F461235

General Info

Members Datasets Scaffolds Average Seq Length
540 223 1080 291

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10027816|Ga0213872_100278162
Length 324
Sequence MSGVQRVPGGQPCYDGGNGCSPSQPTEVSLMSPFSRREFIKGSLAAGTLAGIGTLPLQAKARTATDTVTLGKSGMQVTRLAFGTGSNGGEVQAALGQKEFSRLVAYAYDHGLRFFETAEAYQTPAMLGEALKPYPRDSYKLMSKITTFHEGDPLTRLYEQRRISQTEYFDIMLLHWQHTPDWTTTTARWQDAILEAQAKKTILTRGASVHGLPALRQMPGNQWLQIAMIRMNHNGTRMDGPTYEDNNNPDHVTEVVEHVKQVHSQGMGVISMKLCGNGNFTKREDRQAAMRFAFNHAGVDCVTVGFKNTGEIDEAIENVNLALA

Samples

Sample ID Description Type Environment
1 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
132 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
137 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
138 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
139 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
141 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
194 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.7
Metatranscriptomes 6.11
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.33
Rhizosphere 95.19
Stem 0
Stem Tuber 0
Unclassified 28.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213872_10027816 3300021361 Bacteria 2594
2 rootH2_10068752 3300003320 Bacteria 15287
3 Ga0070658_10013171 3300005327 Bacteria 6634
4 Ga0070658_10161377 3300005327 Bacteria 1880
5 Ga0070658_10248661 3300005327 Bacteria 1508
6 Ga0070676_10095799 3300005328 Unclassified 1825
7 Ga0070683_100000006 3300005329 Bacteria 361071
8 Ga0070683_100000090 3300005329 Bacteria 59739
9 Ga0070683_100068633 3300005329 Bacteria 3303
10 Ga0070683_100231412 3300005329 Unclassified 1757
11 Ga0070683_100485320 3300005329 Bacteria 1180
12 Ga0070670_100000411 3300005331 Bacteria 35280
13 Ga0070670_100029502 3300005331 Bacteria 4723
14 Ga0068869_100000036 3300005334 Bacteria 55466
15 Ga0068869_100285365 3300005334 Unclassified 1329
16 Ga0070682_100043629 3300005337 Unclassified 2774
17 Ga0068868_100000152 3300005338 Bacteria 44788
18 Ga0068868_100518788 3300005338 Unclassified 1046
19 Ga0070660_100235790 3300005339 Bacteria 1489
20 Ga0070661_100039486 3300005344 Bacteria 3439
21 Ga0070661_100055122 3300005344 Bacteria 2911
22 Ga0070661_100205721 3300005344 Bacteria 1505
23 Ga0070668_100077867 3300005347 Unclassified 2592
24 Ga0070671_100036061 3300005355 Bacteria 4100
25 Ga0070667_100000709 3300005367 Bacteria 32126
26 Ga0070709_10000498 3300005434 Bacteria 23165
27 Ga0070714_100036624 3300005435 Bacteria 4116
28 Ga0070714_100117216 3300005435 Bacteria 2365
29 Ga0070714_100303590 3300005435 Unclassified 1489
30 Ga0070713_100000322 3300005436 Bacteria 31317
31 Ga0070713_100016467 3300005436 Bacteria 5559
32 Ga0070713_100048771 3300005436 Unclassified 3489
33 Ga0070713_100076649 3300005436 Unclassified 2841
34 Ga0070713_100211257 3300005436 Bacteria 1757
35 Ga0070710_10011092 3300005437 Unclassified 4443
36 Ga0070710_10079315 3300005437 Unclassified 1913
37 Ga0070711_100065877 3300005439 Bacteria 2535
38 Ga0070711_100147501 3300005439 Unclassified 1771
39 Ga0070663_100010906 3300005455 Bacteria 5678
40 Ga0070663_100077401 3300005455 Bacteria 2435
41 Ga0070678_100198742 3300005456 Bacteria 1653
42 Ga0070662_100095633 3300005457 Unclassified 2239
43 Ga0070681_10006466 3300005458 Bacteria 11407
44 Ga0070681_10008726 3300005458 Bacteria 9945
45 Ga0070685_10365560 3300005466 Bacteria 990
46 Ga0070679_100195637 3300005530 Bacteria 1989
47 Ga0070684_100000889 3300005535 Bacteria 21143
48 Ga0070684_100009388 3300005535 Bacteria 7702
49 Ga0070684_100024793 3300005535 Bacteria 5034
50 Ga0070684_100035098 3300005535 Unclassified 4290
51 Ga0070684_100064002 3300005535 Bacteria 3226
52 Ga0070684_100513117 3300005535 Unclassified 1111
53 Ga0070697_100266776 3300005536 Bacteria 1467
54 Ga0068853_100000203 3300005539 Bacteria 41915
55 Ga0068853_100061472 3300005539 Bacteria 3249
56 Ga0068853_100073407 3300005539 Bacteria 2983
57 Ga0070672_100063539 3300005543 Bacteria 2915
58 Ga0070665_100002484 3300005548 Bacteria 20306
59 Ga0070665_100037955 3300005548 Bacteria 4843
60 Ga0070665_100042539 3300005548 Bacteria 4567
61 Ga0070665_100131364 3300005548 Bacteria 2506
62 Ga0070665_100358362 3300005548 Bacteria 1464
63 Ga0068855_100002968 3300005563 Bacteria 20742
64 Ga0068855_100013422 3300005563 Bacteria 9879
65 Ga0068855_100039278 3300005563 Bacteria 5618
66 Ga0068855_100152839 3300005563 Bacteria 2624
67 Ga0070664_100089095 3300005564 Bacteria 2669
68 Ga0068857_100001869 3300005577 Bacteria 16949
69 Ga0068857_100002976 3300005577 Bacteria 13962
70 Ga0068856_100000187 3300005614 Bacteria 64851
71 Ga0068856_100019986 3300005614 Bacteria 6501
72 Ga0068856_100033425 3300005614 Bacteria 5035
73 Ga0068856_100059384 3300005614 Bacteria 3778
74 Ga0068856_100090377 3300005614 Bacteria 3046
75 Ga0068856_100108662 3300005614 Bacteria 2770
76 Ga0068856_100186551 3300005614 Bacteria 2088
77 Ga0068852_100000008 3300005616 Bacteria 154351
78 Ga0068852_100000082 3300005616 Bacteria 67016
79 Ga0068852_100044163 3300005616 Bacteria 3783
80 Ga0068852_100062164 3300005616 Bacteria 3247
81 Ga0068852_100070598 3300005616 Unclassified 3065
82 Ga0068852_100080148 3300005616 Bacteria 2894
83 Ga0068852_100192719 3300005616 Bacteria 1924
84 Ga0068852_100432265 3300005616 Bacteria 1300
85 Ga0068859_100009321 3300005617 Bacteria 9909
86 Ga0068859_100343015 3300005617 Bacteria 1588
87 Ga0068864_100003925 3300005618 Bacteria 12252
88 Ga0068851_10001200 3300005834 Bacteria 11246
89 Ga0068851_10008990 3300005834 Unclassified 4635
90 Ga0068851_10020267 3300005834 Bacteria 3218
91 Ga0068863_100000811 3300005841 Bacteria 31348
92 Ga0068863_100043253 3300005841 Bacteria 4276
93 Ga0068863_100082041 3300005841 Bacteria 3055
94 Ga0068858_100000955 3300005842 Bacteria 29910
95 Ga0068858_100082987 3300005842 Bacteria 2980
96 Ga0068858_100379438 3300005842 Unclassified 1356
97 Ga0068858_100521534 3300005842 Unclassified 1149
98 Ga0068860_100000854 3300005843 Bacteria 33984
99 Ga0068860_100588020 3300005843 Bacteria 1118
100 Ga0068862_100061153 3300005844 Bacteria 3237
101 Ga0081540_1036279 3300005983 Bacteria 2631
102 Ga0081540_1058906 3300005983 Bacteria 1847
103 Ga0081539_10022163 3300005985 Bacteria 4212
104 Ga0070717_10001169 3300006028 Bacteria 17721
105 Ga0070717_10023076 3300006028 Unclassified 4924
106 Ga0070717_10047743 3300006028 Bacteria 3509
107 Ga0070715_10025728 3300006163 Unclassified 2335
108 Ga0070716_100007168 3300006173 Bacteria 5480
109 Ga0070716_100023022 3300006173 Unclassified 3299
110 Ga0070716_100074688 3300006173 Unclassified 2004
111 Ga0070712_100000456 3300006175 Bacteria 23452
112 Ga0070712_100056055 3300006175 Unclassified 2763
113 Ga0070712_100064368 3300006175 Unclassified 2600
114 Ga0070712_100225162 3300006175 Unclassified 1487
115 Ga0097621_100000450 3300006237 Bacteria 28799
116 Ga0097621_100003099 3300006237 Bacteria 11403
117 Ga0097621_100018742 3300006237 Bacteria 5295
118 Ga0097621_100073459 3300006237 Unclassified 2831
119 Ga0068871_100000380 3300006358 Bacteria 31116
120 Ga0068871_100013157 3300006358 Bacteria 6136
121 Ga0068871_100017473 3300006358 Bacteria 5429
122 Ga0068871_100032506 3300006358 Bacteria 4123
123 Ga0068871_100206843 3300006358 Unclassified 1696
124 Ga0068865_100015780 3300006881 Unclassified 4819
125 Ga0097620_100009321 3300006931 Bacteria 9909
126 Ga0097620_100343013 3300006931 Bacteria 1588
127 Ga0105240_10000038 3300009093 Bacteria 270341
128 Ga0105240_10000360 3300009093 Bacteria 85690
129 Ga0105240_10000983 3300009093 Bacteria 50850
130 Ga0105240_10006147 3300009093 Bacteria 17705
131 Ga0105240_10008566 3300009093 Bacteria 14616
132 Ga0105240_10016990 3300009093 Bacteria 9829
133 Ga0105240_10019362 3300009093 Bacteria 9096
134 Ga0105240_10693748 3300009093 Unclassified 1112
135 Ga0111539_10296306 3300009094 Unclassified 1882
136 Ga0105245_10000372 3300009098 Bacteria 41796
137 Ga0105245_10002893 3300009098 Bacteria 15415
138 Ga0105245_10179958 3300009098 Bacteria 2019
139 Ga0105247_10001579 3300009101 Bacteria 16180
140 Ga0105247_10264026 3300009101 Bacteria 1181
141 Ga0105241_10000026 3300009174 Bacteria 132695
142 Ga0105241_10000429 3300009174 Bacteria 31800
143 Ga0105241_10000588 3300009174 Bacteria 27439
144 Ga0105241_10010226 3300009174 Bacteria 6892
145 Ga0105241_10059926 3300009174 Unclassified 2928
146 Ga0105241_10130233 3300009174 Bacteria 2036
147 Ga0105242_10376502 3300009176 Unclassified 1318
148 Ga0105242_10723228 3300009176 Bacteria 977
149 Ga0105248_10000004 3300009177 Bacteria 695244
150 Ga0105248_10018823 3300009177 Bacteria 7637
151 Ga0105248_10034837 3300009177 Bacteria 5633
152 Ga0105248_10366351 3300009177 Bacteria 1622
153 Ga0105248_10437391 3300009177 Bacteria 1473
154 Ga0105248_10492852 3300009177 Unclassified 1381
155 Ga0105248_10609952 3300009177 Bacteria 1231
156 Ga0105248_10661262 3300009177 Unclassified 1179
157 Ga0105237_10001153 3300009545 Bacteria 35396
158 Ga0105237_10012752 3300009545 Bacteria 8840
159 Ga0105237_10025910 3300009545 Bacteria 5995
160 Ga0105237_10031781 3300009545 Bacteria 5347
161 Ga0105237_10032425 3300009545 Bacteria 5290
162 Ga0105237_10051003 3300009545 Bacteria 4158
163 Ga0105237_10059732 3300009545 Bacteria 3814
164 Ga0105237_10250859 3300009545 Bacteria 1772
165 Ga0105237_10358887 3300009545 Unclassified 1462
166 Ga0105237_10369560 3300009545 Unclassified 1439
167 Ga0105238_10000137 3300009551 Bacteria 80931
168 Ga0105238_10000218 3300009551 Bacteria 63093
169 Ga0105238_10001537 3300009551 Bacteria 23148
170 Ga0105238_10009372 3300009551 Bacteria 9798
171 Ga0105238_10016086 3300009551 Bacteria 7565
172 Ga0105238_10033638 3300009551 Bacteria 5216
173 Ga0105238_10047816 3300009551 Unclassified 4312
174 Ga0105238_10080962 3300009551 Bacteria 3236
175 Ga0105238_10148750 3300009551 Bacteria 2318
176 Ga0105249_10037792 3300009553 Bacteria 4381
177 Ga0105249_10120269 3300009553 Bacteria 2495
178 Ga0105249_10873964 3300009553 Unclassified 965
179 Ga0105239_10001628 3300010375 Bacteria 29653
180 Ga0105239_10003331 3300010375 Bacteria 19772
181 Ga0105239_10004953 3300010375 Bacteria 15722
182 Ga0105239_10251760 3300010375 Bacteria 1984
183 Ga0105239_10494148 3300010375 Unclassified 1391
184 Ga0105246_10000487 3300011119 Bacteria 21462
185 Ga0157373_10035248 3300013100 Unclassified 3593
186 Ga0157373_10070506 3300013100 Bacteria 2470
187 Ga0157373_10378437 3300013100 Bacteria 1012
188 Ga0157371_10027364 3300013102 Bacteria 4136
189 Ga0157370_10000130 3300013104 Bacteria 89817
190 Ga0157370_10137395 3300013104 Bacteria 2278
191 Ga0157370_10446995 3300013104 Unclassified 1188
192 Ga0157369_10000058 3300013105 Bacteria 154342
193 Ga0157369_10001028 3300013105 Bacteria 35223
194 Ga0157369_10002904 3300013105 Bacteria 20480
195 Ga0157369_10008970 3300013105 Bacteria 11455
196 Ga0157369_10019950 3300013105 Bacteria 7496
197 Ga0157369_10030039 3300013105 Bacteria 5997
198 Ga0157369_10056574 3300013105 Bacteria 4232
199 Ga0157369_10081547 3300013105 Plasmid 3462
200 Ga0157369_10090084 3300013105 Bacteria 3275
201 Ga0157369_10189082 3300013105 Bacteria 2164
202 Ga0157374_10000512 3300013296 Bacteria 34928
203 Ga0157374_10005667 3300013296 Bacteria 10525
204 Ga0157374_10005714 3300013296 Bacteria 10496
205 Ga0157374_10007314 3300013296 Bacteria 9413
206 Ga0157374_10007590 3300013296 Bacteria 9255
207 Ga0157374_10014675 3300013296 Bacteria 6857
208 Ga0157374_10017211 3300013296 Bacteria 6363
209 Ga0157374_10173514 3300013296 Bacteria 2104
210 Ga0157374_10197596 3300013296 Bacteria 1968
211 Ga0157378_10003221 3300013297 Bacteria 14517
212 Ga0157378_10005121 3300013297 Bacteria 11508
213 Ga0157378_10116562 3300013297 Unclassified 2456
214 Ga0163162_10001417 3300013306 Bacteria 22285
215 Ga0163162_10032285 3300013306 Bacteria 5199
216 Ga0163162_10115175 3300013306 Unclassified 2788
217 Ga0163162_10823413 3300013306 Unclassified 1045
218 Ga0157372_10000163 3300013307 Bacteria 73216
219 Ga0157372_10009471 3300013307 Bacteria 10358
220 Ga0157372_10009618 3300013307 Bacteria 10274
221 Ga0157372_10015810 3300013307 Bacteria 8096
222 Ga0157372_10018728 3300013307 Bacteria 7449
223 Ga0157372_10033478 3300013307 Bacteria 5645
224 Ga0157372_10045824 3300013307 Bacteria 4853
225 Ga0157372_10050697 3300013307 Bacteria 4616
226 Ga0157372_10054160 3300013307 Bacteria 4474
227 Ga0157372_10095186 3300013307 Bacteria 3392
228 Ga0157372_10106139 3300013307 Bacteria 3213
229 Ga0157375_10001295 3300013308 Bacteria 21530
230 Ga0157375_10017125 3300013308 Bacteria 6533
231 Ga0163163_10000826 3300014325 Bacteria 26368
232 Ga0163163_10048927 3300014325 Bacteria 4159
233 Ga0163163_10069858 3300014325 Bacteria 3497
234 Ga0163163_10178122 3300014325 Bacteria 2173
235 Ga0163163_10196400 3300014325 Unclassified 2066
236 Ga0157377_10039283 3300014745 Bacteria 2617
237 Ga0157379_10000147 3300014968 Bacteria 51402
238 Ga0157379_10186905 3300014968 Bacteria 1872
239 Ga0157376_10000447 3300014969 Bacteria 26609
240 Ga0157376_10167041 3300014969 Unclassified 2000
241 Ga0206352_10338750 3300020078 Bacteria 957
242 Ga0206352_10822384 3300020078 Bacteria 1041
243 Ga0213873_10041264 3300021358 Unclassified 1189
244 Ga0213872_10005995 3300021361 Bacteria 6161
245 Ga0213872_10011855 3300021361 Unclassified 4117
246 Ga0213876_10046343 3300021384 Unclassified 2298
247 Ga0224712_10164438 3300022467 Bacteria 992
248 Ga0207656_10014445 3300025321 Bacteria 3042
249 Ga0207656_10024981 3300025321 Bacteria 2422
250 Ga0207656_10041312 3300025321 Bacteria 1959
251 Ga0207656_10054917 3300025321 Bacteria 1732
252 Ga0207692_10031833 3300025898 Unclassified 2529
253 Ga0207692_10036677 3300025898 Unclassified 2393
254 Ga0207710_10000251 3300025900 Bacteria 44887
255 Ga0207710_10056068 3300025900 Bacteria 1778
256 Ga0207685_10041010 3300025905 Unclassified 1729
257 Ga0207699_10002436 3300025906 Bacteria 8782
258 Ga0207699_10357006 3300025906 Unclassified 1033
259 Ga0207705_10181192 3300025909 Bacteria 1590
260 Ga0207705_10185675 3300025909 Unclassified 1571
261 Ga0207654_10000017 3300025911 Bacteria 201589
262 Ga0207654_10000099 3300025911 Bacteria 57684
263 Ga0207654_10000135 3300025911 Bacteria 47542
264 Ga0207654_10052669 3300025911 Unclassified 2347
265 Ga0207707_10003922 3300025912 Bacteria 13211
266 Ga0207707_10070977 3300025912 Bacteria 3035
267 Ga0207695_10000070 3300025913 Bacteria 318111
268 Ga0207695_10000080 3300025913 Bacteria 287868
269 Ga0207695_10000113 3300025913 Bacteria 247240
270 Ga0207695_10000561 3300025913 Bacteria 76257
271 Ga0207695_10005420 3300025913 Bacteria 16928
272 Ga0207695_10020454 3300025913 Bacteria 7579
273 Ga0207695_10028959 3300025913 Bacteria 6129
274 Ga0207695_10165623 3300025913 Unclassified 2139
275 Ga0207695_10497044 3300025913 Bacteria 1102
276 Ga0207671_10000065 3300025914 Bacteria 166743
277 Ga0207671_10000123 3300025914 Bacteria 119385
278 Ga0207671_10052764 3300025914 Bacteria 3013
279 Ga0207671_10101167 3300025914 Bacteria 2183
280 Ga0207671_10170636 3300025914 Bacteria 1689
281 Ga0207671_10248924 3300025914 Bacteria 1397
282 Ga0207693_10000055 3300025915 Bacteria 96481
283 Ga0207693_10032288 3300025915 Bacteria 4132
284 Ga0207693_10220696 3300025915 Unclassified 1489
285 Ga0207663_10097796 3300025916 Unclassified 1964
286 Ga0207663_10282251 3300025916 Bacteria 1234
287 Ga0207649_10023678 3300025920 Bacteria 3559
288 Ga0207649_10060761 3300025920 Bacteria 2376
289 Ga0207649_10087657 3300025920 Bacteria 2031
290 Ga0207649_10183162 3300025920 Bacteria 1467
291 Ga0207694_10000112 3300025924 Bacteria 85385
292 Ga0207694_10000215 3300025924 Bacteria 56422
293 Ga0207694_10000940 3300025924 Bacteria 25679
294 Ga0207694_10028751 3300025924 Bacteria 4240
295 Ga0207694_10056904 3300025924 Bacteria 3039
296 Ga0207694_10124201 3300025924 Bacteria 2063
297 Ga0207694_10143225 3300025924 Unclassified 1923
298 Ga0207694_10206964 3300025924 Bacteria 1598
299 Ga0207650_10003613 3300025925 Bacteria 10606
300 Ga0207659_10149008 3300025926 Unclassified 1825
301 Ga0207687_10009806 3300025927 Bacteria 6268
302 Ga0207687_10163393 3300025927 Bacteria 1711
303 Ga0207700_10000206 3300025928 Bacteria 35436
304 Ga0207700_10087796 3300025928 Unclassified 2446
305 Ga0207700_10251516 3300025928 Unclassified 1510
306 Ga0207664_10103355 3300025929 Unclassified 2358
307 Ga0207664_10210827 3300025929 Bacteria 1681
308 Ga0207664_10314785 3300025929 Unclassified 1380
309 Ga0207644_10003113 3300025931 Bacteria 10669
310 Ga0207644_10059855 3300025931 Bacteria 2755
311 Ga0207706_10010126 3300025933 Bacteria 8632
312 Ga0207665_10030737 3300025939 Unclassified 3551
313 Ga0207665_10032962 3300025939 Unclassified 3432
314 Ga0207665_10048659 3300025939 Bacteria 2847
315 Ga0207691_10079783 3300025940 Bacteria 2945
316 Ga0207711_10000008 3300025941 Bacteria 597686
317 Ga0207711_10000010 3300025941 Bacteria 557970
318 Ga0207711_10001485 3300025941 Bacteria 21833
319 Ga0207711_10033102 3300025941 Bacteria 4372
320 Ga0207711_10144138 3300025941 Unclassified 2145
321 Ga0207711_10428298 3300025941 Bacteria 1231
322 Ga0207689_10001390 3300025942 Bacteria 23168
323 Ga0207689_10376561 3300025942 Unclassified 1182
324 Ga0207661_10000357 3300025944 Bacteria 29408
325 Ga0207661_10199548 3300025944 Unclassified 1758
326 Ga0207661_10434829 3300025944 Bacteria 1193
327 Ga0207679_10047692 3300025945 Bacteria 3114
328 Ga0207667_10003542 3300025949 Bacteria 19311
329 Ga0207667_10015867 3300025949 Bacteria 8533
330 Ga0207667_10018059 3300025949 Bacteria 7921
331 Ga0207667_10056227 3300025949 Bacteria 4134
332 Ga0207667_10143946 3300025949 Bacteria 2454
333 Ga0207667_10195382 3300025949 Bacteria 2076
334 Ga0207667_10217909 3300025949 Unclassified 1956
335 Ga0207712_10150259 3300025961 Bacteria 1798
336 Ga0207668_10032491 3300025972 Unclassified 3449
337 Ga0207640_10009572 3300025981 Bacteria 5432
338 Ga0207640_10034352 3300025981 Bacteria 3165
339 Ga0207640_10160081 3300025981 Bacteria 1664
340 Ga0207658_10000546 3300025986 Bacteria 34065
341 Ga0207677_10000114 3300026023 Bacteria 65804
342 Ga0207677_10060729 3300026023 Bacteria 2614
343 Ga0207703_10001906 3300026035 Bacteria 18491
344 Ga0207703_10064635 3300026035 Bacteria 3004
345 Ga0207703_10616529 3300026035 Unclassified 1027
346 Ga0207639_10000233 3300026041 Bacteria 41490
347 Ga0207639_10092285 3300026041 Bacteria 2426
348 Ga0207639_10094845 3300026041 Bacteria 2396
349 Ga0207639_10115648 3300026041 Bacteria 2194
350 Ga0207639_10482253 3300026041 Bacteria 1130
351 Ga0207678_10034906 3300026067 Bacteria 4379
352 Ga0207678_10136564 3300026067 Bacteria 2092
353 Ga0207702_10000343 3300026078 Bacteria 53525
354 Ga0207702_10000611 3300026078 Bacteria 39477
355 Ga0207702_10001988 3300026078 Bacteria 19846
356 Ga0207702_10036564 3300026078 Bacteria 4108
357 Ga0207702_10142973 3300026078 Bacteria 2167
358 Ga0207702_10282767 3300026078 Bacteria 1569
359 Ga0207641_10000319 3300026088 Bacteria 59351
360 Ga0207641_10003282 3300026088 Bacteria 14396
361 Ga0207641_10062036 3300026088 Bacteria 3189
362 Ga0207641_10152510 3300026088 Bacteria 2094
363 Ga0207641_10160389 3300026088 Unclassified 2044
364 Ga0207641_10279120 3300026088 Unclassified 1571
365 Ga0207676_10007628 3300026095 Bacteria 7682
366 Ga0207674_10000479 3300026116 Bacteria 52694
367 Ga0207674_10001109 3300026116 Bacteria 34940
368 Ga0207674_10077429 3300026116 Unclassified 3331
369 Ga0207674_10447033 3300026116 Bacteria 1249
370 Ga0207683_10001725 3300026121 Bacteria 19490
371 Ga0207698_10000010 3300026142 Bacteria 270583
372 Ga0207698_10000066 3300026142 Bacteria 70450
373 Ga0207698_10055735 3300026142 Bacteria 3049
374 Ga0207698_10123151 3300026142 Bacteria 2199
375 Ga0207698_10130113 3300026142 Bacteria 2149
376 Ga0207698_10158989 3300026142 Bacteria 1973
377 Ga0268266_10017152 3300028379 Bacteria 6183
378 Ga0268266_10042517 3300028379 Bacteria 3882
379 Ga0268266_10093654 3300028379 Bacteria 2636
380 Ga0268266_10219847 3300028379 Bacteria 1746
381 Ga0268265_10175469 3300028380 Bacteria 1836
382 Ga0268264_10000718 3300028381 Bacteria 38048
383 Ga0268264_10265703 3300028381 Bacteria 1601
384 Ga0268264_10344482 3300028381 Bacteria 1417
385 Ga0268264_10621022 3300028381 Unclassified 1067
386 Ga0265338_10012853 3300028800 Bacteria 9514
387 Ga0265338_10176969 3300028800 Bacteria 1630
388 Ga0265760_10048201 3300031090 Bacteria 1280
389 Ga0265330_10000375 3300031235 Bacteria 31300
390 Ga0265330_10002693 3300031235 Bacteria 9595
391 Ga0265325_10000051 3300031241 Bacteria 78605
392 Ga0265325_10014063 3300031241 Bacteria 4537
393 Ga0265325_10073152 3300031241 Bacteria 1716
394 Ga0265325_10116547 3300031241 Bacteria 1292
395 Ga0265325_10126955 3300031241 Unclassified 1225
396 Ga0265340_10033458 3300031247 Bacteria 2559
397 Ga0265339_10002079 3300031249 Bacteria 14664
398 Ga0265339_10088598 3300031249 Unclassified 1625
399 Ga0265316_10000539 3300031344 Bacteria 42671
400 Ga0265316_10027073 3300031344 Bacteria 4756
401 Ga0265316_10079431 3300031344 Bacteria 2517
402 Ga0265316_10235439 3300031344 Bacteria 1347
403 Ga0265313_10002617 3300031595 Bacteria 15308
404 Ga0265313_10042380 3300031595 Bacteria 2236
405 Ga0265313_10065272 3300031595 Bacteria 1690
406 Ga0265314_10004981 3300031711 Bacteria 12109
407 Ga0265314_10084913 3300031711 Bacteria 2077
408 Ga0265314_10085513 3300031711 Unclassified 2067
409 Ga0265314_10162542 3300031711 Bacteria 1357
410 Ga0265314_10215320 3300031711 Bacteria 1125
411 Ga0265342_10000671 3300031712 Bacteria 35667
412 Ga0373926_0012571 3300035083 Unclassified 2863
413 Ga0373934_0094328 3300035086 Unclassified 1208
414 Ga0373936_0048750 3300035113 Unclassified 1710
415 Ga0373945_0012813 3300035116 Unclassified 2791
416 Ga0373957_0127025 3300035120 Bacteria 1036
417 Ga0373955_0097220 3300035172 Bacteria 1686
418 Ga0373955_0142863 3300035172 Unclassified 1404
419 Ga0373955_0247663 3300035172 Unclassified 1068
420 Ga0373924_0180927 3300035410 Bacteria 928
421 Ga0373931_0198066 3300035691 Unclassified 1198
422 Ga0373931_0215187 3300035691 Bacteria 1154
423 Ga0373935_0010978 3300035692 Bacteria 5441
424 Ga0373935_0035599 3300035692 Bacteria 3108
425 Ga0373935_0110941 3300035692 Unclassified 1821
426 Ga0373935_0296122 3300035692 Unclassified 1142
427 Ga0373927_0001395 3300035695 Bacteria 18205
428 Ga0373927_0003161 3300035695 Bacteria 11889
429 Ga0373947_0001412 3300035725 Bacteria 14801
430 Ga0373947_0072768 3300035725 Unclassified 2111
431 Ga0373947_0098598 3300035725 Unclassified 1833
432 Ga0373947_0111599 3300035725 Bacteria 1728
433 Ga0373937_0032125 3300036401 Unclassified 4760
434 Ga0373937_0098872 3300036401 Unclassified 2707
435 Ga0373937_0394501 3300036401 Bacteria 1313
436 Ga0373925_0000103 3300037068 Bacteria 92575
437 Ga0373925_0002912 3300037068 Bacteria 13499
438 Ga0373925_0038795 3300037068 Unclassified 3523
439 Ga0436364_0020384 3300037853 Unclassified 3397
440 Ga0436364_0334239 3300037853 Bacteria 90865
441 Ga0436364_0903129 3300037853 Unclassified 3857
442 Ga0436365_1573905 3300039437 Unclassified 2084
443 Ga0436361_0089440 3300039447 Bacteria 1217
444 Ga0436361_1098452 3300039447 Bacteria 8208
445 Ga0436363_1486660 3300039450 Bacteria 8926
446 Ga0436362_0596821 3300039453 Bacteria 9267
447 Ga0466961_0071478 3300044693 Bacteria 2202
448 Ga0466961_0227731 3300044693 Bacteria 1148
449 Ga0466963_0012081 3300044694 Bacteria 5277
450 Ga0466963_0091807 3300044694 Unclassified 2069
451 Ga0453684_0202660 3300044712 Bacteria 2312
452 Ga0451576_0131700 3300045051 Bacteria 2607
453 Ga0451576_0185680 3300045051 Bacteria 2171
454 Ga0451576_0200622 3300045051 Bacteria 2084
455 Ga0466967_0004075 3300045976 Bacteria 9753
456 Ga0466967_0059643 3300045976 Bacteria 3379
457 Ga0466967_0187282 3300045976 Unclassified 1955
458 Ga0495629_0053351 3300046459 Unclassified 2829
459 Ga0495629_0064782 3300046459 Bacteria 2551
460 Ga0495651_0265279 3300046462 Bacteria 1167
461 Ga0495580_0062903 3300046472 Unclassified 2603
462 Ga0495580_0224514 3300046472 Unclassified 1290
463 Ga0495580_0257663 3300046472 Unclassified 1193
464 Ga0495582_0004662 3300046473 Bacteria 7711
465 Ga0495582_0061804 3300046473 Bacteria 2069
466 Ga0495664_0058845 3300046477 Unclassified 2287
467 Ga0495664_0255623 3300046477 Unclassified 1059
468 Ga0495630_0053887 3300046517 Unclassified 3013
469 Ga0495652_0249500 3300046529 Bacteria 1316
470 Ga0495665_0161181 3300046531 Unclassified 1169
471 Ga0495587_0099971 3300046536 Bacteria 1672
472 Ga0495667_0047233 3300046559 Unclassified 2845
473 Ga0495634_0114037 3300046642 Bacteria 1736
474 Ga0495657_0217418 3300046675 Unclassified 1160
475 Ga0495623_0261225 3300046679 Bacteria 970
476 Ga0495669_0017386 3300046684 Bacteria 3087
477 Ga0495669_0090167 3300046684 Unclassified 1415
478 Ga0495624_0033121 3300046690 Unclassified 3348
479 Ga0495674_0045075 3300047319 Unclassified 3917
480 Ga0495674_0141562 3300047319 Unclassified 2021
481 Ga0495676_0218186 3300047321 Bacteria 1316
482 Ga0495675_0104987 3300047444 Bacteria 1766
483 Ga0495684_0016913 3300047471 Bacteria 5619
484 Ga0495684_0418681 3300047471 Unclassified 937
485 Ga0496101_0217129 3300048904 Unclassified 1483
486 Ga0496102_0444796 3300048905 Unclassified 1216
487 Ga0496104_0128665 3300048907 Unclassified 2432
488 Ga0496104_0215642 3300048907 Bacteria 1831
489 Ga0496104_0300558 3300048907 Bacteria 1517
490 Ga0496104_0346138 3300048907 Bacteria 1399
491 Ga0496104_0388081 3300048907 Unclassified 1309
492 Ga0496105_0123954 3300048908 Bacteria 2130
493 Ga0496105_0290208 3300048908 Bacteria 1317
494 Ga0496106_0239391 3300048909 Unclassified 1450
495 Ga0496107_0389361 3300048910 Unclassified 1037
496 Ga0496110_0109429 3300048913 Bacteria 2482
497 Ga0496114_0085295 3300048917 Unclassified 2675
498 Ga0496114_0184147 3300048917 Unclassified 1825
499 Ga0496114_0253188 3300048917 Bacteria 1550
500 Ga0496115_0033436 3300048918 Unclassified 4060
501 Ga0496115_0241265 3300048918 Bacteria 1489
502 Ga0496115_0401303 3300048918 Bacteria 1112
503 Ga0496126_0081625 3300048929 Bacteria 2858
504 Ga0501037_0288966 3300049573 Bacteria 1141
505 Ga0501047_0345829 3300049581 Bacteria 1324
506 Ga0501044_0003939 3300049823 Bacteria 16637
507 Ga0501044_0100336 3300049823 Bacteria 2913
508 Ga0501044_0399755 3300049823 Unclassified 1287
509 Ga0495601_0077985 3300053077 Unclassified 2122
510 Ga0495619_0300820 3300053085 Unclassified 1111
511 Ga0587084_019654 3300059477 Unclassified 997
512 Ga0587066_030966 3300059490 Unclassified 953
513 Ga0587070_034064 3300059491 Unclassified 940
514 Ga0587073_0052568 3300059492 Bacteria 929
515 Ga0587077_032200 3300059493 Unclassified 1006
516 Ga0587082_028036 3300059504 Unclassified 964
517 Ga0587083_0036304 3300059505 Unclassified 1009
518 Ga0587085_024332 3300059506 Unclassified 948
519 Ga0587086_012254 3300059507 Unclassified 1063
520 Ga0587088_032262 3300059508 Unclassified 943
521 Ga0587089_015614 3300059509 Unclassified 1004
522 Ga0587090_020956 3300059510 Unclassified 1021
523 Ga0587091_036423 3300059511 Unclassified 950
524 Ga0587092_025815 3300059512 Bacteria 940
525 Ga0587094_021209 3300059513 Unclassified 945
526 Ga0587095_005233 3300059514 Unclassified 975
527 Ga0587101_015909 3300059623 Unclassified 1024
528 Ga0587109_036950 3300059624 Unclassified 953
529 Ga0587115_018632 3300059626 Unclassified 947
530 Ga0587117_015396 3300059627 Unclassified 1005
531 Ga0587128_019984 3300059630 Unclassified 1019
532 Ga0587067_035435 3300059640 Unclassified 944
533 Ga0587076_030918 3300059645 Unclassified 948
534 Ga0587078_014119 3300059646 Unclassified 953
535 Ga0587079_030614 3300059647 Unclassified 1032
536 Ga0587107_017840 3300059652 Unclassified 954
537 Ga0587119_010944 3300059658 Unclassified 1037
538 Ga0587071_039023 3300060344 Unclassified 945
539 Ga0587111_0043274 3300060346 Unclassified 968
540 2884217092 2884215851 Bacteria 4554841
541 Ga0213872_10027816
542 rootH2_10068752
543 Ga0070658_10013171
544 Ga0070658_10161377
545 Ga0070658_10248661
546 Ga0070676_10095799
547 Ga0070683_100000006
548 Ga0070683_100000090
549 Ga0070683_100068633
550 Ga0070683_100231412
551 Ga0070683_100485320
552 Ga0070670_100000411
553 Ga0070670_100029502
554 Ga0068869_100000036
555 Ga0068869_100285365
556 Ga0070682_100043629
557 Ga0068868_100000152
558 Ga0068868_100518788
559 Ga0070660_100235790
560 Ga0070661_100039486
561 Ga0070661_100055122
562 Ga0070661_100205721
563 Ga0070668_100077867
564 Ga0070671_100036061
565 Ga0070667_100000709
566 Ga0070709_10000498
567 Ga0070714_100036624
568 Ga0070714_100117216
569 Ga0070714_100303590
570 Ga0070713_100000322
571 Ga0070713_100016467
572 Ga0070713_100048771
573 Ga0070713_100076649
574 Ga0070713_100211257
575 Ga0070710_10011092
576 Ga0070710_10079315
577 Ga0070711_100065877
578 Ga0070711_100147501
579 Ga0070663_100010906
580 Ga0070663_100077401
581 Ga0070678_100198742
582 Ga0070662_100095633
583 Ga0070681_10006466
584 Ga0070681_10008726
585 Ga0070685_10365560
586 Ga0070679_100195637
587 Ga0070684_100000889
588 Ga0070684_100009388
589 Ga0070684_100024793
590 Ga0070684_100035098
591 Ga0070684_100064002
592 Ga0070684_100513117
593 Ga0070697_100266776
594 Ga0068853_100000203
595 Ga0068853_100061472
596 Ga0068853_100073407
597 Ga0070672_100063539
598 Ga0070665_100002484
599 Ga0070665_100037955
600 Ga0070665_100042539
601 Ga0070665_100131364
602 Ga0070665_100358362
603 Ga0068855_100002968
604 Ga0068855_100013422
605 Ga0068855_100039278
606 Ga0068855_100152839
607 Ga0070664_100089095
608 Ga0068857_100001869
609 Ga0068857_100002976
610 Ga0068856_100000187
611 Ga0068856_100019986
612 Ga0068856_100033425
613 Ga0068856_100059384
614 Ga0068856_100090377
615 Ga0068856_100108662
616 Ga0068856_100186551
617 Ga0068852_100000008
618 Ga0068852_100000082
619 Ga0068852_100044163
620 Ga0068852_100062164
621 Ga0068852_100070598
622 Ga0068852_100080148
623 Ga0068852_100192719
624 Ga0068852_100432265
625 Ga0068859_100009321
626 Ga0068859_100343015
627 Ga0068864_100003925
628 Ga0068851_10001200
629 Ga0068851_10008990
630 Ga0068851_10020267
631 Ga0068863_100000811
632 Ga0068863_100043253
633 Ga0068863_100082041
634 Ga0068858_100000955
635 Ga0068858_100082987
636 Ga0068858_100379438
637 Ga0068858_100521534
638 Ga0068860_100000854
639 Ga0068860_100588020
640 Ga0068862_100061153
641 Ga0081540_1036279
642 Ga0081540_1058906
643 Ga0081539_10022163
644 Ga0070717_10001169
645 Ga0070717_10023076
646 Ga0070717_10047743
647 Ga0070715_10025728
648 Ga0070716_100007168
649 Ga0070716_100023022
650 Ga0070716_100074688
651 Ga0070712_100000456
652 Ga0070712_100056055
653 Ga0070712_100064368
654 Ga0070712_100225162
655 Ga0097621_100000450
656 Ga0097621_100003099
657 Ga0097621_100018742
658 Ga0097621_100073459
659 Ga0068871_100000380
660 Ga0068871_100013157
661 Ga0068871_100017473
662 Ga0068871_100032506
663 Ga0068871_100206843
664 Ga0068865_100015780
665 Ga0097620_100009321
666 Ga0097620_100343013
667 Ga0105240_10000038
668 Ga0105240_10000360
669 Ga0105240_10000983
670 Ga0105240_10006147
671 Ga0105240_10008566
672 Ga0105240_10016990
673 Ga0105240_10019362
674 Ga0105240_10693748
675 Ga0111539_10296306
676 Ga0105245_10000372
677 Ga0105245_10002893
678 Ga0105245_10179958
679 Ga0105247_10001579
680 Ga0105247_10264026
681 Ga0105241_10000026
682 Ga0105241_10000429
683 Ga0105241_10000588
684 Ga0105241_10010226
685 Ga0105241_10059926
686 Ga0105241_10130233
687 Ga0105242_10376502
688 Ga0105242_10723228
689 Ga0105248_10000004
690 Ga0105248_10018823
691 Ga0105248_10034837
692 Ga0105248_10366351
693 Ga0105248_10437391
694 Ga0105248_10492852
695 Ga0105248_10609952
696 Ga0105248_10661262
697 Ga0105237_10001153
698 Ga0105237_10012752
699 Ga0105237_10025910
700 Ga0105237_10031781
701 Ga0105237_10032425
702 Ga0105237_10051003
703 Ga0105237_10059732
704 Ga0105237_10250859
705 Ga0105237_10358887
706 Ga0105237_10369560
707 Ga0105238_10000137
708 Ga0105238_10000218
709 Ga0105238_10001537
710 Ga0105238_10009372
711 Ga0105238_10016086
712 Ga0105238_10033638
713 Ga0105238_10047816
714 Ga0105238_10080962
715 Ga0105238_10148750
716 Ga0105249_10037792
717 Ga0105249_10120269
718 Ga0105249_10873964
719 Ga0105239_10001628
720 Ga0105239_10003331
721 Ga0105239_10004953
722 Ga0105239_10251760
723 Ga0105239_10494148
724 Ga0105246_10000487
725 Ga0157373_10035248
726 Ga0157373_10070506
727 Ga0157373_10378437
728 Ga0157371_10027364
729 Ga0157370_10000130
730 Ga0157370_10137395
731 Ga0157370_10446995
732 Ga0157369_10000058
733 Ga0157369_10001028
734 Ga0157369_10002904
735 Ga0157369_10008970
736 Ga0157369_10019950
737 Ga0157369_10030039
738 Ga0157369_10056574
739 Ga0157369_10081547
740 Ga0157369_10090084
741 Ga0157369_10189082
742 Ga0157374_10000512
743 Ga0157374_10005667
744 Ga0157374_10005714
745 Ga0157374_10007314
746 Ga0157374_10007590
747 Ga0157374_10014675
748 Ga0157374_10017211
749 Ga0157374_10173514
750 Ga0157374_10197596
751 Ga0157378_10003221
752 Ga0157378_10005121
753 Ga0157378_10116562
754 Ga0163162_10001417
755 Ga0163162_10032285
756 Ga0163162_10115175
757 Ga0163162_10823413
758 Ga0157372_10000163
759 Ga0157372_10009471
760 Ga0157372_10009618
761 Ga0157372_10015810
762 Ga0157372_10018728
763 Ga0157372_10033478
764 Ga0157372_10045824
765 Ga0157372_10050697
766 Ga0157372_10054160
767 Ga0157372_10095186
768 Ga0157372_10106139
769 Ga0157375_10001295
770 Ga0157375_10017125
771 Ga0163163_10000826
772 Ga0163163_10048927
773 Ga0163163_10069858
774 Ga0163163_10178122
775 Ga0163163_10196400
776 Ga0157377_10039283
777 Ga0157379_10000147
778 Ga0157379_10186905
779 Ga0157376_10000447
780 Ga0157376_10167041
781 Ga0206352_10338750
782 Ga0206352_10822384
783 Ga0213873_10041264
784 Ga0213872_10005995
785 Ga0213872_10011855
786 Ga0213876_10046343
787 Ga0224712_10164438
788 Ga0207656_10014445
789 Ga0207656_10024981
790 Ga0207656_10041312
791 Ga0207656_10054917
792 Ga0207692_10031833
793 Ga0207692_10036677
794 Ga0207710_10000251
795 Ga0207710_10056068
796 Ga0207685_10041010
797 Ga0207699_10002436
798 Ga0207699_10357006
799 Ga0207705_10181192
800 Ga0207705_10185675
801 Ga0207654_10000017
802 Ga0207654_10000099
803 Ga0207654_10000135
804 Ga0207654_10052669
805 Ga0207707_10003922
806 Ga0207707_10070977
807 Ga0207695_10000070
808 Ga0207695_10000080
809 Ga0207695_10000113
810 Ga0207695_10000561
811 Ga0207695_10005420
812 Ga0207695_10020454
813 Ga0207695_10028959
814 Ga0207695_10165623
815 Ga0207695_10497044
816 Ga0207671_10000065
817 Ga0207671_10000123
818 Ga0207671_10052764
819 Ga0207671_10101167
820 Ga0207671_10170636
821 Ga0207671_10248924
822 Ga0207693_10000055
823 Ga0207693_10032288
824 Ga0207693_10220696
825 Ga0207663_10097796
826 Ga0207663_10282251
827 Ga0207649_10023678
828 Ga0207649_10060761
829 Ga0207649_10087657
830 Ga0207649_10183162
831 Ga0207694_10000112
832 Ga0207694_10000215
833 Ga0207694_10000940
834 Ga0207694_10028751
835 Ga0207694_10056904
836 Ga0207694_10124201
837 Ga0207694_10143225
838 Ga0207694_10206964
839 Ga0207650_10003613
840 Ga0207659_10149008
841 Ga0207687_10009806
842 Ga0207687_10163393
843 Ga0207700_10000206
844 Ga0207700_10087796
845 Ga0207700_10251516
846 Ga0207664_10103355
847 Ga0207664_10210827
848 Ga0207664_10314785
849 Ga0207644_10003113
850 Ga0207644_10059855
851 Ga0207706_10010126
852 Ga0207665_10030737
853 Ga0207665_10032962
854 Ga0207665_10048659
855 Ga0207691_10079783
856 Ga0207711_10000008
857 Ga0207711_10000010
858 Ga0207711_10001485
859 Ga0207711_10033102
860 Ga0207711_10144138
861 Ga0207711_10428298
862 Ga0207689_10001390
863 Ga0207689_10376561
864 Ga0207661_10000357
865 Ga0207661_10199548
866 Ga0207661_10434829
867 Ga0207679_10047692
868 Ga0207667_10003542
869 Ga0207667_10015867
870 Ga0207667_10018059
871 Ga0207667_10056227
872 Ga0207667_10143946
873 Ga0207667_10195382
874 Ga0207667_10217909
875 Ga0207712_10150259
876 Ga0207668_10032491
877 Ga0207640_10009572
878 Ga0207640_10034352
879 Ga0207640_10160081
880 Ga0207658_10000546
881 Ga0207677_10000114
882 Ga0207677_10060729
883 Ga0207703_10001906
884 Ga0207703_10064635
885 Ga0207703_10616529
886 Ga0207639_10000233
887 Ga0207639_10092285
888 Ga0207639_10094845
889 Ga0207639_10115648
890 Ga0207639_10482253
891 Ga0207678_10034906
892 Ga0207678_10136564
893 Ga0207702_10000343
894 Ga0207702_10000611
895 Ga0207702_10001988
896 Ga0207702_10036564
897 Ga0207702_10142973
898 Ga0207702_10282767
899 Ga0207641_10000319
900 Ga0207641_10003282
901 Ga0207641_10062036
902 Ga0207641_10152510
903 Ga0207641_10160389
904 Ga0207641_10279120
905 Ga0207676_10007628
906 Ga0207674_10000479
907 Ga0207674_10001109
908 Ga0207674_10077429
909 Ga0207674_10447033
910 Ga0207683_10001725
911 Ga0207698_10000010
912 Ga0207698_10000066
913 Ga0207698_10055735
914 Ga0207698_10123151
915 Ga0207698_10130113
916 Ga0207698_10158989
917 Ga0268266_10017152
918 Ga0268266_10042517
919 Ga0268266_10093654
920 Ga0268266_10219847
921 Ga0268265_10175469
922 Ga0268264_10000718
923 Ga0268264_10265703
924 Ga0268264_10344482
925 Ga0268264_10621022
926 Ga0265338_10012853
927 Ga0265338_10176969
928 Ga0265760_10048201
929 Ga0265330_10000375
930 Ga0265330_10002693
931 Ga0265325_10000051
932 Ga0265325_10014063
933 Ga0265325_10073152
934 Ga0265325_10116547
935 Ga0265325_10126955
936 Ga0265340_10033458
937 Ga0265339_10002079
938 Ga0265339_10088598
939 Ga0265316_10000539
940 Ga0265316_10027073
941 Ga0265316_10079431
942 Ga0265316_10235439
943 Ga0265313_10002617
944 Ga0265313_10042380
945 Ga0265313_10065272
946 Ga0265314_10004981
947 Ga0265314_10084913
948 Ga0265314_10085513
949 Ga0265314_10162542
950 Ga0265314_10215320
951 Ga0265342_10000671
952 Ga0373926_0012571
953 Ga0373934_0094328
954 Ga0373936_0048750
955 Ga0373945_0012813
956 Ga0373957_0127025
957 Ga0373955_0097220
958 Ga0373955_0142863
959 Ga0373955_0247663
960 Ga0373924_0180927
961 Ga0373931_0198066
962 Ga0373931_0215187
963 Ga0373935_0010978
964 Ga0373935_0035599
965 Ga0373935_0110941
966 Ga0373935_0296122
967 Ga0373927_0001395
968 Ga0373927_0003161
969 Ga0373947_0001412
970 Ga0373947_0072768
971 Ga0373947_0098598
972 Ga0373947_0111599
973 Ga0373937_0032125
974 Ga0373937_0098872
975 Ga0373937_0394501
976 Ga0373925_0000103
977 Ga0373925_0002912
978 Ga0373925_0038795
979 Ga0436364_0020384
980 Ga0436364_0334239
981 Ga0436364_0903129
982 Ga0436365_1573905
983 Ga0436361_0089440
984 Ga0436361_1098452
985 Ga0436363_1486660
986 Ga0436362_0596821
987 Ga0466961_0071478
988 Ga0466961_0227731
989 Ga0466963_0012081
990 Ga0466963_0091807
991 Ga0453684_0202660
992 Ga0451576_0131700
993 Ga0451576_0185680
994 Ga0451576_0200622
995 Ga0466967_0004075
996 Ga0466967_0059643
997 Ga0466967_0187282
998 Ga0495629_0053351
999 Ga0495629_0064782
1000 Ga0495651_0265279
1001 Ga0495580_0062903
1002 Ga0495580_0224514
1003 Ga0495580_0257663
1004 Ga0495582_0004662
1005 Ga0495582_0061804
1006 Ga0495664_0058845
1007 Ga0495664_0255623
1008 Ga0495630_0053887
1009 Ga0495652_0249500
1010 Ga0495665_0161181
1011 Ga0495587_0099971
1012 Ga0495667_0047233
1013 Ga0495634_0114037
1014 Ga0495657_0217418
1015 Ga0495623_0261225
1016 Ga0495669_0017386
1017 Ga0495669_0090167
1018 Ga0495624_0033121
1019 Ga0495674_0045075
1020 Ga0495674_0141562
1021 Ga0495676_0218186
1022 Ga0495675_0104987
1023 Ga0495684_0016913
1024 Ga0495684_0418681
1025 Ga0496101_0217129
1026 Ga0496102_0444796
1027 Ga0496104_0128665
1028 Ga0496104_0215642
1029 Ga0496104_0300558
1030 Ga0496104_0346138
1031 Ga0496104_0388081
1032 Ga0496105_0123954
1033 Ga0496105_0290208
1034 Ga0496106_0239391
1035 Ga0496107_0389361
1036 Ga0496110_0109429
1037 Ga0496114_0085295
1038 Ga0496114_0184147
1039 Ga0496114_0253188
1040 Ga0496115_0033436
1041 Ga0496115_0241265
1042 Ga0496115_0401303
1043 Ga0496126_0081625
1044 Ga0501037_0288966
1045 Ga0501047_0345829
1046 Ga0501044_0003939
1047 Ga0501044_0100336
1048 Ga0501044_0399755
1049 Ga0495601_0077985
1050 Ga0495619_0300820
1051 Ga0587084_019654
1052 Ga0587066_030966
1053 Ga0587070_034064
1054 Ga0587073_0052568
1055 Ga0587077_032200
1056 Ga0587082_028036
1057 Ga0587083_0036304
1058 Ga0587085_024332
1059 Ga0587086_012254
1060 Ga0587088_032262
1061 Ga0587089_015614
1062 Ga0587090_020956
1063 Ga0587091_036423
1064 Ga0587092_025815
1065 Ga0587094_021209
1066 Ga0587095_005233
1067 Ga0587101_015909
1068 Ga0587109_036950
1069 Ga0587115_018632
1070 Ga0587117_015396
1071 Ga0587128_019984
1072 Ga0587067_035435
1073 Ga0587076_030918
1074 Ga0587078_014119
1075 Ga0587079_030614
1076 Ga0587107_017840
1077 Ga0587119_010944
1078 Ga0587071_039023
1079 Ga0587111_0043274
1080 2884217092

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

79

288

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ezl-assembly1.cif.gz_A rice l-galactose dehydrogenase (holo form) 0.7311 35 268
8k1i-assembly1.cif.gz_D crystal structure of arabinose dehydrogenase from candida auris 0.7221 71 272
4exa-assembly1.cif.gz_B crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.7149 33 273
8k1i-assembly1.cif.gz_C crystal structure of arabinose dehydrogenase from candida auris 0.711 71 272
4exa-assembly2.cif.gz_C crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.7086 32 273
ID Description Score Start End Superfamily
af_A0A1D6KXU0_49_191_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.7643 37 124 3.20.20.100
af_Q9VGF2_1_211_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.7461 36 175 3.20.20.100
af_A0A0R0KVN6_7_249_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.7153 36 175 3.20.20.100
af_Q20127_83_403_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.7096 36 271 3.20.20.100
af_Q2QQV2_1_312_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.7026 37 267 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A2V9FH82-F1-model_v4 Oxidoreductase 0.9395 83 273
AF-A0A2V9FH82-F1-model_v4 Oxidoreductase 0.9346 83 273
AF-A0A0S8E7Z4-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9165 118 272
AF-A0A2V9QM81-F1-model_v4 Oxidoreductase 0.9137 31 273
AF-A0A836QK15-F1-model_v4 Aldo/keto reductase 0.9029 99 273

Map