3300005337 | Bacteria | 1046 |
| 27 | Ga0070682_101092389 | 3300005337 | Unclassified | 667 |
| 28 | Ga0070682_101382862 | 3300005337 | Unclassified | 601 |
| 29 | Ga0068868_100012614 | 3300005338 | Bacteria | 6180 |
| 30 | Ga0068868_100878521 | 3300005338 | Bacteria | 813 |
| 31 | Ga0070691_10792679 | 3300005341 | Bacteria | 576 |
| 32 | Ga0070661_100001158 | 3300005344 | Bacteria | 18566 |
| 33 | Ga0070661_100229945 | 3300005344 | Bacteria | 1425 |
| 34 | Ga0070661_101050818 | 3300005344 | Unclassified | 677 |
| 35 | Ga0070669_100746205 | 3300005353 | Bacteria | 829 |
| 36 | Ga0070675_100150933 | 3300005354 | Bacteria | 1992 |
| 37 | Ga0070671_100000913 | 3300005355 | Bacteria | 21571 |
| 38 | Ga0070671_100173229 | 3300005355 | Bacteria | 1825 |
| 39 | Ga0070673_100272722 | 3300005364 | Bacteria | 1481 |
| 40 | Ga0070673_100939375 | 3300005364 | Unclassified | 803 |
| 41 | Ga0070667_100008178 | 3300005367 | Bacteria | 8671 |
| 42 | Ga0070667_100104105 | 3300005367 | Bacteria | 2454 |
| 43 | Ga0070709_10444215 | 3300005434 | Unclassified | 976 |
| 44 | Ga0070714_100315957 | 3300005435 | Unclassified | 1460 |
| 45 | Ga0070714_100771470 | 3300005435 | Bacteria | 930 |
| 46 | Ga0070714_102165587 | 3300005435 | Unclassified | 542 |
| 47 | Ga0070713_100002588 | 3300005436 | Bacteria | 11836 |
| 48 | Ga0070713_100228197 | 3300005436 | Bacteria | 1692 |
| 49 | Ga0070713_100572400 | 3300005436 | Bacteria | 1071 |
| 50 | Ga0070711_100083726 | 3300005439 | Unclassified | 2280 |
| 51 | Ga0070708_100045529 | 3300005445 | Bacteria | 3865 |
| 52 | Ga0070708_101528059 | 3300005445 | Bacteria | 622 |
| 53 | Ga0070663_100870700 | 3300005455 | Bacteria | 776 |
| 54 | Ga0070678_100014837 | 3300005456 | Bacteria | 4930 |
| 55 | Ga0070662_100025148 | 3300005457 | Bacteria | 4109 |
| 56 | Ga0070681_10560808 | 3300005458 | Unclassified | 1056 |
| 57 | Ga0070681_11265328 | 3300005458 | Bacteria | 660 |
| 58 | Ga0070681_11874233 | 3300005458 | Unclassified | 527 |
| 59 | Ga0068867_100116760 | 3300005459 | Bacteria | 2057 |
| 60 | Ga0070706_100022637 | 3300005467 | Bacteria | 5787 |
| 61 | Ga0070706_100032432 | 3300005467 | Bacteria | 4818 |
| 62 | Ga0070706_101020459 | 3300005467 | Unclassified | 763 |
| 63 | Ga0070707_100077683 | 3300005468 | Bacteria | 3203 |
| 64 | Ga0070698_100006879 | 3300005471 | Bacteria | 12320 |
| 65 | Ga0070684_100001799 | 3300005535 | Bacteria | 15680 |
| 66 | Ga0070684_100048961 | 3300005535 | Bacteria | 3667 |
| 67 | Ga0070684_100067058 | 3300005535 | Bacteria | 3151 |
| 68 | Ga0070684_100737055 | 3300005535 | Unclassified | 919 |
| 69 | Ga0070697_100374245 | 3300005536 | Bacteria | 1233 |
| 70 | Ga0068853_100009903 | 3300005539 | Bacteria | 7695 |
| 71 | Ga0068853_100028794 | 3300005539 | Bacteria | 4674 |
| 72 | Ga0068853_100074863 | 3300005539 | Bacteria | 2954 |
| 73 | Ga0068853_100183515 | 3300005539 | Bacteria | 1898 |
| 74 | Ga0068853_100324663 | 3300005539 | Bacteria | 1427 |
| 75 | Ga0068853_101746298 | 3300005539 | Unclassified | 603 |
| 76 | Ga0070672_100003630 | 3300005543 | Bacteria | 10014 |
| 77 | Ga0070672_101128068 | 3300005543 | Unclassified | 697 |
| 78 | Ga0070693_100160316 | 3300005547 | Bacteria | 1432 |
| 79 | Ga0070665_100010329 | 3300005548 | Bacteria | 9445 |
| 80 | Ga0070665_100176450 | 3300005548 | Bacteria | 2138 |
| 81 | Ga0070665_100219971 | 3300005548 | Bacteria | 1899 |
| 82 | Ga0070665_101289352 | 3300005548 | Unclassified | 740 |
| 83 | Ga0068855_100012881 | 3300005563 | Bacteria | 10090 |
| 84 | Ga0068855_100064019 | 3300005563 | Bacteria | 4289 |
| 85 | Ga0068855_100078597 | 3300005563 | Bacteria | 3827 |
| 86 | Ga0068855_100295111 | 3300005563 | Bacteria | 1796 |
| 87 | Ga0068855_101931468 | 3300005563 | Unclassified | 597 |
| 88 | Ga0070664_100463853 | 3300005564 | Bacteria | 1164 |
| 89 | Ga0070664_100576324 | 3300005564 | Bacteria | 1042 |
| 90 | Ga0070664_100634650 | 3300005564 | Bacteria | 992 |
| 91 | Ga0068857_100000391 | 3300005577 | Bacteria | 30759 |
| 92 | Ga0068857_100126927 | 3300005577 | Bacteria | 2299 |
| 93 | Ga0068857_100218938 | 3300005577 | Bacteria | 1738 |
| 94 | Ga0068857_100665242 | 3300005577 | Bacteria | 988 |
| 95 | Ga0068854_100018648 | 3300005578 | Bacteria | 4662 |
| 96 | Ga0068854_100226039 | 3300005578 | Bacteria | 1483 |
| 97 | Ga0068854_100300694 | 3300005578 | Bacteria | 1298 |
| 98 | Ga0068856_100003157 | 3300005614 | Bacteria | 16800 |
| 99 | Ga0068856_100072082 | 3300005614 | Bacteria | 3420 |
| 100 | Ga0068856_100074313 | 3300005614 | Bacteria | 3365 |
| 101 | Ga0068856_101591281 | 3300005614 | Bacteria | 667 |
| 102 | Ga0068856_101736398 | 3300005614 | Bacteria | 636 |
| 103 | Ga0070702_101282546 | 3300005615 | Unclassified | 594 |
| 104 | Ga0068852_100000397 | 3300005616 | Bacteria | 29177 |
| 105 | Ga0068852_100029408 | 3300005616 | Bacteria | 4514 |
| 106 | Ga0068852_100064898 | 3300005616 | Unclassified | 3184 |
| 107 | Ga0068852_100076679 | 3300005616 | Bacteria | 2952 |
| 108 | Ga0068852_100168724 | 3300005616 | Bacteria | 2050 |
| 109 | Ga0068852_100228042 | 3300005616 | Bacteria | 1775 |
| 110 | Ga0068852_100718286 | 3300005616 | Unclassified | 1010 |
| 111 | Ga0068852_100982108 | 3300005616 | Unclassified | 863 |
| 112 | Ga0068859_100116949 | 3300005617 | Unclassified | 2731 |
| 113 | Ga0068859_100143413 | 3300005617 | Bacteria | 2462 |
| 114 | Ga0068864_100000424 | 3300005618 | Bacteria | 36475 |
| 115 | Ga0068864_100187212 | 3300005618 | Bacteria | 1896 |
| 116 | Ga0068866_10934256 | 3300005718 | Bacteria | 612 |
| 117 | Ga0068851_10001032 | 3300005834 | Bacteria | 12097 |
| 118 | Ga0068851_10019359 | 3300005834 | Bacteria | 3288 |
| 119 | Ga0068851_10021457 | 3300005834 | Bacteria | 3136 |
| 120 | Ga0068851_10027638 | 3300005834 | Unclassified | 2797 |
| 121 | Ga0068851_10050746 | 3300005834 | Bacteria | 2107 |
| 122 | Ga0068851_10737292 | 3300005834 | Unclassified | 609 |
| 123 | Ga0068851_10857794 | 3300005834 | Unclassified | 567 |
| 124 | Ga0068863_100004144 | 3300005841 | Bacteria | 14324 |
| 125 | Ga0068863_102587506 | 3300005841 | Unclassified | 516 |
| 126 | Ga0068858_100004796 | 3300005842 | Bacteria | 13249 |
| 127 | Ga0068858_100126502 | 3300005842 | Bacteria | 2393 |
| 128 | Ga0068858_101769439 | 3300005842 | Bacteria | 610 |
| 129 | Ga0068860_100003785 | 3300005843 | Bacteria | 15568 |
| 130 | Ga0068860_100175373 | 3300005843 | Bacteria | 2072 |
| 131 | Ga0068862_100046185 | 3300005844 | Unclassified | 3716 |
| 132 | Ga0081455_10010007 | 3300005937 | Bacteria | 9693 |
| 133 | Ga0081455_10032038 | 3300005937 | Bacteria | 4744 |
| 134 | Ga0081539_10007120 | 3300005985 | Bacteria | 10338 |
| 135 | Ga0070717_10488087 | 3300006028 | Bacteria | 1112 |
| 136 | Ga0070717_11082957 | 3300006028 | Unclassified | 730 |
| 137 | Ga0070717_11520104 | 3300006028 | Unclassified | 607 |
| 138 | Ga0070716_100252784 | 3300006173 | Bacteria | 1202 |
| 139 | Ga0097621_100034317 | 3300006237 | Bacteria | 4047 |
| 140 | Ga0097621_100061643 | 3300006237 | Unclassified | 3077 |
| 141 | Ga0097621_100355660 | 3300006237 | Bacteria | 1303 |
| 142 | Ga0068871_100000467 | 3300006358 | Bacteria | 27676 |
| 143 | Ga0068871_100013303 | 3300006358 | Bacteria | 6105 |
| 144 | Ga0068871_100301983 | 3300006358 | Bacteria | 1405 |
| 145 | Ga0075433_10972814 | 3300006852 | Unclassified | 740 |
| 146 | Ga0068865_100164121 | 3300006881 | Bacteria | 1697 |
| 147 | Ga0097620_100116947 | 3300006931 | Unclassified | 2731 |
| 148 | Ga0097620_100143415 | 3300006931 | Bacteria | 2462 |
| 149 | Ga0105240_10000022 | 3300009093 | Bacteria | 387911 |
| 150 | Ga0105240_10001487 | 3300009093 | Bacteria | 39890 |
| 151 | Ga0105240_10001689 | 3300009093 | Bacteria | 37381 |
| 152 | Ga0105240_10004882 | 3300009093 | Bacteria | 20177 |
| 153 | Ga0105240_10006707 | 3300009093 | Bacteria | 16865 |
| 154 | Ga0105240_10060000 | 3300009093 | Bacteria | 4744 |
| 155 | Ga0105240_10220119 | 3300009093 | Bacteria | 2212 |
| 156 | Ga0105240_10283790 | 3300009093 | Unclassified | 1901 |
| 157 | Ga0105240_10335577 | 3300009093 | Bacteria | 1718 |
| 158 | Ga0105240_11801350 | 3300009093 | Bacteria | 638 |
| 159 | Ga0105245_10001275 | 3300009098 | Bacteria | 22730 |
| 160 | Ga0105245_10061460 | 3300009098 | Bacteria | 3387 |
| 161 | Ga0105245_10073223 | 3300009098 | Bacteria | 3114 |
| 162 | Ga0105245_10188716 | 3300009098 | Unclassified | 1973 |
| 163 | Ga0105245_11824590 | 3300009098 | Bacteria | 661 |
| 164 | Ga0105247_10035758 | 3300009101 | Unclassified | 3029 |
| 165 | Ga0105247_10232434 | 3300009101 | Unclassified | 1253 |
| 166 | Ga0105247_10288270 | 3300009101 | Bacteria | 1135 |
| 167 | Ga0114129_10006405 | 3300009147 | Bacteria | 16690 |
| 168 | Ga0105241_10000043 | 3300009174 | Bacteria | 105124 |
| 169 | Ga0105241_10000790 | 3300009174 | Bacteria | 24067 |
| 170 | Ga0105241_10001172 | 3300009174 | Bacteria | 19967 |
| 171 | Ga0105241_10016720 | 3300009174 | Bacteria | 5383 |
| 172 | Ga0105241_10061356 | 3300009174 | Bacteria | 2895 |
| 173 | Ga0105241_10098112 | 3300009174 | Bacteria | 2324 |
| 174 | Ga0105241_11714570 | 3300009174 | Unclassified | 611 |
| 175 | Ga0105242_10142562 | 3300009176 | Bacteria | 2081 |
| 176 | Ga0105242_10564990 | 3300009176 | Bacteria | 1093 |
| 177 | Ga0105248_10001095 | 3300009177 | Bacteria | 29976 |
| 178 | Ga0105248_10011728 | 3300009177 | Bacteria | 9664 |
| 179 | Ga0105248_10186825 | 3300009177 | Bacteria | 2335 |
| 180 | Ga0105248_11710312 | 3300009177 | Bacteria | 713 |
| 181 | Ga0105237_10026359 | 3300009545 | Bacteria | 5940 |
| 182 | Ga0105237_10037235 | 3300009545 | Bacteria | 4919 |
| 183 | Ga0105237_10132860 | 3300009545 | Bacteria | 2483 |
| 184 | Ga0105237_10204243 | 3300009545 | Bacteria | 1976 |
| 185 | Ga0105237_10706904 | 3300009545 | Bacteria | 1014 |
| 186 | Ga0105238_10000801 | 3300009551 | Bacteria | 32620 |
| 187 | Ga0105238_10001399 | 3300009551 | Bacteria | 24200 |
| 188 | Ga0105238_10002233 | 3300009551 | Bacteria | 19538 |
| 189 | Ga0105238_10006437 | 3300009551 | Bacteria | 11684 |
| 190 | Ga0105238_10153060 | 3300009551 | Bacteria | 2281 |
| 191 | Ga0105238_10168020 | 3300009551 | Bacteria | 2169 |
| 192 | Ga0105238_10532198 | 3300009551 | Bacteria | 1178 |
| 193 | Ga0105249_10062108 | 3300009553 | Unclassified | 3430 |
| 194 | Ga0105249_10179277 | 3300009553 | Bacteria | 2060 |
| 195 | Ga0105249_11953297 | 3300009553 | Bacteria | 659 |
| 196 | Ga0105239_10003395 | 3300010375 | Bacteria | 19535 |
| 197 | Ga0105239_10012987 | 3300010375 | Bacteria | 9265 |
| 198 | Ga0105239_10086852 | 3300010375 | Unclassified | 3448 |
| 199 | Ga0105239_10420565 | 3300010375 | Unclassified | 1514 |
| 200 | Ga0105239_11133403 | 3300010375 | Unclassified | 901 |
| 201 | Ga0105239_11256892 | 3300010375 | Unclassified | 854 |
| 202 | Ga0105239_11785461 | 3300010375 | Unclassified | 712 |
| 203 | Ga0105239_13255921 | 3300010375 | Unclassified | 529 |
| 204 | Ga0105246_10080812 | 3300011119 | Unclassified | 2315 |
| 205 | Ga0105246_10177218 | 3300011119 | Bacteria | 1638 |
| 206 | Ga0157373_10115501 | 3300013100 | Bacteria | 1887 |
| 207 | Ga0157371_11541434 | 3300013102 | Bacteria | 519 |
| 208 | Ga0157370_10241249 | 3300013104 | Bacteria | 1672 |
| 209 | Ga0157370_10491960 | 3300013104 | Bacteria | 1127 |
| 210 | Ga0157370_11980478 | 3300013104 | Bacteria | 522 |
| 211 | Ga0157369_10001425 | 3300013105 | Bacteria | 29348 |
| 212 | Ga0157369_10013330 | 3300013105 | Bacteria | 9298 |
| 213 | Ga0157369_10032369 | 3300013105 | Bacteria | 5752 |
| 214 | Ga0157369_10044917 | 3300013105 | Unclassified | 4807 |
| 215 | Ga0157369_10151774 | 3300013105 | Bacteria | 2448 |
| 216 | Ga0157369_10219644 | 3300013105 | Unclassified | 1990 |
| 217 | Ga0157369_10938077 | 3300013105 | Bacteria | 887 |
| 218 | Ga0157369_11573965 | 3300013105 | Unclassified | 668 |
| 219 | Ga0157374_10071948 | 3300013296 | Bacteria | 3262 |
| 220 | Ga0157374_10083575 | 3300013296 | Bacteria | 3033 |
| 221 | Ga0157374_10132451 | 3300013296 | Unclassified | 2413 |
| 222 | Ga0157374_10430890 | 3300013296 | Bacteria | 1318 |
| 223 | Ga0157374_10604152 | 3300013296 | Bacteria | 1107 |
| 224 | Ga0157374_10856183 | 3300013296 | Bacteria | 926 |
| 225 | Ga0157374_10884046 | 3300013296 | Bacteria | 911 |
| 226 | Ga0157374_11232691 | 3300013296 | Unclassified | 770 |
| 227 | Ga0157374_11382718 | 3300013296 | Bacteria | 726 |
| 228 | Ga0157378_10021006 | 3300013297 | Bacteria | 5744 |
| 229 | Ga0157378_10048720 | 3300013297 | Bacteria | 3767 |
| 230 | Ga0157378_10095155 | 3300013297 | Unclassified | 2712 |
| 231 | Ga0157378_10129296 | 3300013297 | Bacteria | 2336 |
| 232 | Ga0157378_11532680 | 3300013297 | Unclassified | 711 |
| 233 | Ga0157378_12119442 | 3300013297 | Unclassified | 613 |
| 234 | Ga0157378_12711352 | 3300013297 | Bacteria | 548 |
| 235 | Ga0163162_10012929 | 3300013306 | Bacteria | 8149 |
| 236 | Ga0163162_10281092 | 3300013306 | Bacteria | 1796 |
| 237 | Ga0157372_10008695 | 3300013307 | Bacteria | 10782 |
| 238 | Ga0157372_10039165 | 3300013307 | Bacteria | 5232 |
| 239 | Ga0157372_10054972 | 3300013307 | Bacteria | 4444 |
| 240 | Ga0157372_10138618 | 3300013307 | Unclassified | 2802 |
| 241 | Ga0157372_10161647 | 3300013307 | Bacteria | 2588 |
| 242 | Ga0157372_10234626 | 3300013307 | Bacteria | 2128 |
| 243 | Ga0157372_10410556 | 3300013307 | Bacteria | 1578 |
| 244 | Ga0157372_10739546 | 3300013307 | Bacteria | 1144 |
| 245 | Ga0157372_10803327 | 3300013307 | Unclassified | 1093 |
| 246 | Ga0157372_11418043 | 3300013307 | Bacteria | 801 |
| 247 | Ga0157372_12178530 | 3300013307 | Unclassified | 637 |
| 248 | Ga0157375_10018458 | 3300013308 | Bacteria | 6327 |
| 249 | Ga0157375_10018613 | 3300013308 | Bacteria | 6301 |
| 250 | Ga0157375_10236145 | 3300013308 | Bacteria | 1987 |
| 251 | Ga0157375_11772190 | 3300013308 | Bacteria | 732 |
| 252 | Ga0163163_10005695 | 3300014325 | Bacteria | 10804 |
| 253 | Ga0163163_10282735 | 3300014325 | Bacteria | 1711 |
| 254 | Ga0163163_11565882 | 3300014325 | Unclassified | 720 |
| 255 | Ga0157379_10017883 | 3300014968 | Bacteria | 6246 |
| 256 | Ga0157379_10251034 | 3300014968 | Bacteria | 1606 |
| 257 | Ga0157379_10574740 | 3300014968 | Bacteria | 1050 |
| 258 | Ga0157379_10659662 | 3300014968 | Unclassified | 980 |
| 259 | Ga0157376_10000369 | 3300014969 | Bacteria | 29606 |
| 260 | Ga0157376_10101513 | 3300014969 | Bacteria | 2514 |
| 261 | Ga0157376_10111617 | 3300014969 | Bacteria | 2407 |
| 262 | Ga0163161_10113188 | 3300017792 | Bacteria | 2031 |
| 263 | Ga0197907_10939265 | 3300020069 | Bacteria | 1202 |
| 264 | Ga0197907_10960766 | 3300020069 | Bacteria | 572 |
| 265 | Ga0206349_1436852 | 3300020075 | Bacteria | 842 |
| 266 | Ga0206351_10137195 | 3300020077 | Bacteria | 652 |
| 267 | Ga0206351_10372312 | 3300020077 | Bacteria | 1248 |
| 268 | Ga0206350_10557554 | 3300020080 | Bacteria | 1392 |
| 269 | Ga0206350_11208427 | 3300020080 | Bacteria | 1056 |
| 270 | Ga0206350_11210002 | 3300020080 | Bacteria | 1197 |
| 271 | Ga0224712_10288208 | 3300022467 | Bacteria | 766 |
| 272 | Ga0207697_10012275 | 3300025315 | Bacteria | 3597 |
| 273 | Ga0207656_10002068 | 3300025321 | Bacteria | 6701 |
| 274 | Ga0207656_10052368 | 3300025321 | Bacteria | 1768 |
| 275 | Ga0207656_10122547 | 3300025321 | Unclassified | 1211 |
| 276 | Ga0207656_10164114 | 3300025321 | Bacteria | 1059 |
| 277 | Ga0207656_10303027 | 3300025321 | Unclassified | 791 |
| 278 | Ga0207656_10338817 | 3300025321 | Bacteria | 749 |
| 279 | Ga0207656_10589374 | 3300025321 | Unclassified | 567 |
| 280 | Ga0207710_10005046 | 3300025900 | Bacteria | 5720 |
| 281 | Ga0207710_10093947 | 3300025900 | Bacteria | 1407 |
| 282 | Ga0207710_10126758 | 3300025900 | Unclassified | 1223 |
| 283 | Ga0207680_10175940 | 3300025903 | Bacteria | 1444 |
| 284 | Ga0207680_10217601 | 3300025903 | Bacteria | 1308 |
| 285 | Ga0207647_10037418 | 3300025904 | Bacteria | 3077 |
| 286 | Ga0207647_10135470 | 3300025904 | Bacteria | 1446 |
| 287 | Ga0207699_10871575 | 3300025906 | Unclassified | 664 |
| 288 | Ga0207645_10038537 | 3300025907 | Bacteria | 3064 |
| 289 | Ga0207705_10539213 | 3300025909 | Unclassified | 907 |
| 290 | Ga0207705_11040417 | 3300025909 | Bacteria | 632 |
| 291 | Ga0207684_10022617 | 3300025910 | Bacteria | 5366 |
| 292 | Ga0207684_10145246 | 3300025910 | Bacteria | 2040 |
| 293 | Ga0207654_10000019 | 3300025911 | Bacteria | 171031 |
| 294 | Ga0207654_10001893 | 3300025911 | Bacteria | 10853 |
| 295 | Ga0207654_10011130 | 3300025911 | Bacteria | 4579 |
| 296 | Ga0207654_10085894 | 3300025911 | Bacteria | 1906 |
| 297 | Ga0207654_10203416 | 3300025911 | Bacteria | 1305 |
| 298 | Ga0207654_11160207 | 3300025911 | Unclassified | 563 |
| 299 | Ga0207707_10990207 | 3300025912 | Bacteria | 690 |
| 300 | Ga0207695_10000022 | 3300025913 | Bacteria | 659090 |
| 301 | Ga0207695_10000108 | 3300025913 | Bacteria | 252306 |
| 302 | Ga0207695_10000871 | 3300025913 | Bacteria | 54947 |
| 303 | Ga0207695_10001287 | 3300025913 | Bacteria | 42580 |
| 304 | Ga0207695_10002583 | 3300025913 | Bacteria | 26559 |
| 305 | Ga0207695_10007296 | 3300025913 | Bacteria | 14115 |
| 306 | Ga0207695_10165741 | 3300025913 | Unclassified | 2138 |
| 307 | Ga0207695_10530693 | 3300025913 | Bacteria | 1058 |
| 308 | Ga0207695_10758063 | 3300025913 | Bacteria | 851 |
| 309 | Ga0207671_10001258 | 3300025914 | Bacteria | 29873 |
| 310 | Ga0207671_10002967 | 3300025914 | Bacteria | 17438 |
| 311 | Ga0207671_10034212 | 3300025914 | Bacteria | 3777 |
| 312 | Ga0207671_10263219 | 3300025914 | Bacteria | 1357 |
| 313 | Ga0207693_10939301 | 3300025915 | Unclassified | 662 |
| 314 | Ga0207663_10055635 | 3300025916 | Unclassified | 2484 |
| 315 | Ga0207660_10946679 | 3300025917 | Bacteria | 703 |
| 316 | Ga0207660_10959360 | 3300025917 | Bacteria | 698 |
| 317 | Ga0207657_10486419 | 3300025919 | Unclassified | 967 |
| 318 | Ga0207657_10515714 | 3300025919 | Bacteria | 936 |
| 319 | Ga0207649_10015265 | 3300025920 | Bacteria | 4316 |
| 320 | Ga0207649_10198155 | 3300025920 | Bacteria | 1417 |
| 321 | Ga0207649_10897963 | 3300025920 | Unclassified | 695 |
| 322 | Ga0207649_11108117 | 3300025920 | Bacteria | 625 |
| 323 | Ga0207646_10144251 | 3300025922 | Bacteria | 2145 |
| 324 | Ga0207646_10665189 | 3300025922 | Unclassified | 932 |
| 325 | Ga0207681_10418159 | 3300025923 | Bacteria | 1086 |
| 326 | Ga0207694_10000325 | 3300025924 | Bacteria | 44875 |
| 327 | Ga0207694_10000671 | 3300025924 | Bacteria | 30684 |
| 328 | Ga0207694_10013980 | 3300025924 | Bacteria | 6052 |
| 329 | Ga0207694_10045986 | 3300025924 | Unclassified | 3373 |
| 330 | Ga0207694_10155434 | 3300025924 | Bacteria | 1844 |
| 331 | Ga0207694_10444911 | 3300025924 | Bacteria | 1081 |
| 332 | Ga0207650_10002547 | 3300025925 | Bacteria | 12635 |
| 333 | Ga0207659_10067200 | 3300025926 | Bacteria | 2603 |
| 334 | Ga0207687_10014077 | 3300025927 | Bacteria | 5231 |
| 335 | Ga0207687_10071983 | 3300025927 | Bacteria | 2471 |
| 336 | Ga0207687_10086096 | 3300025927 | Bacteria | 2281 |
| 337 | Ga0207687_11097046 | 3300025927 | Bacteria | 683 |
| 338 | Ga0207687_11181096 | 3300025927 | Unclassified | 658 |
| 339 | Ga0207700_10000956 | 3300025928 | Bacteria | 16649 |
| 340 | Ga0207700_10415537 | 3300025928 | Unclassified | 1181 |
| 341 | Ga0207700_11345924 | 3300025928 | Bacteria | 636 |
| 342 | Ga0207664_10204587 | 3300025929 | Bacteria | 1705 |
| 343 | Ga0207664_10891350 | 3300025929 | Unclassified | 799 |
| 344 | Ga0207664_11625222 | 3300025929 | Unclassified | 568 |
| 345 | Ga0207644_10001595 | 3300025931 | Bacteria | 14640 |
| 346 | Ga0207644_10012397 | 3300025931 | Bacteria | 5661 |
| 347 | Ga0207706_10023576 | 3300025933 | Bacteria | 5525 |
| 348 | Ga0207686_10604662 | 3300025934 | Bacteria | 863 |
| 349 | Ga0207686_11107879 | 3300025934 | Bacteria | 646 |
| 350 | Ga0207669_10391506 | 3300025937 | Bacteria | 1086 |
| 351 | Ga0207704_10097988 | 3300025938 | Bacteria | 1946 |
| 352 | Ga0207691_10002490 | 3300025940 | Bacteria | 18013 |
| 353 | Ga0207711_10048925 | 3300025941 | Unclassified | 3618 |
| 354 | Ga0207711_10062599 | 3300025941 | Bacteria | 3209 |
| 355 | Ga0207711_10228240 | 3300025941 | Bacteria | 1705 |
| 356 | Ga0207689_10000130 | 3300025942 | Bacteria | 63848 |
| 357 | Ga0207689_10027632 | 3300025942 | Bacteria | 4748 |
| 358 | Ga0207661_10036210 | 3300025944 | Bacteria | 3851 |
| 359 | Ga0207661_10118937 | 3300025944 | Bacteria | 2247 |
| 360 | Ga0207661_10488376 | 3300025944 | Bacteria | 1125 |
| 361 | Ga0207661_10579038 | 3300025944 | Unclassified | 1029 |
| 362 | Ga0207679_10175291 | 3300025945 | Bacteria | 1769 |
| 363 | Ga0207679_10210201 | 3300025945 | Bacteria | 1631 |
| 364 | Ga0207679_10316717 | 3300025945 | Bacteria | 1349 |
| 365 | Ga0207679_11162764 | 3300025945 | Bacteria | 708 |
| 366 | Ga0207667_10001508 | 3300025949 | Bacteria | 29221 |
| 367 | Ga0207667_10004656 | 3300025949 | Bacteria | 16811 |
| 368 | Ga0207667_10101220 | 3300025949 | Bacteria | 2972 |
| 369 | Ga0207651_10102587 | 3300025960 | Bacteria | 2127 |
| 370 | Ga0207712_10828397 | 3300025961 | Bacteria | 815 |
| 371 | Ga0207712_10985529 | 3300025961 | Bacteria | 747 |
| 372 | Ga0207712_11830639 | 3300025961 | Unclassified | 544 |
| 373 | Ga0207668_10035315 | 3300025972 | Bacteria | 3327 |
| 374 | Ga0207640_10011694 | 3300025981 | Bacteria | 4975 |
| 375 | Ga0207640_10219520 | 3300025981 | Bacteria | 1454 |
| 376 | Ga0207658_10015582 | 3300025986 | Bacteria | 5215 |
| 377 | Ga0207658_11210393 | 3300025986 | Bacteria | 690 |
| 378 | Ga0207677_10005672 | 3300026023 | Bacteria | 6791 |
| 379 | Ga0207677_10009644 | 3300026023 | Bacteria | 5435 |
| 380 | Ga0207677_10032881 | 3300026023 | Bacteria | 3339 |
| 381 | Ga0207703_10009310 | 3300026035 | Bacteria | 7721 |
| 382 | Ga0207703_10097333 | 3300026035 | Bacteria | 2486 |
| 383 | Ga0207703_11285521 | 3300026035 | Bacteria | 704 |
| 384 | Ga0207639_10000180 | 3300026041 | Bacteria | 49455 |
| 385 | Ga0207639_10091164 | 3300026041 | Bacteria | 2440 |
| 386 | Ga0207639_10106429 | 3300026041 | Unclassified | 2277 |
| 387 | Ga0207639_10197060 | 3300026041 | Bacteria | 1724 |
| 388 | Ga0207639_10238490 | 3300026041 | Bacteria | 1580 |
| 389 | Ga0207639_10315987 | 3300026041 | Bacteria | 1385 |
| 390 | Ga0207639_11320454 | 3300026041 | Bacteria | 677 |
| 391 | Ga0207639_11327008 | 3300026041 | Unclassified | 675 |
| 392 | Ga0207678_10260128 | 3300026067 | Bacteria | 1487 |
| 393 | Ga0207678_11020842 | 3300026067 | Unclassified | 732 |
| 394 | Ga0207702_10003238 | 3300026078 | Bacteria | 15038 |
| 395 | Ga0207702_10041914 | 3300026078 | Bacteria | 3839 |
| 396 | Ga0207702_10049794 | 3300026078 | Bacteria | 3535 |
| 397 | Ga0207702_10060667 | 3300026078 | Bacteria | 3224 |
| 398 | Ga0207641_10018193 | 3300026088 | Bacteria | 5760 |
| 399 | Ga0207641_10678338 | 3300026088 | Bacteria | 1014 |
| 400 | Ga0207648_10220642 | 3300026089 | Bacteria | 1685 |
| 401 | Ga0207676_10042168 | 3300026095 | Unclassified | 3508 |
| 402 | Ga0207676_10049083 | 3300026095 | Bacteria | 3281 |
| 403 | Ga0207674_10000910 | 3300026116 | Bacteria | 38534 |
| 404 | Ga0207674_10001536 | 3300026116 | Bacteria | 29733 |
| 405 | Ga0207674_10260350 | 3300026116 | Bacteria | 1682 |
| 406 | Ga0207675_101644814 | 3300026118 | Unclassified | 662 |
| 407 | Ga0207683_10003953 | 3300026121 | Bacteria | 12862 |
| 408 | Ga0207698_10000289 | 3300026142 | Bacteria | 30526 |
| 409 | Ga0207698_10055869 | 3300026142 | Bacteria | 3045 |
| 410 | Ga0207698_10062099 | 3300026142 | Bacteria | 2916 |
| 411 | Ga0207698_10242316 | 3300026142 | Bacteria | 1644 |
| 412 | Ga0207698_10452419 | 3300026142 | Unclassified | 1240 |
| 413 | Ga0207698_10580917 | 3300026142 | Bacteria | 1102 |
| 414 | Ga0207698_11274878 | 3300026142 | Unclassified | 749 |
| 415 | Ga0207698_12319691 | 3300026142 | Unclassified | 548 |
| 416 | Ga0268266_10016603 | 3300028379 | Bacteria | 6291 |
| 417 | Ga0268266_10146846 | 3300028379 | Bacteria | 2121 |
| 418 | Ga0268266_10290944 | 3300028379 | Bacteria | 1521 |
| 419 | Ga0268266_11304103 | 3300028379 | Unclassified | 701 |
| 420 | Ga0268265_10709928 | 3300028380 | Unclassified | 972 |
| 421 | Ga0268264_10007648 | 3300028381 | Bacteria | 9007 |
| 422 | Ga0268264_10073960 | 3300028381 | Bacteria | 2894 |
| 423 | Ga0265338_10161718 | 3300028800 | Bacteria | 1728 |
| 424 | Ga0265760_10378501 | 3300031090 | Unclassified | 509 |
| 425 | Ga0265325_10386622 | 3300031241 | Unclassified | 614 |
| 426 | Ga0265329_10212005 | 3300031242 | Bacteria | 639 |
| 427 | Ga0265339_10000324 | 3300031249 | Bacteria | 38292 |
| 428 | Ga0265316_10179949 | 3300031344 | Bacteria | 1574 |
| 429 | Ga0265314_10008824 | 3300031711 | Bacteria | 8611 |
| 430 | Ga0265314_10069846 | 3300031711 | Bacteria | 2356 |
| 431 | Ga0265342_10112777 | 3300031712 | Bacteria | 1537 |
| 432 | Ga0316576_10075087 | 3300031727 | Bacteria | 2500 |
| 433 | Ga0316578_10054847 | 3300031728 | Bacteria | 2338 |
| 434 | Ga0307414_10269968 | 3300032004 | Unclassified | 1424 |
| 435 | Ga0373954_0504354 | 3300035118 | Bacteria | 599 |
| 436 | Ga0373956_0295809 | 3300035119 | Bacteria | 771 |
| 437 | Ga0373957_0309787 | 3300035120 | Unclassified | 670 |
| 438 | Ga0316574_0399890 | 3300035398 | Bacteria | 865 |
| 439 | Ga0373924_0341288 | 3300035410 | Bacteria | 667 |
| 440 | Ga0373935_1117348 | 3300035692 | Unclassified | 587 |
| 441 | Ga0373937_0054485 | 3300036401 | Bacteria | 3670 |
| 442 | Ga0373937_0177449 | 3300036401 | Bacteria | 2000 |
| 443 | Ga0373937_0836372 | 3300036401 | Bacteria | 869 |
| 444 | Ga0316584_0772232 | 3300036712 | Bacteria | 654 |
| 445 | Ga0373925_0270076 | 3300037068 | Bacteria | 1368 |
| 446 | Ga0395899_0875701 | 3300037312 | Bacteria | 549 |
| 447 | Ga0395900_0444131 | 3300037418 | Bacteria | 1254 |
| 448 | Ga0395900_1478899 | 3300037418 | Bacteria | 592 |
| 449 | Ga0395898_0520942 | 3300037466 | Bacteria | 1130 |
| 450 | Ga0395905_0036044 | 3300037471 | Bacteria | 4646 |
| 451 | Ga0395905_0093435 | 3300037471 | Bacteria | 2821 |
| 452 | Ga0395905_0335955 | 3300037471 | Unclassified | 1402 |
| 453 | Ga0395905_0553805 | 3300037471 | Bacteria | 1051 |
| 454 | Ga0395905_0898370 | 3300037471 | Unclassified | 789 |
| 455 | Ga0395905_1530944 | 3300037471 | Bacteria | 571 |
| 456 | Ga0436364_0468724 | 3300037853 | Bacteria | 928 |
| 457 | Ga0395901_0399763 | 3300038443 | Bacteria | 1412 |
| 458 | Ga0395901_0899935 | 3300038443 | Bacteria | 867 |
| 459 | Ga0395901_1026862 | 3300038443 | Unclassified | 799 |
| 460 | Ga0436363_0173117 | 3300039450 | Bacteria | 667 |
| 461 | Ga0451839_0222012 | 3300041496 | Unclassified | 583 |
| 462 | Ga0451847_0630597 | 3300041503 | Bacteria | 615 |
| 463 | Ga0451851_1177581 | 3300041507 | Bacteria | 768 |
| 464 | Ga0453683_0552489 | 3300044673 | Bacteria | 749 |
| 465 | Ga0466966_0562255 | 3300044684 | Unclassified | 686 |
| 466 | Ga0466959_0428021 | 3300045049 | Bacteria | 898 |
| 467 | Ga0466959_0577353 | 3300045049 | Bacteria | 757 |
| 468 | Ga0451576_1523974 | 3300045051 | Bacteria | 694 |
| 469 | Ga0466958_0116482 | 3300045836 | Bacteria | 1670 |
| 470 | Ga0495629_0020147 | 3300046459 | Bacteria | 4762 |
| 471 | Ga0495629_0104781 | 3300046459 | Bacteria | 1973 |
| 472 | Ga0495629_0288273 | 3300046459 | Bacteria | 1126 |
| 473 | Ga0495580_0619222 | 3300046472 | Bacteria | 714 |
| 474 | Ga0495608_0277952 | 3300046511 | Bacteria | 1040 |
| 475 | Ga0495652_0974296 | 3300046529 | Bacteria | 556 |
| 476 | Ga0495652_1134925 | 3300046529 | Unclassified | 506 |
| 477 | Ga0495665_0084260 | 3300046531 | Bacteria | 1671 |
| 478 | Ga0495586_0302399 | 3300046535 | Bacteria | 917 |
| 479 | Ga0495587_0187684 | 3300046536 | Bacteria | 1171 |
| 480 | Ga0495645_0083957 | 3300046543 | Bacteria | 2282 |
| 481 | Ga0495667_0384319 | 3300046559 | Bacteria | 885 |
| 482 | Ga0495667_0858191 | 3300046559 | Unclassified | 558 |
| 483 | Ga0495657_0706381 | 3300046675 | Unclassified | 579 |
| 484 | Ga0495657_0789978 | 3300046675 | Bacteria | 543 |
| 485 | Ga0495599_0299469 | 3300046678 | Bacteria | 971 |
| 486 | Ga0495623_0123923 | 3300046679 | Bacteria | 1553 |
| 487 | Ga0495623_0128808 | 3300046679 | Bacteria | 1518 |
| 488 | Ga0495623_0612098 | 3300046679 | Unclassified | 565 |
| 489 | Ga0495658_0659733 | 3300046683 | Bacteria | 670 |
| 490 | Ga0495669_0021515 | 3300046684 | Bacteria | 2800 |
| 491 | Ga0495613_0026749 | 3300046689 | Unclassified | 4297 |
| 492 | Ga0495613_0121581 | 3300046689 | Bacteria | 1875 |
| 493 | Ga0495600_0040357 | 3300046809 | Bacteria | 3039 |
| 494 | Ga0495600_0888577 | 3300046809 | Bacteria | 526 |
| 495 | Ga0495581_0349368 | 3300047315 | Bacteria | 863 |
| 496 | Ga0495672_0001982 | 3300047320 | Bacteria | 19333 |
| 497 | Ga0495684_0497899 | 3300047471 | Bacteria | 838 |
| 498 | Ga0495602_0338471 | 3300048088 | Bacteria | 1089 |
| 499 | Ga0495602_0371308 | 3300048088 | Bacteria | 1027 |
| 500 | Ga0495602_0404478 | 3300048088 | Bacteria | 973 |
| 501 | Ga0496100_0074736 | 3300048903 | Unclassified | 2271 |
| 502 | Ga0496100_0208258 | 3300048903 | Bacteria | 1429 |
| 503 | Ga0496100_1302456 | 3300048903 | Unclassified | 573 |
| 504 | Ga0496102_1405813 | 3300048905 | Unclassified | 617 |
| 505 | Ga0496104_0007097 | 3300048907 | Bacteria | 9875 |
| 506 | Ga0496104_0412169 | 3300048907 | Unclassified | 1263 |
| 507 | Ga0496104_1572272 | 3300048907 | Unclassified | 560 |
| 508 | Ga0496105_0629229 | 3300048908 | Unclassified | 830 |
| 509 | Ga0496105_1077354 | 3300048908 | Bacteria | 598 |
| 510 | Ga0496107_0017766 | 3300048910 | Bacteria | 5005 |
| 511 | Ga0496109_0095789 | 3300048912 | Bacteria | 2749 |
| 512 | Ga0496112_0183091 | 3300048915 | Bacteria | 2059 |
| 513 | Ga0496112_1791089 | 3300048915 | Unclassified | 526 |
| 514 | Ga0496114_0015202 | 3300048917 | Bacteria | 6188 |
| 515 | Ga0496114_0628914 | 3300048917 | Unclassified | 945 |
| 516 | Ga0496115_0019162 | 3300048918 | Bacteria | 5263 |
| 517 | Ga0496115_0052776 | 3300048918 | Bacteria | 3262 |
| 518 | Ga0496115_0994439 | 3300048918 | Bacteria | 641 |
| 519 | Ga0496126_0003167 | 3300048929 | Bacteria | 21188 |
| 520 | Ga0501031_0096709 | 3300049568 | Bacteria | 1927 |
| 521 | Ga0501032_0032958 | 3300049569 | Bacteria | 3550 |
| 522 | Ga0501033_0010077 | 3300049570 | Bacteria | 7251 |
| 523 | Ga0501034_0006678 | 3300049571 | Bacteria | 12374 |
| 524 | Ga0501036_0001526 | 3300049572 | Bacteria | 17871 |
| 525 | Ga0501038_0031468 | 3300049574 | Bacteria | 4688 |
| 526 | Ga0501039_0415695 | 3300049575 | Bacteria | 1056 |
| 527 | Ga0501043_0014657 | 3300049579 | Bacteria | 6137 |
| 528 | Ga0501046_0012194 | 3300049580 | Bacteria | 7324 |
| 529 | Ga0501048_0146224 | 3300049582 | Bacteria | 1672 |
| 530 | Ga0501068_0130528 | 3300049584 | Bacteria | 1571 |
| 531 | Ga0501070_0258061 | 3300049586 | Bacteria | 1425 |
| 532 | Ga0501073_0092712 | 3300049589 | Bacteria | 2099 |
| 533 | Ga0501073_1025172 | 3300049589 | Bacteria | 568 |
| 534 | Ga0501074_0142476 | 3300049590 | Bacteria | 1714 |
| 535 | Ga0501080_0635442 | 3300049742 | Bacteria | 945 |
| 536 | Ga0501035_0015193 | 3300049822 | Bacteria | 7106 |
| 537 | Ga0501044_0062717 | 3300049823 | Bacteria | 3798 |
| 538 | Ga0501044_0163845 | 3300049823 | Bacteria | 2198 |
| 539 | nmdc:mga03683_166749_c1 | 3300050489 | Unclassified | 999 |
| 540 | nmdc:mga05p37_9008_c1 | 3300050507 | Bacteria | 11803 |
| 541 | Ga0501084_1630284 | 3300054114 | Bacteria | 539 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013100 | Ga0157373_10115501 | Ga0157373_101155013 | 79 |
| 2 | 3300013104 | Ga0157370_10241249 | Ga0157370_102412493 | 79 |
| 3 | 3300028800 | Ga0265338_10161718 | Ga0265338_101617182 | 79 |
| 4 | 3300031242 | Ga0265329_10212005 | Ga0265329_102120051 | 79 |
| 5 | 3300031249 | Ga0265339_10000324 | Ga0265339_1000032430 | 79 |
| 6 | 3300031344 | Ga0265316_10179949 | Ga0265316_101799492 | 79 |
| 7 | 3300031711 | Ga0265314_10008824 | Ga0265314_100088244 | 79 |
| 8 | 3300031712 | Ga0265342_10112777 | Ga0265342_101127771 | 79 |
| 9 | 3300037471 | Ga0395905_0553805 | Ga0395905_0553805_753_1028 | 79 |
| 10 | 3300003320 | rootH2_10028640 | rootH2_100286403 | 80 |
| 11 | 3300003320 | rootH2_10250896 | rootH2_102508961 | 80 |
| 12 | 3300003320 | rootH2_10303074 | rootH2_103030741 | 80 |
| 13 | 3300005327 | Ga0070658_10023085 | Ga0070658_100230853 | 80 |
| 14 | 3300005327 | Ga0070658_10077834 | Ga0070658_100778342 | 80 |
| 15 | 3300005327 | Ga0070658_10345660 | Ga0070658_103456602 | 80 |
| 16 | 3300005327 | Ga0070658_11840278 | Ga0070658_118402781 | 80 |
| 17 | 3300005328 | Ga0070676_10017129 | Ga0070676_100171294 | 80 |
| 18 | 3300005329 | Ga0070683_100012643 | Ga0070683_1000126434 | 80 |
| 19 | 3300005329 | Ga0070683_100078010 | Ga0070683_1000780102 | 80 |
| 20 | 3300005329 | Ga0070683_100143339 | Ga0070683_1001433392 | 80 |
| 21 | 3300005329 | Ga0070683_100149286 | Ga0070683_1001492863 | 80 |
| 22 | 3300005329 | Ga0070683_100185631 | Ga0070683_1001856313 | 80 |
| 23 | 3300005331 | Ga0070670_100144513 | Ga0070670_1001445133 | 80 |
| 24 | 3300005331 | Ga0070670_100556625 | Ga0070670_1005566252 | 80 |
| 25 | 3300005334 | Ga0068869_100000547 | Ga0068869_1000005473 | 80 |
| 26 | 3300005334 | Ga0068869_100756063 | Ga0068869_1007560631 | 80 |
| 27 | 3300005335 | Ga0070666_10033873 | Ga0070666_100338733 | 80 |
| 28 | 3300005335 | Ga0070666_10170650 | Ga0070666_101706502 | 80 |
| 29 | 3300005337 | Ga0070682_100393363 | Ga0070682_1003933632 | 80 |
| 30 | 3300005337 | Ga0070682_101092389 | Ga0070682_1010923891 | 80 |
| 31 | 3300005337 | Ga0070682_101382862 | Ga0070682_1013828621 | 80 |
| 32 | 3300005338 | Ga0068868_100012614 | Ga0068868_1000126145 | 80 |
| 33 | 3300005338 | Ga0068868_100878521 | Ga0068868_1008785212 | 80 |
| 34 | 3300005341 | Ga0070691_10792679 | Ga0070691_107926791 | 80 |
| 35 | 3300005344 | Ga0070661_100001158 | Ga0070661_1000011584 | 80 |
| 36 | 3300005344 | Ga0070661_100229945 | Ga0070661_1002299452 | 80 |
| 37 | 3300005344 | Ga0070661_101050818 | Ga0070661_1010508181 | 80 |
| 38 | 3300005353 | Ga0070669_100746205 | Ga0070669_1007462051 | 80 |
| 39 | 3300005354 | Ga0070675_100150933 | Ga0070675_1001509332 | 80 |
| 40 | 3300005355 | Ga0070671_100000913 | Ga0070671_1000009133 | 80 |
| 41 | 3300005355 | Ga0070671_100173229 | Ga0070671_1001732293 | 80 |
| 42 | 3300005364 | Ga0070673_100272722 | Ga0070673_1002727222 | 80 |
| 43 | 3300005364 | Ga0070673_100939375 | Ga0070673_1009393752 | 80 |
| 44 | 3300005367 | Ga0070667_100008178 | Ga0070667_1000081786 | 80 |
| 45 | 3300005367 | Ga0070667_100104105 | Ga0070667_1001041052 | 80 |
| 46 | 3300005434 | Ga0070709_10444215 | Ga0070709_104442152 | 80 |
| 47 | 3300005435 | Ga0070714_100315957 | Ga0070714_1003159572 | 80 |
| 48 | 3300005435 | Ga0070714_100771470 | Ga0070714_1007714701 | 80 |
| 49 | 3300005435 | Ga0070714_102165587 | Ga0070714_1021655871 | 80 |
| 50 | 3300005436 | Ga0070713_100002588 | Ga0070713_1000025885 | 80 |
| 51 | 3300005439 | Ga0070711_100083726 | Ga0070711_1000837262 | 80 |
| 52 | 3300005455 | Ga0070663_100870700 | Ga0070663_1008707002 | 80 |
| 53 | 3300005456 | Ga0070678_100014837 | Ga0070678_1000148374 | 80 |
| 54 | 3300005457 | Ga0070662_100025148 | Ga0070662_1000251482 | 80 |
| 55 | 3300005458 | Ga0070681_11265328 | Ga0070681_112653282 | 80 |
| 56 | 3300005459 | Ga0068867_100116760 | Ga0068867_1001167601 | 80 |
| 57 | 3300005535 | Ga0070684_100001799 | Ga0070684_1000017995 | 80 |
| 58 | 3300005535 | Ga0070684_100048961 | Ga0070684_1000489612 | 80 |
| 59 | 3300005535 | Ga0070684_100067058 | Ga0070684_1000670584 | 80 |
| 60 | 3300005535 | Ga0070684_100737055 | Ga0070684_1007370552 | 80 |
| 61 | 3300005539 | Ga0068853_100009903 | Ga0068853_1000099032 | 80 |
| 62 | 3300005539 | Ga0068853_100028794 | Ga0068853_1000287945 | 80 |
| 63 | 3300005539 | Ga0068853_100074863 | Ga0068853_1000748633 | 80 |
| 64 | 3300005539 | Ga0068853_100324663 | Ga0068853_1003246632 | 80 |
| 65 | 3300005543 | Ga0070672_100003630 | Ga0070672_1000036308 | 80 |
| 66 | 3300005543 | Ga0070672_101128068 | Ga0070672_1011280682 | 80 |
| 67 | 3300005547 | Ga0070693_100160316 | Ga0070693_1001603161 | 80 |
| 68 | 3300005548 | Ga0070665_100010329 | Ga0070665_1000103297 | 80 |
| 69 | 3300005548 | Ga0070665_100176450 | Ga0070665_1001764501 | 80 |
| 70 | 3300005563 | Ga0068855_100012881 | Ga0068855_1000128814 | 80 |
| 71 | 3300005563 | Ga0068855_100064019 | Ga0068855_1000640194 | 80 |
| 72 | 3300005563 | Ga0068855_100078597 | Ga0068855_1000785973 | 80 |
| 73 | 3300005563 | Ga0068855_100295111 | Ga0068855_1002951113 | 80 |
| 74 | 3300005563 | Ga0068855_101931468 | Ga0068855_1019314682 | 80 |
| 75 | 3300005564 | Ga0070664_100463853 | Ga0070664_1004638531 | 80 |
| 76 | 3300005564 | Ga0070664_100576324 | Ga0070664_1005763241 | 80 |
| 77 | 3300005564 | Ga0070664_100634650 | Ga0070664_1006346502 | 80 |
| 78 | 3300005577 | Ga0068857_100000391 | Ga0068857_1000003915 | 80 |
| 79 | 3300005577 | Ga0068857_100126927 | Ga0068857_1001269272 | 80 |
| 80 | 3300005577 | Ga0068857_100218938 | Ga0068857_1002189381 | 80 |
| 81 | 3300005578 | Ga0068854_100018648 | Ga0068854_1000186483 | 80 |
| 82 | 3300005578 | Ga0068854_100226039 | Ga0068854_1002260392 | 80 |
| 83 | 3300005578 | Ga0068854_100300694 | Ga0068854_1003006943 | 80 |
| 84 | 3300005614 | Ga0068856_100003157 | Ga0068856_1000031579 | 80 |
| 85 | 3300005614 | Ga0068856_100072082 | Ga0068856_1000720823 | 80 |
| 86 | 3300005614 | Ga0068856_100074313 | Ga0068856_1000743133 | 80 |
| 87 | 3300005614 | Ga0068856_101591281 | Ga0068856_1015912811 | 80 |
| 88 | 3300005614 | Ga0068856_101736398 | Ga0068856_1017363982 | 80 |
| 89 | 3300005615 | Ga0070702_101282546 | Ga0070702_1012825461 | 80 |
| 90 | 3300005616 | Ga0068852_100000397 | Ga0068852_10000039720 | 80 |
| 91 | 3300005616 | Ga0068852_100029408 | Ga0068852_1000294082 | 80 |
| 92 | 3300005616 | Ga0068852_100064898 | Ga0068852_1000648983 | 80 |
| 93 | 3300005616 | Ga0068852_100076679 | Ga0068852_1000766793 | 80 |
| 94 | 3300005616 | Ga0068852_100168724 | Ga0068852_1001687242 | 80 |
| 95 | 3300005616 | Ga0068852_100718286 | Ga0068852_1007182861 | 80 |
| 96 | 3300005616 | Ga0068852_100982108 | Ga0068852_1009821082 | 80 |
| 97 | 3300005617 | Ga0068859_100116949 | Ga0068859_1001169492 | 80 |
| 98 | 3300005617 | Ga0068859_100143413 | Ga0068859_1001434133 | 80 |
| 99 | 3300005618 | Ga0068864_100000424 | Ga0068864_10000042420 | 80 |
| 100 | 3300005618 | Ga0068864_100187212 | Ga0068864_1001872121 | 80 |
| 101 | 3300005718 | Ga0068866_10934256 | Ga0068866_109342562 | 80 |
| 102 | 3300005834 | Ga0068851_10001032 | Ga0068851_100010326 | 80 |
| 103 | 3300005834 | Ga0068851_10019359 | Ga0068851_100193593 | 80 |
| 104 | 3300005834 | Ga0068851_10021457 | Ga0068851_100214573 | 80 |
| 105 | 3300005834 | Ga0068851_10027638 | Ga0068851_100276382 | 80 |
| 106 | 3300005834 | Ga0068851_10050746 | Ga0068851_100507462 | 80 |
| 107 | 3300005834 | Ga0068851_10737292 | Ga0068851_107372922 | 80 |
| 108 | 3300005841 | Ga0068863_100004144 | Ga0068863_1000041449 | 80 |
| 109 | 3300005841 | Ga0068863_102587506 | Ga0068863_1025875061 | 80 |
| 110 | 3300005842 | Ga0068858_100004796 | Ga0068858_1000047968 | 80 |
| 111 | 3300005842 | Ga0068858_100126502 | Ga0068858_1001265022 | 80 |
| 112 | 3300005842 | Ga0068858_101769439 | Ga0068858_1017694392 | 80 |
| 113 | 3300005843 | Ga0068860_100003785 | Ga0068860_1000037855 | 80 |
| 114 | 3300005843 | Ga0068860_100175373 | Ga0068860_1001753733 | 80 |
| 115 | 3300005844 | Ga0068862_100046185 | Ga0068862_1000461852 | 80 |
| 116 | 3300006028 | Ga0070717_11082957 | Ga0070717_110829571 | 80 |
| 117 | 3300006237 | Ga0097621_100034317 | Ga0097621_1000343174 | 80 |
| 118 | 3300006237 | Ga0097621_100061643 | Ga0097621_1000616434 | 80 |
| 119 | 3300006237 | Ga0097621_100355660 | Ga0097621_1003556602 | 80 |
| 120 | 3300006358 | Ga0068871_100000467 | Ga0068871_1000004675 | 80 |
| 121 | 3300006358 | Ga0068871_100013303 | Ga0068871_1000133034 | 80 |
| 122 | 3300006358 | Ga0068871_100301983 | Ga0068871_1003019832 | 80 |
| 123 | 3300006881 | Ga0068865_100164121 | Ga0068865_1001641212 | 80 |
| 124 | 3300006931 | Ga0097620_100116947 | Ga0097620_1001169473 | 80 |
| 125 | 3300006931 | Ga0097620_100143415 | Ga0097620_1001434153 | 80 |
| 126 | 3300009093 | Ga0105240_10001487 | Ga0105240_1000148715 | 80 |
| 127 | 3300009093 | Ga0105240_10001689 | Ga0105240_100016896 | 80 |
| 128 | 3300009093 | Ga0105240_10004882 | Ga0105240_1000488213 | 80 |
| 129 | 3300009093 | Ga0105240_10006707 | Ga0105240_100067074 | 80 |
| 130 | 3300009093 | Ga0105240_10060000 | Ga0105240_100600002 | 80 |
| 131 | 3300009093 | Ga0105240_10283790 | Ga0105240_102837903 | 80 |
| 132 | 3300009093 | Ga0105240_10335577 | Ga0105240_103355772 | 80 |
| 133 | 3300009098 | Ga0105245_10001275 | Ga0105245_1000127520 | 80 |
| 134 | 3300009098 | Ga0105245_10061460 | Ga0105245_100614604 | 80 |
| 135 | 3300009098 | Ga0105245_10073223 | Ga0105245_100732233 | 80 |
| 136 | 3300009098 | Ga0105245_10188716 | Ga0105245_101887161 | 80 |
| 137 | 3300009098 | Ga0105245_11824590 | Ga0105245_118245901 | 80 |
| 138 | 3300009101 | Ga0105247_10035758 | Ga0105247_100357582 | 80 |
| 139 | 3300009101 | Ga0105247_10232434 | Ga0105247_102324342 | 80 |
| 140 | 3300009101 | Ga0105247_10288270 | Ga0105247_102882702 | 80 |
| 141 | 3300009174 | Ga0105241_10000043 | Ga0105241_1000004333 | 80 |
| 142 | 3300009174 | Ga0105241_10000790 | Ga0105241_1000079020 | 80 |
| 143 | 3300009174 | Ga0105241_10001172 | Ga0105241_100011725 | 80 |
| 144 | 3300009174 | Ga0105241_10016720 | Ga0105241_100167202 | 80 |
| 145 | 3300009174 | Ga0105241_10061356 | Ga0105241_100613562 | 80 |
| 146 | 3300009174 | Ga0105241_10098112 | Ga0105241_100981122 | 80 |
| 147 | 3300009174 | Ga0105241_11714570 | Ga0105241_117145701 | 80 |
| 148 | 3300009176 | Ga0105242_10142562 | Ga0105242_101425623 | 80 |
| 149 | 3300009176 | Ga0105242_10564990 | Ga0105242_105649902 | 80 |
| 150 | 3300009177 | Ga0105248_10001095 | Ga0105248_1000109522 | 80 |
| 151 | 3300009177 | Ga0105248_10011728 | Ga0105248_100117286 | 80 |
| 152 | 3300009177 | Ga0105248_10186825 | Ga0105248_101868253 | 80 |
| 153 | 3300009177 | Ga0105248_11710312 | Ga0105248_117103121 | 80 |
| 154 | 3300009545 | Ga0105237_10026359 | Ga0105237_100263592 | 80 |
| 155 | 3300009545 | Ga0105237_10037235 | Ga0105237_100372354 | 80 |
| 156 | 3300009545 | Ga0105237_10132860 | Ga0105237_101328603 | 80 |
| 157 | 3300009545 | Ga0105237_10204243 | Ga0105237_102042432 | 80 |
| 158 | 3300009551 | Ga0105238_10000801 | Ga0105238_100008015 | 80 |
| 159 | 3300009551 | Ga0105238_10001399 | Ga0105238_1000139921 | 80 |
| 160 | 3300009551 | Ga0105238_10002233 | Ga0105238_100022335 | 80 |
| 161 | 3300009551 | Ga0105238_10006437 | Ga0105238_100064375 | 80 |
| 162 | 3300009551 | Ga0105238_10168020 | Ga0105238_101680202 | 80 |
| 163 | 3300009551 | Ga0105238_10532198 | Ga0105238_105321982 | 80 |
| 164 | 3300009553 | Ga0105249_10062108 | Ga0105249_100621083 | 80 |
| 165 | 3300009553 | Ga0105249_10179277 | Ga0105249_101792773 | 80 |
| 166 | 3300009553 | Ga0105249_11953297 | Ga0105249_119532971 | 80 |
| 167 | 3300010375 | Ga0105239_10003395 | Ga0105239_1000339515 | 80 |
| 168 | 3300010375 | Ga0105239_10012987 | Ga0105239_100129878 | 80 |
| 169 | 3300010375 | Ga0105239_10086852 | Ga0105239_100868524 | 80 |
| 170 | 3300010375 | Ga0105239_11133403 | Ga0105239_111334032 | 80 |
| 171 | 3300010375 | Ga0105239_11256892 | Ga0105239_112568921 | 80 |
| 172 | 3300010375 | Ga0105239_13255921 | Ga0105239_132559211 | 80 |
| 173 | 3300011119 | Ga0105246_10080812 | Ga0105246_100808123 | 80 |
| 174 | 3300011119 | Ga0105246_10177218 | Ga0105246_101772182 | 80 |
| 175 | 3300013102 | Ga0157371_11541434 | Ga0157371_115414341 | 80 |
| 176 | 3300013104 | Ga0157370_10491960 | Ga0157370_104919601 | 80 |
| 177 | 3300013104 | Ga0157370_11980478 | Ga0157370_119804781 | 80 |
| 178 | 3300013105 | Ga0157369_10001425 | Ga0157369_100014254 | 80 |
| 179 | 3300013105 | Ga0157369_10013330 | Ga0157369_100133304 | 80 |
| 180 | 3300013105 | Ga0157369_10032369 | Ga0157369_100323691 | 80 |
| 181 | 3300013105 | Ga0157369_10044917 | Ga0157369_100449174 | 80 |
| 182 | 3300013105 | Ga0157369_10151774 | Ga0157369_101517743 | 80 |
| 183 | 3300013105 | Ga0157369_10219644 | Ga0157369_102196443 | 80 |
| 184 | 3300013105 | Ga0157369_10938077 | Ga0157369_109380772 | 80 |
| 185 | 3300013105 | Ga0157369_11573965 | Ga0157369_115739652 | 80 |
| 186 | 3300013296 | Ga0157374_10083575 | Ga0157374_100835751 | 80 |
| 187 | 3300013296 | Ga0157374_10132451 | Ga0157374_101324513 | 80 |
| 188 | 3300013296 | Ga0157374_10430890 | Ga0157374_104308902 | 80 |
| 189 | 3300013296 | Ga0157374_10604152 | Ga0157374_106041522 | 80 |
| 190 | 3300013296 | Ga0157374_10856183 | Ga0157374_108561831 | 80 |
| 191 | 3300013296 | Ga0157374_11232691 | Ga0157374_112326912 | 80 |
| 192 | 3300013297 | Ga0157378_10021006 | Ga0157378_100210064 | 80 |
| 193 | 3300013297 | Ga0157378_10048720 | Ga0157378_100487202 | 80 |
| 194 | 3300013297 | Ga0157378_10095155 | Ga0157378_100951553 | 80 |
| 195 | 3300013297 | Ga0157378_10129296 | Ga0157378_101292962 | 80 |
| 196 | 3300013297 | Ga0157378_11532680 | Ga0157378_115326802 | 80 |
| 197 | 3300013297 | Ga0157378_12711352 | Ga0157378_127113522 | 80 |
| 198 | 3300013306 | Ga0163162_10012929 | Ga0163162_100129293 | 80 |
| 199 | 3300013306 | Ga0163162_10281092 | Ga0163162_102810923 | 80 |
| 200 | 3300013307 | Ga0157372_10008695 | Ga0157372_100086956 | 80 |
| 201 | 3300013307 | Ga0157372_10039165 | Ga0157372_100391654 | 80 |
| 202 | 3300013307 | Ga0157372_10054972 | Ga0157372_100549724 | 80 |
| 203 | 3300013307 | Ga0157372_10138618 | Ga0157372_101386183 | 80 |
| 204 | 3300013307 | Ga0157372_10161647 | Ga0157372_101616471 | 80 |
| 205 | 3300013307 | Ga0157372_10234626 | Ga0157372_102346263 | 80 |
| 206 | 3300013307 | Ga0157372_10739546 | Ga0157372_107395461 | 80 |
| 207 | 3300013307 | Ga0157372_10803327 | Ga0157372_108033273 | 80 |
| 208 | 3300013308 | Ga0157375_10018458 | Ga0157375_100184583 | 80 |
| 209 | 3300013308 | Ga0157375_10018613 | Ga0157375_100186134 | 80 |
| 210 | 3300013308 | Ga0157375_10236145 | Ga0157375_102361453 | 80 |
| 211 | 3300014325 | Ga0163163_10005695 | Ga0163163_100056955 | 80 |
| 212 | 3300014325 | Ga0163163_10282735 | Ga0163163_102827351 | 80 |
| 213 | 3300014325 | Ga0163163_11565882 | Ga0163163_115658821 | 80 |
| 214 | 3300014968 | Ga0157379_10017883 | Ga0157379_100178834 | 80 |
| 215 | 3300014968 | Ga0157379_10251034 | Ga0157379_102510341 | 80 |
| 216 | 3300014968 | Ga0157379_10659662 | Ga0157379_106596622 | 80 |
| 217 | 3300014969 | Ga0157376_10000369 | Ga0157376_1000036920 | 80 |
| 218 | 3300014969 | Ga0157376_10101513 | Ga0157376_101015133 | 80 |
| 219 | 3300014969 | Ga0157376_10111617 | Ga0157376_101116172 | 80 |
| 220 | 3300017792 | Ga0163161_10113188 | Ga0163161_101131882 | 80 |
| 221 | 3300022467 | Ga0224712_10288208 | Ga0224712_102882082 | 80 |
| 222 | 3300025315 | Ga0207697_10012275 | Ga0207697_100122753 | 80 |
| 223 | 3300025321 | Ga0207656_10002068 | Ga0207656_100020684 | 80 |
| 224 | 3300025321 | Ga0207656_10052368 | Ga0207656_100523681 | 80 |
| 225 | 3300025321 | Ga0207656_10122547 | Ga0207656_101225471 | 80 |
| 226 | 3300025321 | Ga0207656_10164114 | Ga0207656_101641141 | 80 |
| 227 | 3300025321 | Ga0207656_10303027 | Ga0207656_103030271 | 80 |
| 228 | 3300025321 | Ga0207656_10338817 | Ga0207656_103388171 | 80 |
| 229 | 3300025900 | Ga0207710_10005046 | Ga0207710_100050465 | 80 |
| 230 | 3300025900 | Ga0207710_10093947 | Ga0207710_100939472 | 80 |
| 231 | 3300025900 | Ga0207710_10126758 | Ga0207710_101267582 | 80 |
| 232 | 3300025903 | Ga0207680_10175940 | Ga0207680_101759402 | 80 |
| 233 | 3300025903 | Ga0207680_10217601 | Ga0207680_102176013 | 80 |
| 234 | 3300025904 | Ga0207647_10037418 | Ga0207647_100374183 | 80 |
| 235 | 3300025904 | Ga0207647_10135470 | Ga0207647_101354702 | 80 |
| 236 | 3300025906 | Ga0207699_10871575 | Ga0207699_108715751 | 80 |
| 237 | 3300025907 | Ga0207645_10038537 | Ga0207645_100385373 | 80 |
| 238 | 3300025909 | Ga0207705_10539213 | Ga0207705_105392131 | 80 |
| 239 | 3300025909 | Ga0207705_11040417 | Ga0207705_110404171 | 80 |
| 240 | 3300025911 | Ga0207654_10000019 | Ga0207654_1000001952 | 80 |
| 241 | 3300025911 | Ga0207654_10001893 | Ga0207654_100018933 | 80 |
| 242 | 3300025911 | Ga0207654_10011130 | Ga0207654_100111304 | 80 |
| 243 | 3300025911 | Ga0207654_10085894 | Ga0207654_100858942 | 80 |
| 244 | 3300025911 | Ga0207654_10203416 | Ga0207654_102034162 | 80 |
| 245 | 3300025911 | Ga0207654_11160207 | Ga0207654_111602071 | 80 |
| 246 | 3300025912 | Ga0207707_10990207 | Ga0207707_109902072 | 80 |
| 247 | 3300025913 | Ga0207695_10000108 | Ga0207695_10000108192 | 80 |
| 248 | 3300025913 | Ga0207695_10000871 | Ga0207695_1000087119 | 80 |
| 249 | 3300025913 | Ga0207695_10001287 | Ga0207695_1000128710 | 80 |
| 250 | 3300025913 | Ga0207695_10002583 | Ga0207695_1000258312 | 80 |
| 251 | 3300025913 | Ga0207695_10007296 | Ga0207695_100072964 | 80 |
| 252 | 3300025913 | Ga0207695_10165741 | Ga0207695_101657413 | 80 |
| 253 | 3300025913 | Ga0207695_10758063 | Ga0207695_107580632 | 80 |
| 254 | 3300025914 | Ga0207671_10001258 | Ga0207671_1000125820 | 80 |
| 255 | 3300025914 | Ga0207671_10002967 | Ga0207671_1000296710 | 80 |
| 256 | 3300025914 | Ga0207671_10034212 | Ga0207671_100342123 | 80 |
| 257 | 3300025914 | Ga0207671_10263219 | Ga0207671_102632192 | 80 |
| 258 | 3300025915 | Ga0207693_10939301 | Ga0207693_109393012 | 80 |
| 259 | 3300025916 | Ga0207663_10055635 | Ga0207663_100556352 | 80 |
| 260 | 3300025917 | Ga0207660_10946679 | Ga0207660_109466791 | 80 |
| 261 | 3300025917 | Ga0207660_10959360 | Ga0207660_109593602 | 80 |
| 262 | 3300025919 | Ga0207657_10486419 | Ga0207657_104864191 | 80 |
| 263 | 3300025920 | Ga0207649_10015265 | Ga0207649_100152653 | 80 |
| 264 | 3300025920 | Ga0207649_10198155 | Ga0207649_101981552 | 80 |
| 265 | 3300025920 | Ga0207649_10897963 | Ga0207649_108979631 | 80 |
| 266 | 3300025920 | Ga0207649_11108117 | Ga0207649_111081171 | 80 |
| 267 | 3300025923 | Ga0207681_10418159 | Ga0207681_104181592 | 80 |
| 268 | 3300025924 | Ga0207694_10000325 | Ga0207694_1000032525 | 80 |
| 269 | 3300025924 | Ga0207694_10000671 | Ga0207694_1000067115 | 80 |
| 270 | 3300025924 | Ga0207694_10013980 | Ga0207694_100139804 | 80 |
| 271 | 3300025924 | Ga0207694_10045986 | Ga0207694_100459864 | 80 |
| 272 | 3300025924 | Ga0207694_10155434 | Ga0207694_101554343 | 80 |
| 273 | 3300025925 | Ga0207650_10002547 | Ga0207650_100025478 | 80 |
| 274 | 3300025926 | Ga0207659_10067200 | Ga0207659_100672003 | 80 |
| 275 | 3300025927 | Ga0207687_10014077 | Ga0207687_100140771 | 80 |
| 276 | 3300025927 | Ga0207687_10071983 | Ga0207687_100719831 | 80 |
| 277 | 3300025927 | Ga0207687_10086096 | Ga0207687_100860962 | 80 |
| 278 | 3300025927 | Ga0207687_11097046 | Ga0207687_110970462 | 80 |
| 279 | 3300025927 | Ga0207687_11181096 | Ga0207687_111810961 | 80 |
| 280 | 3300025928 | Ga0207700_10000956 | Ga0207700_1000095613 | 80 |
| 281 | 3300025928 | Ga0207700_10415537 | Ga0207700_104155372 | 80 |
| 282 | 3300025929 | Ga0207664_10204587 | Ga0207664_102045872 | 80 |
| 283 | 3300025929 | Ga0207664_11625222 | Ga0207664_116252221 | 80 |
| 284 | 3300025931 | Ga0207644_10001595 | Ga0207644_100015954 | 80 |
| 285 | 3300025931 | Ga0207644_10012397 | Ga0207644_100123973 | 80 |
| 286 | 3300025933 | Ga0207706_10023576 | Ga0207706_100235765 | 80 |
| 287 | 3300025934 | Ga0207686_10604662 | Ga0207686_106046621 | 80 |
| 288 | 3300025934 | Ga0207686_11107879 | Ga0207686_111078791 | 80 |
| 289 | 3300025937 | Ga0207669_10391506 | Ga0207669_103915061 | 80 |
| 290 | 3300025938 | Ga0207704_10097988 | Ga0207704_100979883 | 80 |
| 291 | 3300025940 | Ga0207691_10002490 | Ga0207691_100024909 | 80 |
| 292 | 3300025941 | Ga0207711_10048925 | Ga0207711_100489253 | 80 |
| 293 | 3300025941 | Ga0207711_10062599 | Ga0207711_100625993 | 80 |
| 294 | 3300025941 | Ga0207711_10228240 | Ga0207711_102282403 | 80 |
| 295 | 3300025942 | Ga0207689_10000130 | Ga0207689_1000013021 | 80 |
| 296 | 3300025942 | Ga0207689_10027632 | Ga0207689_100276325 | 80 |
| 297 | 3300025944 | Ga0207661_10036210 | Ga0207661_100362102 | 80 |
| 298 | 3300025944 | Ga0207661_10118937 | Ga0207661_101189373 | 80 |
| 299 | 3300025944 | Ga0207661_10488376 | Ga0207661_104883762 | 80 |
| 300 | 3300025944 | Ga0207661_10579038 | Ga0207661_105790382 | 80 |
| 301 | 3300025945 | Ga0207679_10175291 | Ga0207679_101752913 | 80 |
| 302 | 3300025945 | Ga0207679_10210201 | Ga0207679_102102013 | 80 |
| 303 | 3300025945 | Ga0207679_10316717 | Ga0207679_103167173 | 80 |
| 304 | 3300025945 | Ga0207679_11162764 | Ga0207679_111627641 | 80 |
| 305 | 3300025949 | Ga0207667_10001508 | Ga0207667_1000150819 | 80 |
| 306 | 3300025949 | Ga0207667_10004656 | Ga0207667_100046564 | 80 |
| 307 | 3300025949 | Ga0207667_10101220 | Ga0207667_101012203 | 80 |
| 308 | 3300025960 | Ga0207651_10102587 | Ga0207651_101025873 | 80 |
| 309 | 3300025961 | Ga0207712_10828397 | Ga0207712_108283971 | 80 |
| 310 | 3300025961 | Ga0207712_10985529 | Ga0207712_109855292 | 80 |
| 311 | 3300025961 | Ga0207712_11830639 | Ga0207712_118306392 | 80 |
| 312 | 3300025972 | Ga0207668_10035315 | Ga0207668_100353151 | 80 |
| 313 | 3300025981 | Ga0207640_10011694 | Ga0207640_100116944 | 80 |
| 314 | 3300025981 | Ga0207640_10219520 | Ga0207640_102195201 | 80 |
| 315 | 3300025986 | Ga0207658_10015582 | Ga0207658_100155821 | 80 |
| 316 | 3300025986 | Ga0207658_11210393 | Ga0207658_112103931 | 80 |
| 317 | 3300026023 | Ga0207677_10005672 | Ga0207677_100056721 | 80 |
| 318 | 3300026023 | Ga0207677_10009644 | Ga0207677_100096445 | 80 |
| 319 | 3300026023 | Ga0207677_10032881 | Ga0207677_100328813 | 80 |
| 320 | 3300026035 | Ga0207703_10009310 | Ga0207703_100093104 | 80 |
| 321 | 3300026035 | Ga0207703_10097333 | Ga0207703_100973333 | 80 |
| 322 | 3300026035 | Ga0207703_11285521 | Ga0207703_112855212 | 80 |
| 323 | 3300026041 | Ga0207639_10000180 | Ga0207639_1000018010 | 80 |
| 324 | 3300026041 | Ga0207639_10091164 | Ga0207639_100911641 | 80 |
| 325 | 3300026041 | Ga0207639_10106429 | Ga0207639_101064293 | 80 |
| 326 | 3300026041 | Ga0207639_10238490 | Ga0207639_102384902 | 80 |
| 327 | 3300026041 | Ga0207639_10315987 | Ga0207639_103159872 | 80 |
| 328 | 3300026041 | Ga0207639_11327008 | Ga0207639_113270082 | 80 |
| 329 | 3300026067 | Ga0207678_10260128 | Ga0207678_102601281 | 80 |
| 330 | 3300026078 | Ga0207702_10003238 | Ga0207702_100032389 | 80 |
| 331 | 3300026078 | Ga0207702_10041914 | Ga0207702_100419142 | 80 |
| 332 | 3300026078 | Ga0207702_10049794 | Ga0207702_100497943 | 80 |
| 333 | 3300026078 | Ga0207702_10060667 | Ga0207702_100606671 | 80 |
| 334 | 3300026088 | Ga0207641_10018193 | Ga0207641_100181932 | 80 |
| 335 | 3300026088 | Ga0207641_10678338 | Ga0207641_106783382 | 80 |
| 336 | 3300026089 | Ga0207648_10220642 | Ga0207648_102206423 | 80 |
| 337 | 3300026095 | Ga0207676_10042168 | Ga0207676_100421683 | 80 |
| 338 | 3300026095 | Ga0207676_10049083 | Ga0207676_100490833 | 80 |
| 339 | 3300026116 | Ga0207674_10000910 | Ga0207674_100009107 | 80 |
| 340 | 3300026116 | Ga0207674_10001536 | Ga0207674_1000153618 | 80 |
| 341 | 3300026116 | Ga0207674_10260350 | Ga0207674_102603503 | 80 |
| 342 | 3300026118 | Ga0207675_101644814 | Ga0207675_1016448141 | 80 |
| 343 | 3300026121 | Ga0207683_10003953 | Ga0207683_100039537 | 80 |
| 344 | 3300026142 | Ga0207698_10000289 | Ga0207698_100002896 | 80 |
| 345 | 3300026142 | Ga0207698_10055869 | Ga0207698_100558693 | 80 |
| 346 | 3300026142 | Ga0207698_10062099 | Ga0207698_100620992 | 80 |
| 347 | 3300026142 | Ga0207698_10242316 | Ga0207698_102423162 | 80 |
| 348 | 3300026142 | Ga0207698_10452419 | Ga0207698_104524191 | 80 |
| 349 | 3300026142 | Ga0207698_11274878 | Ga0207698_112748782 | 80 |
| 350 | 3300026142 | Ga0207698_12319691 | Ga0207698_123196911 | 80 |
| 351 | 3300028379 | Ga0268266_10016603 | Ga0268266_100166032 | 80 |
| 352 | 3300028379 | Ga0268266_10146846 | Ga0268266_101468461 | 80 |
| 353 | 3300028380 | Ga0268265_10709928 | Ga0268265_107099282 | 80 |
| 354 | 3300028381 | Ga0268264_10007648 | Ga0268264_100076484 | 80 |
| 355 | 3300028381 | Ga0268264_10073960 | Ga0268264_100739603 | 80 |
| 356 | 3300031090 | Ga0265760_10378501 | Ga0265760_103785012 | 80 |
| 357 | 3300031241 | Ga0265325_10386622 | Ga0265325_103866221 | 80 |
| 358 | 3300031711 | Ga0265314_10069846 | Ga0265314_100698461 | 80 |
| 359 | 3300035118 | Ga0373954_0504354 | Ga0373954_0504354_274_552 | 80 |
| 360 | 3300035119 | Ga0373956_0295809 | Ga0373956_0295809_446_724 | 80 |
| 361 | 3300035120 | Ga0373957_0309787 | Ga0373957_0309787_299_577 | 80 |
| 362 | 3300035410 | Ga0373924_0341288 | Ga0373924_0341288_353_631 | 80 |
| 363 | 3300035692 | Ga0373935_1117348 | Ga0373935_1117348_235_513 | 80 |
| 364 | 3300036401 | Ga0373937_0054485 | Ga0373937_0054485_200_478 | 80 |
| 365 | 3300036401 | Ga0373937_0177449 | Ga0373937_0177449_703_981 | 80 |
| 366 | 3300036401 | Ga0373937_0836372 | Ga0373937_0836372_266_544 | 80 |
| 367 | 3300041496 | Ga0451839_0222012 | Ga0451839_0222012_134_412 | 80 |
| 368 | 3300044684 | Ga0466966_0562255 | Ga0466966_0562255_389_667 | 80 |
| 369 | 3300045836 | Ga0466958_0116482 | Ga0466958_0116482_71_349 | 80 |
| 370 | 3300046459 | Ga0495629_0020147 | Ga0495629_0020147_2354_2632 | 80 |
| 371 | 3300046459 | Ga0495629_0104781 | Ga0495629_0104781_1075_1353 | 80 |
| 372 | 3300046459 | Ga0495629_0288273 | Ga0495629_0288273_353_631 | 80 |
| 373 | 3300046472 | Ga0495580_0619222 | Ga0495580_0619222_165_443 | 80 |
| 374 | 3300046511 | Ga0495608_0277952 | Ga0495608_0277952_203_481 | 80 |
| 375 | 3300046529 | Ga0495652_0974296 | Ga0495652_0974296_159_437 | 80 |
| 376 | 3300046529 | Ga0495652_1134925 | Ga0495652_1134925_211_489 | 80 |
| 377 | 3300046531 | Ga0495665_0084260 | Ga0495665_0084260_575_853 | 80 |
| 378 | 3300046535 | Ga0495586_0302399 | Ga0495586_0302399_303_581 | 80 |
| 379 | 3300046536 | Ga0495587_0187684 | Ga0495587_0187684_396_674 | 80 |
| 380 | 3300046543 | Ga0495645_0083957 | Ga0495645_0083957_1647_1925 | 80 |
| 381 | 3300046559 | Ga0495667_0384319 | Ga0495667_0384319_204_482 | 80 |
| 382 | 3300046559 | Ga0495667_0858191 | Ga0495667_0858191_207_485 | 80 |
| 383 | 3300046675 | Ga0495657_0706381 | Ga0495657_0706381_257_535 | 80 |
| 384 | 3300046675 | Ga0495657_0789978 | Ga0495657_0789978_56_334 | 80 |
| 385 | 3300046678 | Ga0495599_0299469 | Ga0495599_0299469_186_464 | 80 |
| 386 | 3300046679 | Ga0495623_0123923 | Ga0495623_0123923_787_1065 | 80 |
| 387 | 3300046679 | Ga0495623_0128808 | Ga0495623_0128808_331_609 | 80 |
| 388 | 3300046679 | Ga0495623_0612098 | Ga0495623_0612098_47_325 | 80 |
| 389 | 3300046683 | Ga0495658_0659733 | Ga0495658_0659733_21_299 | 80 |
| 390 | 3300046684 | Ga0495669_0021515 | Ga0495669_0021515_397_675 | 80 |
| 391 | 3300046689 | Ga0495613_0026749 | Ga0495613_0026749_3991_4269 | 80 |
| 392 | 3300046689 | Ga0495613_0121581 | Ga0495613_0121581_357_635 | 80 |
| 393 | 3300046809 | Ga0495600_0040357 | Ga0495600_0040357_921_1199 | 80 |
| 394 | 3300046809 | Ga0495600_0888577 | Ga0495600_0888577_108_386 | 80 |
| 395 | 3300047315 | Ga0495581_0349368 | Ga0495581_0349368_136_414 | 80 |
| 396 | 3300047471 | Ga0495684_0497899 | Ga0495684_0497899_369_647 | 80 |
| 397 | 3300048088 | Ga0495602_0338471 | Ga0495602_0338471_397_675 | 80 |
| 398 | 3300048088 | Ga0495602_0371308 | Ga0495602_0371308_378_656 | 80 |
| 399 | 3300048088 | Ga0495602_0404478 | Ga0495602_0404478_356_634 | 80 |
| 400 | 3300048903 | Ga0496100_0074736 | Ga0496100_0074736_1927_2205 | 80 |
| 401 | 3300048903 | Ga0496100_0208258 | Ga0496100_0208258_320_598 | 80 |
| 402 | 3300048903 | Ga0496100_1302456 | Ga0496100_1302456_257_535 | 80 |
| 403 | 3300048905 | Ga0496102_1405813 | Ga0496102_1405813_128_406 | 80 |
| 404 | 3300048907 | Ga0496104_0007097 | Ga0496104_0007097_3869_4147 | 80 |
| 405 | 3300048907 | Ga0496104_0412169 | Ga0496104_0412169_743_1021 | 80 |
| 406 | 3300048908 | Ga0496105_0629229 | Ga0496105_0629229_67_345 | 80 |
| 407 | 3300048908 | Ga0496105_1077354 | Ga0496105_1077354_215_493 | 80 |
| 408 | 3300048910 | Ga0496107_0017766 | Ga0496107_0017766_147_425 | 80 |
| 409 | 3300048912 | Ga0496109_0095789 | Ga0496109_0095789_1663_1941 | 80 |
| 410 | 3300048917 | Ga0496114_0015202 | Ga0496114_0015202_816_1094 | 80 |
| 411 | 3300048918 | Ga0496115_0019162 | Ga0496115_0019162_3768_4046 | 80 |
| 412 | 3300048918 | Ga0496115_0052776 | Ga0496115_0052776_1110_1388 | 80 |
| 413 | 3300048918 | Ga0496115_0994439 | Ga0496115_0994439_153_431 | 80 |
| 414 | 3300048929 | Ga0496126_0003167 | Ga0496126_0003167_15775_16053 | 80 |
| 415 | 2088090002 | CNA_F6ESG4R02GBA9Z | CNA_00970800 | 81 |
| 416 | 3300003911 | JGI25405J52794_10001170 | JGI25405J52794_100011701 | 81 |
| 417 | 3300005293 | Ga0065715_10008377 | Ga0065715_100083773 | 81 |
| 418 | 3300005327 | Ga0070658_11276068 | Ga0070658_112760682 | 81 |
| 419 | 3300005329 | Ga0070683_100951879 | Ga0070683_1009518791 | 81 |
| 420 | 3300005331 | Ga0070670_100141994 | Ga0070670_1001419942 | 81 |
| 421 | 3300005436 | Ga0070713_100228197 | Ga0070713_1002281972 | 81 |
| 422 | 3300005436 | Ga0070713_100572400 | Ga0070713_1005724001 | 81 |
| 423 | 3300005445 | Ga0070708_100045529 | Ga0070708_1000455293 | 81 |
| 424 | 3300005445 | Ga0070708_101528059 | Ga0070708_1015280592 | 81 |
| 425 | 3300005458 | Ga0070681_10560808 | Ga0070681_105608082 | 81 |
| 426 | 3300005458 | Ga0070681_11874233 | Ga0070681_118742331 | 81 |
| 427 | 3300005467 | Ga0070706_100022637 | Ga0070706_1000226374 | 81 |
| 428 | 3300005467 | Ga0070706_100032432 | Ga0070706_1000324323 | 81 |
| 429 | 3300005467 | Ga0070706_101020459 | Ga0070706_1010204592 | 81 |
| 430 | 3300005468 | Ga0070707_100077683 | Ga0070707_1000776833 | 81 |
| 431 | 3300005471 | Ga0070698_100006879 | Ga0070698_1000068798 | 81 |
| 432 | 3300005536 | Ga0070697_100374245 | Ga0070697_1003742452 | 81 |
| 433 | 3300005539 | Ga0068853_100183515 | Ga0068853_1001835153 | 81 |
| 434 | 3300005539 | Ga0068853_101746298 | Ga0068853_1017462982 | 81 |
| 435 | 3300005548 | Ga0070665_100219971 | Ga0070665_1002199712 | 81 |
| 436 | 3300005548 | Ga0070665_101289352 | Ga0070665_1012893521 | 81 |
| 437 | 3300005577 | Ga0068857_100665242 | Ga0068857_1006652422 | 81 |
| 438 | 3300005616 | Ga0068852_100228042 | Ga0068852_1002280422 | 81 |
| 439 | 3300005834 | Ga0068851_10857794 | Ga0068851_108577942 | 81 |
| 440 | 3300005937 | Ga0081455_10010007 | Ga0081455_100100079 | 81 |
| 441 | 3300005937 | Ga0081455_10032038 | Ga0081455_100320385 | 81 |
| 442 | 3300005985 | Ga0081539_10007120 | Ga0081539_1000712010 | 81 |
| 443 | 3300006028 | Ga0070717_10488087 | Ga0070717_104880872 | 81 |
| 444 | 3300006028 | Ga0070717_11520104 | Ga0070717_115201041 | 81 |
| 445 | 3300006173 | Ga0070716_100252784 | Ga0070716_1002527842 | 81 |
| 446 | 3300006852 | Ga0075433_10972814 | Ga0075433_109728142 | 81 |
| 447 | 3300009093 | Ga0105240_10000022 | Ga0105240_10000022119 | 81 |
| 448 | 3300009093 | Ga0105240_10220119 | Ga0105240_102201193 | 81 |
| 449 | 3300009093 | Ga0105240_11801350 | Ga0105240_118013501 | 81 |
| 450 | 3300009147 | Ga0114129_10006405 | Ga0114129_100064057 | 81 |
| 451 | 3300009545 | Ga0105237_10706904 | Ga0105237_107069041 | 81 |
| 452 | 3300009551 | Ga0105238_10153060 | Ga0105238_101530603 | 81 |
| 453 | 3300010375 | Ga0105239_10420565 | Ga0105239_104205653 | 81 |
| 454 | 3300010375 | Ga0105239_11785461 | Ga0105239_117854611 | 81 |
| 455 | 3300013296 | Ga0157374_10071948 | Ga0157374_100719483 | 81 |
| 456 | 3300013296 | Ga0157374_10884046 | Ga0157374_108840462 | 81 |
| 457 | 3300013296 | Ga0157374_11382718 | Ga0157374_113827181 | 81 |
| 458 | 3300013297 | Ga0157378_12119442 | Ga0157378_121194422 | 81 |
| 459 | 3300013307 | Ga0157372_10410556 | Ga0157372_104105562 | 81 |
| 460 | 3300013307 | Ga0157372_11418043 | Ga0157372_114180431 | 81 |
| 461 | 3300013307 | Ga0157372_12178530 | Ga0157372_121785302 | 81 |
| 462 | 3300013308 | Ga0157375_11772190 | Ga0157375_117721902 | 81 |
| 463 | 3300014968 | Ga0157379_10574740 | Ga0157379_105747402 | 81 |
| 464 | 3300020069 | Ga0197907_10939265 | Ga0197907_109392652 | 81 |
| 465 | 3300020069 | Ga0197907_10960766 | Ga0197907_109607662 | 81 |
| 466 | 3300020075 | Ga0206349_1436852 | Ga0206349_14368522 | 81 |
| 467 | 3300020077 | Ga0206351_10137195 | Ga0206351_101371952 | 81 |
| 468 | 3300020077 | Ga0206351_10372312 | Ga0206351_103723122 | 81 |
| 469 | 3300020080 | Ga0206350_10557554 | Ga0206350_105575542 | 81 |
| 470 | 3300020080 | Ga0206350_11208427 | Ga0206350_112084272 | 81 |
| 471 | 3300020080 | Ga0206350_11210002 | Ga0206350_112100022 | 81 |
| 472 | 3300025321 | Ga0207656_10589374 | Ga0207656_105893742 | 81 |
| 473 | 3300025910 | Ga0207684_10022617 | Ga0207684_100226175 | 81 |
| 474 | 3300025910 | Ga0207684_10145246 | Ga0207684_101452461 | 81 |
| 475 | 3300025913 | Ga0207695_10000022 | Ga0207695_10000022400 | 81 |
| 476 | 3300025913 | Ga0207695_10530693 | Ga0207695_105306933 | 81 |
| 477 | 3300025919 | Ga0207657_10515714 | Ga0207657_105157142 | 81 |
| 478 | 3300025922 | Ga0207646_10144251 | Ga0207646_101442513 | 81 |
| 479 | 3300025922 | Ga0207646_10665189 | Ga0207646_106651891 | 81 |
| 480 | 3300025924 | Ga0207694_10444911 | Ga0207694_104449112 | 81 |
| 481 | 3300025928 | Ga0207700_11345924 | Ga0207700_113459241 | 81 |
| 482 | 3300025929 | Ga0207664_10891350 | Ga0207664_108913501 | 81 |
| 483 | 3300026041 | Ga0207639_10197060 | Ga0207639_101970603 | 81 |
| 484 | 3300026041 | Ga0207639_11320454 | Ga0207639_113204542 | 81 |
| 485 | 3300026067 | Ga0207678_11020842 | Ga0207678_110208422 | 81 |
| 486 | 3300026142 | Ga0207698_10580917 | Ga0207698_105809172 | 81 |
| 487 | 3300028379 | Ga0268266_10290944 | Ga0268266_102909443 | 81 |
| 488 | 3300028379 | Ga0268266_11304103 | Ga0268266_113041032 | 81 |
| 489 | 3300031727 | Ga0316576_10075087 | Ga0316576_100750873 | 81 |
| 490 | 3300031728 | Ga0316578_10054847 | Ga0316578_100548474 | 81 |
| 491 | 3300032004 | Ga0307414_10269968 | Ga0307414_102699683 | 81 |
| 492 | 3300035398 | Ga0316574_0399890 | Ga0316574_0399890_78_362 | 81 |
| 493 | 3300036712 | Ga0316584_0772232 | Ga0316584_0772232_218_502 | 81 |
| 494 | 3300037068 | Ga0373925_0270076 | Ga0373925_0270076_665_949 | 81 |
| 495 | 3300037312 | Ga0395899_0875701 | Ga0395899_0875701_92_400 | 81 |
| 496 | 3300037418 | Ga0395900_0444131 | Ga0395900_0444131_504_788 | 81 |
| 497 | 3300037418 | Ga0395900_1478899 | Ga0395900_1478899_47_364 | 81 |
| 498 | 3300037466 | Ga0395898_0520942 | Ga0395898_0520942_606_890 | 81 |
| 499 | 3300037471 | Ga0395905_0036044 | Ga0395905_0036044_597_899 | 81 |
| 500 | 3300037471 | Ga0395905_0093435 | Ga0395905_0093435_1656_1973 | 81 |
| 501 | 3300037471 | Ga0395905_0335955 | Ga0395905_0335955_1018_1326 | 81 |
| 502 | 3300037471 | Ga0395905_0898370 | Ga0395905_0898370_337_645 | 81 |
| 503 | 3300037471 | Ga0395905_1530944 | Ga0395905_1530944_106_390 | 81 |
| 504 | 3300037853 | Ga0436364_0468724 | Ga0436364_0468724_258_557 | 81 |
| 505 | 3300038443 | Ga0395901_0399763 | Ga0395901_0399763_824_1132 | 81 |
| 506 | 3300038443 | Ga0395901_0899935 | Ga0395901_0899935_260_544 | 81 |
| 507 | 3300038443 | Ga0395901_1026862 | Ga0395901_1026862_433_735 | 81 |
| 508 | 3300039450 | Ga0436363_0173117 | Ga0436363_0173117_83_382 | 81 |
| 509 | 3300041503 | Ga0451847_0630597 | Ga0451847_0630597_129_413 | 81 |
| 510 | 3300041507 | Ga0451851_1177581 | Ga0451851_1177581_15_299 | 81 |
| 511 | 3300044673 | Ga0453683_0552489 | Ga0453683_0552489_366_653 | 81 |
| 512 | 3300045049 | Ga0466959_0428021 | Ga0466959_0428021_454_753 | 81 |
| 513 | 3300045049 | Ga0466959_0577353 | Ga0466959_0577353_362_670 | 81 |
| 514 | 3300045051 | Ga0451576_1523974 | Ga0451576_1523974_355_681 | 81 |
| 515 | 3300047320 | Ga0495672_0001982 | Ga0495672_0001982_1135_1416 | 81 |
| 516 | 3300048907 | Ga0496104_1572272 | Ga0496104_1572272_10_297 | 81 |
| 517 | 3300048915 | Ga0496112_0183091 | Ga0496112_0183091_703_1008 | 81 |
| 518 | 3300048915 | Ga0496112_1791089 | Ga0496112_1791089_107_412 | 81 |
| 519 | 3300048917 | Ga0496114_0628914 | Ga0496114_0628914_596_886 | 81 |
| 520 | 3300049568 | Ga0501031_0096709 | Ga0501031_0096709_527_808 | 81 |
| 521 | 3300049569 | Ga0501032_0032958 | Ga0501032_0032958_303_584 | 81 |
| 522 | 3300049570 | Ga0501033_0010077 | Ga0501033_0010077_3125_3406 | 81 |
| 523 | 3300049571 | Ga0501034_0006678 | Ga0501034_0006678_2437_2718 | 81 |
| 524 | 3300049572 | Ga0501036_0001526 | Ga0501036_0001526_8872_9153 | 81 |
| 525 | 3300049574 | Ga0501038_0031468 | Ga0501038_0031468_1509_1790 | 81 |
| 526 | 3300049575 | Ga0501039_0415695 | Ga0501039_0415695_262_543 | 81 |
| 527 | 3300049579 | Ga0501043_0014657 | Ga0501043_0014657_3194_3475 | 81 |
| 528 | 3300049580 | Ga0501046_0012194 | Ga0501046_0012194_3198_3479 | 81 |
| 529 | 3300049582 | Ga0501048_0146224 | Ga0501048_0146224_644_925 | 81 |
| 530 | 3300049584 | Ga0501068_0130528 | Ga0501068_0130528_584_865 | 81 |
| 531 | 3300049586 | Ga0501070_0258061 | Ga0501070_0258061_35_316 | 81 |
| 532 | 3300049589 | Ga0501073_0092712 | Ga0501073_0092712_1423_1704 | 81 |
| 533 | 3300049589 | Ga0501073_1025172 | Ga0501073_1025172_190_471 | 81 |
| 534 | 3300049590 | Ga0501074_0142476 | Ga0501074_0142476_1264_1545 | 81 |
| 535 | 3300049742 | Ga0501080_0635442 | Ga0501080_0635442_73_354 | 81 |
| 536 | 3300049822 | Ga0501035_0015193 | Ga0501035_0015193_1417_1698 | 81 |
| 537 | 3300049823 | Ga0501044_0062717 | Ga0501044_0062717_3214_3495 | 81 |
| 538 | 3300049823 | Ga0501044_0163845 | Ga0501044_0163845_248_529 | 81 |
| 539 | 3300050489 | nmdc:mga03683_166749_c1 | nmdc:mga03683_166749_c1_362_649 | 81 |
| 540 | 3300050507 | nmdc:mga05p37_9008_c1 | nmdc:mga05p37_9008_c1_1037_1321 | 81 |
| 541 | 3300054114 | Ga0501084_1630284 | Ga0501084_1630284_48_329 | 81 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2v6u-assembly1.cif.gz_A | high resolution crystal structure of pterin-4a-carbinolamine dehydratase from toxoplasma gondii | 0.964 | 2 | 80 |
| 1usm-assembly1.cif.gz_A-2 | dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant | 0.9588 | 6 | 79 |
| 1uso-assembly1.cif.gz_A | dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant | 0.9569 | 7 | 79 |
| 4wil-assembly1.cif.gz_A | crystal structure of dcoh2 s51t | 0.9514 | 7 | 80 |
| 1ru0-assembly1.cif.gz_A | crystal structure of dcoh2, a paralog of dcoh, the dimerization cofactor of hnf-1 | 0.9514 | 7 | 80 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5ACY8_6_110_3.30.1360.20 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase | 0.9729 | 7 | 81 | 3.30.1360.20 |
| af_P9WI93_1_93_3.30.1360.20 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase | 0.9729 | 4 | 79 | 3.30.1360.20 |
| af_O42658_1_95_3.30.1360.20 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase | 0.971 | 7 | 80 | 3.30.1360.20 |
| af_Q4CYK3_54_151_3.30.1360.20 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase | 0.9667 | 2 | 81 | 3.30.1360.20 |
| af_C6S3E6_5_100_3.30.1360.20 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase | 0.966 | 2 | 79 | 3.30.1360.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5T007-F1-model_v4 | Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) | 1.005 | 5 | 81 |
GO:0006729
GO:0008124 |
| AF-A0A2V6ANW9-F1-model_v4 | Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) | 1.003 | 1 | 81 |
GO:0006729
GO:0008124 |
| AF-A0A838FUV4-F1-model_v4 | Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) | 1.003 | 2 | 81 |
GO:0006729
GO:0008124 |
| AF-A0A7V9ZYA0-F1-model_v4 | Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) | 1.002 | 2 | 81 |
GO:0006729
GO:0008124 |
| AF-A0A2G9MS73-F1-model_v4 | 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) | 1.002 | 4 | 78 |
GO:0006729
GO:0008124 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar