F461187

General Info

Members Datasets Scaffolds Average Seq Length
539 321 495 323

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2919462493|2919464939
Length 380
Sequence HRHWKLVSSWCFSVTRIVGGGCVAAGTTAPCRAPYHRLAFIAHTRLIQGDPSMHAWLCENPTGVDALTWKELPTPTPGPGQVLIEIRAASLNFPDLLIVQNKYQIKPPLPFVPGSEYAGIVQAVGEGVTHLSVGQNVACLSGTGGFATHTLAPAALCMPLPEGFGHVDAAAFIMIYATSWHALMDRAQLKAGETVLVLGAAGGVGTAAIQIAKAAGAKVIAAASTDEKCELCRSIGADVTINYTTHALPNGFREAIKAATDGKGPDIIYDPVGGDFAEPAFRSIGWRGRYLVVGFASGPIPSLPLNLTLLKGASLVGVFWGDFAKREPKANAQMMAELAQWYGQGKIKPVIDSTMPMAQLKAAYAHMGSRGVKGKLVMVN

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
3 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
4 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
5 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
6 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
7 2643221658 Variovorax sp. Root411 Isolate Unclassified
8 2643221672 Variovorax sp. Root434 Isolate Unclassified
9 2643221683 Variovorax sp. Root473 Isolate Unclassified
10 2671180195 Frankia sp. CcI49 Isolate Nodule
11 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
12 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
13 2738541277 Variovorax sp. GV051 Isolate Unclassified
14 2738541307 Variovorax sp. GV008 Isolate Unclassified
15 2738543013 Variovorax sp. BT01 Isolate Unclassified
16 2738543019 Variovorax sp. GV040 Isolate Unclassified
17 2818991446 Variovorax sp. 1180 Isolate Unclassified
18 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
19 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
20 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
21 2842677519 Variovorax sp. R-72495 Isolate Unclassified
22 2842733646 Variovorax sp. R-72446 Isolate Unclassified
23 2842747753 Variovorax sp. R-72060 Isolate Unclassified
24 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
25 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
26 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
27 2885198086 Variovorax sp. 679 Isolate Unclassified
28 2899924645 Variovorax sp. 369 Isolate Unclassified
29 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
30 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
31 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
32 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
33 2928037797 Variovorax sp. 1126 Isolate Unclassified
34 2928044640 Variovorax sp. 1128 Isolate Unclassified
35 2928051484 Variovorax sp. 1133 Isolate Unclassified
36 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
37 2928070936 Variovorax gossypii 1167 Isolate Unclassified
38 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
39 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
40 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
41 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
42 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
43 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
44 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
45 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
46 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
47 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
48 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
49 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
50 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
51 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
52 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
53 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
54 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
55 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
56 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
57 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
58 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
59 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
60 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
61 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
62 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
63 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
64 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
65 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
66 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
67 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
68 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
69 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
70 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
71 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
72 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
73 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
74 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
75 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
76 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
77 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
78 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
79 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
80 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
81 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
82 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
83 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
84 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
85 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
86 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
87 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
95 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
96 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
97 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
98 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
99 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
100 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
101 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
104 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
105 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
106 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
107 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
108 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
109 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
128 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
129 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
130 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
133 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
137 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
139 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
147 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
188 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
189 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
190 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
191 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
192 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
193 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
194 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
195 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
196 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
200 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
201 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
213 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
214 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
220 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
221 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
222 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
223 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
224 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
225 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
226 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
227 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
228 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
229 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
230 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
231 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
232 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
233 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
234 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
235 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
236 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
237 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
238 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
239 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
240 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
241 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
242 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
245 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
248 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
249 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
250 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
251 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
254 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
255 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
256 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
257 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
258 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
261 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
262 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
263 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
264 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
265 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
279 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
280 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
281 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
282 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
283 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
284 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
285 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
286 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
287 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
288 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
289 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
290 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
291 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
292 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
293 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
294 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
295 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
296 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
297 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
298 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
299 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
300 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
301 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
302 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
303 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
304 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
305 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
306 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
307 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
308 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
309 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
310 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
311 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
312 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
313 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
314 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
315 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
316 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
317 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
318 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
319 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
320 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
321 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.84
Metatranscriptomes 0
Isolates 8.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.35
Nodule 1.11
Rhizoplane 4.82
Rhizosphere 51.39
Stem 0
Stem Tuber 0
Unclassified 11.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10026299 3300001989 Bacteria 2043
2 JGI25158J39367_1011817 3300002739 Bacteria 1158
3 JGI25152J39213_1000055 3300002773 Bacteria 75639
4 JGI25152J39213_1001621 3300002773 Bacteria 9394
5 JGI25150J39212_1000424 3300002774 Bacteria 19404
6 JGI25150J39212_1010843 3300002774 Bacteria 1677
7 JGI25159J45721_1001930 3300002987 Bacteria 8278
8 JGI25159J45721_1007937 3300002987 Bacteria 2977
9 JGI25151J46595_10000194 3300003187 Bacteria 74948
10 JGI25151J46595_10002906 3300003187 Bacteria 9815
11 JGI25151J46595_10003641 3300003187 Bacteria 8412
12 JGI25151J46595_10005584 3300003187 Bacteria 6471
13 JGI25151J46595_10014216 3300003187 Bacteria 3553
14 JGI25153J46596_10000139 3300003215 Bacteria 74948
15 JGI25153J46596_10009622 3300003215 Bacteria 4460
16 rootH1_10087963 3300003323 Bacteria 4404
17 JGI25160J50197_1001900 3300003354 Bacteria 10004
18 JGI25160J50197_1009738 3300003354 Bacteria 3534
19 JGI25161J50226_1000647 3300003374 Bacteria 13993
20 JGI25161J50226_1010014 3300003374 Bacteria 1299
21 Ga0055535_1000084 3300003761 Bacteria 104652
22 Ga0055542_1000033 3300003762 Bacteria 233997
23 Ga0055526_1000103 3300003771 Bacteria 74948
24 Ga0055526_1004793 3300003771 Bacteria 8008
25 Ga0055537_1000163 3300003773 Bacteria 49422
26 Ga0055537_1003250 3300003773 Bacteria 5062
27 Ga0055537_1010407 3300003773 Bacteria 1963
28 Ga0055524_1000190 3300003775 Bacteria 67475
29 Ga0055524_1003218 3300003775 Bacteria 8008
30 Ga0055536_1003831 3300003781 Bacteria 7919
31 Ga0055536_1005161 3300003781 Bacteria 6454
32 Ga0055536_1012297 3300003781 Bacteria 3187
33 Ga0055536_1031780 3300003781 Bacteria 1377
34 Ga0055534_1000150 3300003784 Bacteria 51661
35 Ga0055534_1000944 3300003784 Bacteria 12953
36 Ga0055534_1001600 3300003784 Bacteria 8786
37 Ga0055534_1003357 3300003784 Bacteria 5062
38 Ga0055528_1003203 3300003790 Bacteria 8365
39 Ga0055528_1011449 3300003790 Bacteria 3520
40 Ga0055528_1018653 3300003790 Bacteria 2342
41 Ga0055530_10001926 3300003791 Bacteria 14155
42 Ga0055540_1002120 3300003792 Bacteria 10835
43 Ga0055540_1002430 3300003792 Bacteria 9843
44 Ga0055540_1003273 3300003792 Bacteria 7923
45 Ga0055540_1004027 3300003792 Bacteria 6842
46 Ga0055531_10002763 3300003794 Bacteria 11516
47 Ga0055531_10004862 3300003794 Bacteria 8007
48 Ga0055531_10021272 3300003794 Bacteria 2524
49 Ga0055543_1002294 3300004625 Bacteria 6458
50 Ga0055543_1005665 3300004625 Bacteria 3151
51 Ga0065165_1004284 3300005262 Bacteria 8999
52 Ga0065714_10069768 3300005288 Bacteria 4095
53 Ga0070676_10008255 3300005328 Bacteria 5607
54 Ga0070676_10045344 3300005328 Bacteria 2561
55 Ga0070670_100012421 3300005331 Bacteria 7288
56 Ga0070670_100015997 3300005331 Bacteria 6438
57 Ga0070677_10001510 3300005333 Bacteria 7366
58 Ga0070666_10130524 3300005335 Bacteria 1746
59 Ga0068868_100081282 3300005338 Bacteria 2598
60 Ga0070660_100220041 3300005339 Bacteria 1543
61 Ga0070661_100000767 3300005344 Bacteria 23151
62 Ga0070661_100286813 3300005344 Bacteria 1278
63 Ga0070669_100010837 3300005353 Bacteria 6470
64 Ga0070675_100006830 3300005354 Bacteria 8761
65 Ga0070675_100253858 3300005354 Bacteria 1540
66 Ga0070671_100046601 3300005355 Bacteria 3605
67 Ga0070671_100240976 3300005355 Bacteria 1535
68 Ga0070674_100018662 3300005356 Bacteria 4392
69 Ga0070674_100034321 3300005356 Bacteria 3387
70 Ga0070673_100005364 3300005364 Bacteria 8192
71 Ga0070659_100013378 3300005366 Bacteria 6106
72 Ga0070659_100315664 3300005366 Bacteria 1306
73 Ga0070667_100115139 3300005367 Bacteria 2335
74 Ga0070667_100129136 3300005367 Bacteria 2205
75 Ga0070678_100012308 3300005456 Bacteria 5312
76 Ga0070678_100160147 3300005456 Bacteria 1822
77 Ga0070678_100165367 3300005456 Bacteria 1797
78 Ga0070662_100093193 3300005457 Bacteria 2266
79 Ga0068867_100016609 3300005459 Bacteria 5227
80 Ga0068867_100386394 3300005459 Bacteria 1177
81 Ga0068853_100007702 3300005539 Bacteria 8637
82 Ga0068853_100194105 3300005539 Bacteria 1846
83 Ga0070672_100009777 3300005543 Bacteria 6625
84 Ga0070672_100259887 3300005543 Bacteria 1464
85 Ga0070665_100012242 3300005548 Bacteria 8646
86 Ga0070665_100050948 3300005548 Bacteria 4154
87 Ga0070665_100254545 3300005548 Bacteria 1757
88 Ga0070664_100014641 3300005564 Bacteria 6402
89 Ga0070664_100110854 3300005564 Bacteria 2395
90 Ga0068857_100069216 3300005577 Bacteria 3143
91 Ga0068857_100436595 3300005577 Bacteria 1223
92 Ga0068856_100354409 3300005614 Bacteria 1486
93 Ga0068852_100284530 3300005616 Bacteria 1595
94 Ga0068864_100179375 3300005618 Bacteria 1935
95 Ga0068864_100261685 3300005618 Bacteria 1609
96 Ga0068870_10022991 3300005840 Bacteria 3069
97 Ga0075365_10137585 3300006038 Bacteria 1694
98 Ga0075363_100020663 3300006048 Bacteria 3305
99 Ga0075364_10075885 3300006051 Bacteria 2218
100 Ga0075364_10079218 3300006051 Bacteria 2171
101 Ga0075364_10114218 3300006051 Bacteria 1804
102 Ga0075432_10002635 3300006058 Bacteria 5991
103 Ga0075432_10005605 3300006058 Bacteria 4275
104 Ga0075362_10035104 3300006177 Bacteria 2188
105 Ga0075367_10132007 3300006178 Bacteria 1544
106 Ga0075366_10001075 3300006195 Bacteria 13433
107 Ga0075366_10086680 3300006195 Bacteria 1873
108 Ga0097621_100204896 3300006237 Bacteria 1714
109 Ga0075370_10000393 3300006353 Bacteria 16172
110 Ga0075370_10001974 3300006353 Bacteria 9286
111 Ga0075370_10002696 3300006353 Bacteria 8310
112 Ga0075370_10005479 3300006353 Bacteria 6316
113 Ga0075370_10005973 3300006353 Bacteria 6094
114 Ga0075370_10074439 3300006353 Bacteria 1946
115 Ga0075370_10247352 3300006353 Bacteria 1056
116 Ga0068871_100256300 3300006358 Bacteria 1525
117 Ga0075428_100453895 3300006844 Bacteria 1373
118 Ga0075430_100052669 3300006846 Bacteria 3428
119 Ga0075431_100018133 3300006847 Bacteria 7161
120 Ga0075431_100429624 3300006847 Bacteria 1319
121 Ga0099826_10000055 3300006948 Bacteria 70119
122 Ga0105244_10005004 3300009036 Bacteria 8932
123 Ga0105240_10254760 3300009093 Bacteria 2028
124 Ga0105245_10062901 3300009098 Bacteria 3350
125 Ga0105245_10333297 3300009098 Bacteria 1498
126 Ga0114129_10137733 3300009147 Bacteria 3348
127 Ga0114129_10277347 3300009147 Bacteria 2241
128 Ga0105243_10002013 3300009148 Bacteria 17274
129 Ga0105243_10007917 3300009148 Bacteria 8161
130 Ga0105243_10084820 3300009148 Bacteria 2595
131 Ga0105243_10230216 3300009148 Bacteria 1644
132 Ga0105241_10053862 3300009174 Bacteria 3078
133 Ga0105248_10159948 3300009177 Bacteria 2541
134 Ga0105237_10063202 3300009545 Bacteria 3700
135 Ga0105237_10160992 3300009545 Bacteria 2243
136 Ga0105239_10139085 3300010375 Bacteria 2705
137 Ga0105239_10163272 3300010375 Bacteria 2490
138 Ga0105246_10014393 3300011119 Bacteria 4975
139 Ga0105246_10047338 3300011119 Bacteria 2936
140 Ga0157373_10020640 3300013100 Bacteria 4786
141 Ga0157373_10065691 3300013100 Bacteria 2567
142 Ga0157370_10006222 3300013104 Bacteria 13222
143 Ga0157370_10359633 3300013104 Bacteria 1341
144 Ga0157370_10415378 3300013104 Bacteria 1238
145 Ga0157374_10302284 3300013296 Bacteria 1583
146 Ga0157378_10345216 3300013297 Bacteria 1453
147 Ga0157375_10070629 3300013308 Bacteria 3502
148 Ga0182008_10000282 3300014497 Bacteria 39753
149 Ga0182008_10002785 3300014497 Bacteria 10835
150 Ga0182008_10007756 3300014497 Bacteria 5907
151 Ga0182008_10009182 3300014497 Bacteria 5346
152 Ga0182008_10052550 3300014497 Bacteria 2019
153 Ga0157377_10173042 3300014745 Bacteria 1352
154 Ga0157376_10019651 3300014969 Bacteria 5212
155 Ga0182006_1001945 3300015261 Bacteria 11727
156 Ga0182007_10000940 3300015262 Bacteria 16048
157 Ga0182007_10001457 3300015262 Bacteria 12697
158 Ga0182005_1010784 3300015265 Bacteria 2620
159 Ga0183362_10001 3300015683 Bacteria 2046624
160 Ga0163161_10000128 3300017792 Bacteria 70965
161 Ga0163161_10006762 3300017792 Bacteria 7922
162 Ga0163161_10009175 3300017792 Bacteria 6837
163 Ga0163161_10009688 3300017792 Bacteria 6668
164 Ga0163161_10076782 3300017792 Bacteria 2452
165 Ga0209436_101842 3300025208 Bacteria 6876
166 Ga0209436_102448 3300025208 Bacteria 5575
167 Ga0209672_100228 3300025228 Bacteria 42777
168 Ga0209147_100951 3300025229 Bacteria 12743
169 Ga0209258_100089 3300025242 Bacteria 234040
170 Ga0207425_1000103 3300025245 Bacteria 79975
171 Ga0207425_1002258 3300025245 Bacteria 6969
172 Ga0209148_1000097 3300025254 Bacteria 234049
173 Ga0209129_1000033 3300025258 Bacteria 336894
174 Ga0209129_1001321 3300025258 Bacteria 14017
175 Ga0209129_1006595 3300025258 Bacteria 3699
176 Ga0209565_1000120 3300025263 Bacteria 111458
177 Ga0209565_1000516 3300025263 Bacteria 27851
178 Ga0209565_1000980 3300025263 Bacteria 14694
179 Ga0209673_1000099 3300025273 Bacteria 193248
180 Ga0209673_1000372 3300025273 Bacteria 80748
181 Ga0209673_1000899 3300025273 Bacteria 38238
182 Ga0209673_1031424 3300025273 Bacteria 1653
183 Ga0209130_1000105 3300025284 Bacteria 135199
184 Ga0209130_1000615 3300025284 Bacteria 34069
185 Ga0209130_1001622 3300025284 Bacteria 13885
186 Ga0209675_1000054 3300025291 Bacteria 193248
187 Ga0209675_1000588 3300025291 Bacteria 26180
188 Ga0209675_1001203 3300025291 Bacteria 15708
189 Ga0209675_1001425 3300025291 Bacteria 13815
190 Ga0209675_1001574 3300025291 Bacteria 12930
191 Ga0209676_1000179 3300025292 Bacteria 150096
192 Ga0209676_1000260 3300025292 Bacteria 111683
193 Ga0209676_1001146 3300025292 Bacteria 28971
194 Ga0209676_1004118 3300025292 Bacteria 8286
195 Ga0209676_1004929 3300025292 Bacteria 7183
196 Ga0209676_1025274 3300025292 Bacteria 1908
197 Ga0209025_1000221 3300025294 Bacteria 135793
198 Ga0209025_1000732 3300025294 Bacteria 55664
199 Ga0209025_1001070 3300025294 Bacteria 39701
200 Ga0209025_1044137 3300025294 Bacteria 1868
201 Ga0209564_1000005 3300025295 Bacteria 1147192
202 Ga0209564_1000151 3300025295 Bacteria 168783
203 Ga0209564_1000246 3300025295 Bacteria 117096
204 Ga0209564_1019875 3300025295 Bacteria 2488
205 Ga0209564_1036861 3300025295 Bacteria 1388
206 Ga0209758_1000027 3300025297 Bacteria 549650
207 Ga0209050_1000172 3300025298 Bacteria 150096
208 Ga0209050_1000977 3300025298 Bacteria 36542
209 Ga0209050_1011057 3300025298 Bacteria 4343
210 Ga0209256_1000069 3300025299 Bacteria 245640
211 Ga0209256_1000506 3300025299 Bacteria 57382
212 Ga0209256_1021207 3300025299 Bacteria 2004
213 Ga0207426_1000027 3300025302 Bacteria 513176
214 Ga0207426_1000115 3300025302 Bacteria 227423
215 Ga0209051_1000046 3300025303 Bacteria 296424
216 Ga0209051_1000510 3300025303 Bacteria 49177
217 Ga0209051_1000707 3300025303 Bacteria 36542
218 Ga0209051_1001434 3300025303 Bacteria 20365
219 Ga0209051_1024551 3300025303 Bacteria 2475
220 Ga0209051_1058005 3300025303 Bacteria 1237
221 Ga0209257_1000281 3300025304 Bacteria 114413
222 Ga0209257_1001995 3300025304 Bacteria 21901
223 Ga0209257_1003764 3300025304 Bacteria 12526
224 Ga0209257_1008565 3300025304 Bacteria 5768
225 Ga0209257_1010979 3300025304 Bacteria 4452
226 Ga0207656_10019055 3300025321 Bacteria 2711
227 Ga0207655_1000566 3300025728 Bacteria 45937
228 Ga0207682_10000464 3300025893 Bacteria 18759
229 Ga0207645_10005669 3300025907 Bacteria 9018
230 Ga0207645_10022034 3300025907 Bacteria 4149
231 Ga0207645_10212981 3300025907 Bacteria 1273
232 Ga0207643_10031527 3300025908 Bacteria 2956
233 Ga0207671_10156318 3300025914 Bacteria 1764
234 Ga0207657_10279196 3300025919 Bacteria 1326
235 Ga0207649_10001113 3300025920 Bacteria 16303
236 Ga0207681_10007123 3300025923 Bacteria 6857
237 Ga0207650_10001129 3300025925 Bacteria 19633
238 Ga0207650_10033329 3300025925 Bacteria 3730
239 Ga0207659_10025290 3300025926 Bacteria 3988
240 Ga0207659_10060126 3300025926 Bacteria 2734
241 Ga0207687_10062855 3300025927 Bacteria 2627
242 Ga0207644_10001847 3300025931 Bacteria 13779
243 Ga0207690_10006023 3300025932 Bacteria 7187
244 Ga0207706_10015537 3300025933 Bacteria 6878
245 Ga0207709_10000230 3300025935 Bacteria 70768
246 Ga0207709_10000240 3300025935 Bacteria 68308
247 Ga0207709_10062674 3300025935 Bacteria 2328
248 Ga0207669_10005124 3300025937 Bacteria 5841
249 Ga0207669_10027498 3300025937 Bacteria 3115
250 Ga0207691_10001003 3300025940 Bacteria 28006
251 Ga0207691_10116224 3300025940 Bacteria 2374
252 Ga0207691_10261323 3300025940 Bacteria 1492
253 Ga0207689_10039581 3300025942 Bacteria 3902
254 Ga0207679_10000533 3300025945 Bacteria 25744
255 Ga0207679_10089935 3300025945 Bacteria 2371
256 Ga0207651_10046747 3300025960 Bacteria 2913
257 Ga0207640_10167062 3300025981 Bacteria 1635
258 Ga0207658_10110704 3300025986 Bacteria 2170
259 Ga0207658_10341562 3300025986 Bacteria 1301
260 Ga0207677_10040550 3300026023 Bacteria 3070
261 Ga0207639_10065773 3300026041 Bacteria 2815
262 Ga0207639_10098548 3300026041 Bacteria 2356
263 Ga0207648_10010746 3300026089 Bacteria 8649
264 Ga0207648_10086470 3300026089 Bacteria 2736
265 Ga0207676_10291412 3300026095 Bacteria 1486
266 Ga0207674_10045346 3300026116 Bacteria 4522
267 Ga0207674_10232422 3300026116 Bacteria 1792
268 Ga0207683_10029398 3300026121 Bacteria 4757
269 Ga0207683_10033606 3300026121 Bacteria 4455
270 Ga0207683_10041842 3300026121 Bacteria 4001
271 Ga0207683_10218717 3300026121 Bacteria 1735
272 Ga0207698_10041932 3300026142 Bacteria 3415
273 Ga0207698_10071918 3300026142 Bacteria 2747
274 Ga0207698_10572996 3300026142 Bacteria 1109
275 Ga0209282_1000363 3300027666 Bacteria 22201
276 Ga0207428_10179321 3300027907 Bacteria 1601
277 Ga0268266_10011319 3300028379 Bacteria 7764
278 Ga0268266_10020280 3300028379 Bacteria 5668
279 Ga0268266_10051651 3300028379 Bacteria 3529
280 Ga0268266_10161128 3300028379 Bacteria 2030
281 Ga0268266_10310814 3300028379 Bacteria 1473
282 Ga0307517_10097239 3300028786 Bacteria 2352
283 Ga0307515_10001286 3300028794 Bacteria 56985
284 Ga0307515_10005581 3300028794 Bacteria 25423
285 Ga0307515_10105599 3300028794 Bacteria 3351
286 Ga0307515_10239168 3300028794 Bacteria 1591
287 Ga0316176_1042615 3300030732 Bacteria 5779
288 Ga0314311_1116647 3300030733 Bacteria 19723
289 Ga0316178_1051159 3300030735 Bacteria 7232
290 Ga0316180_1180628 3300030736 Bacteria 2974
291 Ga0316183_1009415 3300030742 Bacteria 1590
292 Ga0316183_1031412 3300030742 Bacteria 9920
293 Ga0316181_1174844 3300030744 Bacteria 12394
294 Ga0316182_1426068 3300030745 Bacteria 4681
295 Ga0265332_10000037 3300031238 Bacteria 134250
296 Ga0265327_10000419 3300031251 Bacteria 77672
297 Ga0265327_10022905 3300031251 Bacteria 3715
298 Ga0265316_10000144 3300031344 Bacteria 77758
299 Ga0307509_10004147 3300031507 Bacteria 21173
300 Ga0307509_10038659 3300031507 Bacteria 5204
301 Ga0307509_10098159 3300031507 Bacteria 2975
302 Ga0307509_10246250 3300031507 Bacteria 1575
303 Ga0307408_100079020 3300031548 Bacteria 2453
304 Ga0307408_100154216 3300031548 Bacteria 1816
305 Ga0307508_10000163 3300031616 Bacteria 80086
306 Ga0307514_10098955 3300031649 Bacteria 2100
307 Ga0307516_10000138 3300031730 Bacteria 87604
308 Ga0307516_10091699 3300031730 Bacteria 2866
309 Ga0307516_10175878 3300031730 Bacteria 1877
310 Ga0307405_10023742 3300031731 Bacteria 3490
311 Ga0307405_10108396 3300031731 Bacteria 1876
312 Ga0307405_10167516 3300031731 Bacteria 1563
313 Ga0307405_10198417 3300031731 Bacteria 1455
314 Ga0307413_10006289 3300031824 Bacteria 5400
315 Ga0307413_10276077 3300031824 Bacteria 1261
316 Ga0307410_10009037 3300031852 Bacteria 5565
317 Ga0307406_10000879 3300031901 Bacteria 16916
318 Ga0307406_10025829 3300031901 Bacteria 3520
319 Ga0307407_10050585 3300031903 Bacteria 2378
320 Ga0307407_10112764 3300031903 Bacteria 1710
321 Ga0307412_10004788 3300031911 Bacteria 7555
322 Ga0307412_10251946 3300031911 Bacteria 1371
323 Ga0307409_100047074 3300031995 Bacteria 3270
324 Ga0307416_100345313 3300032002 Bacteria 1503
325 Ga0307416_100400113 3300032002 Bacteria 1410
326 Ga0307416_100654862 3300032002 Bacteria 1135
327 Ga0307414_10026973 3300032004 Bacteria 3704
328 Ga0307414_10118737 3300032004 Bacteria 2029
329 Ga0307411_10001360 3300032005 Bacteria 9889
330 Ga0307411_10063848 3300032005 Bacteria 2463
331 Ga0307411_10360022 3300032005 Bacteria 1189
332 Ga0307507_10147619 3300033179 Bacteria 1781
333 Ga0307510_10298405 3300033180 Bacteria 1074
334 Ga0373934_0103333 3300035086 Bacteria 1152
335 Ga0373931_0031066 3300035691 Bacteria 2754
336 Ga0395900_0000046 3300037418 Bacteria 230114
337 Ga0395905_0001198 3300037471 Bacteria 32426
338 Ga0395905_0066690 3300037471 Bacteria 3371
339 Ga0395901_0038776 3300038443 Bacteria 4928
340 Ga0439436_0006136 3300041404 Bacteria 3690
341 Ga0439439_0004068 3300041406 Bacteria 3268
342 Ga0439466_0004497 3300041411 Bacteria 5361
343 Ga0439465_0001703 3300041413 Bacteria 7182
344 Ga0451837_1331497 3300041494 Bacteria 1071
345 Ga0439431_0001388 3300041997 Bacteria 5341
346 Ga0439433_0000999 3300041999 Bacteria 5706
347 Ga0439442_001828 3300042002 Bacteria 4164
348 Ga0439445_0000173 3300042004 Bacteria 11519
349 Ga0439432_006435 3300042006 Bacteria 4194
350 Ga0439432_022472 3300042006 Bacteria 2083
351 Ga0439449_0000240 3300042007 Bacteria 19806
352 Ga0439449_0000914 3300042007 Bacteria 11510
353 Ga0439449_0001046 3300042007 Bacteria 10904
354 Ga0439449_0013617 3300042007 Bacteria 3061
355 Ga0439452_000848 3300042010 Bacteria 14217
356 Ga0439452_004833 3300042010 Bacteria 4432
357 Ga0439462_0000417 3300042015 Bacteria 8245
358 Ga0439462_0003767 3300042015 Bacteria 3657
359 Ga0450911_000459 3300042115 Bacteria 13194
360 Ga0450897_000274 3300042128 Bacteria 2684
361 Ga0450898_007811 3300042134 Bacteria 1674
362 Ga0439446_0002543 3300042156 Bacteria 4389
363 Ga0439434_0000514 3300042435 Bacteria 11008
364 Ga0439434_0001272 3300042435 Bacteria 7258
365 Ga0439434_0005021 3300042435 Bacteria 3867
366 Ga0439434_0009974 3300042435 Bacteria 2795
367 Ga0439459_0000616 3300042438 Bacteria 4779
368 Ga0450918_001344 3300042531 Bacteria 4931
369 Ga0450893_0007724 3300042532 Bacteria 1749
370 Ga0466965_0022522 3300044683 Bacteria 3037
371 Ga0466966_0013814 3300044684 Bacteria 5344
372 Ga0466963_0006321 3300044694 Bacteria 7005
373 Ga0466957_0037016 3300044842 Bacteria 2936
374 Ga0466957_0045907 3300044842 Bacteria 2650
375 Ga0466957_0307769 3300044842 Bacteria 1066
376 Ga0466958_0004614 3300045836 Bacteria 7300
377 Ga0466967_0078246 3300045976 Bacteria 2979
378 Ga0466967_0175423 3300045976 Unclassified 2019
379 Ga0495629_0339552 3300046459 Bacteria 1026
380 Ga0495639_0008096 3300046475 Bacteria 4513
381 Ga0495585_0011629 3300046492 Bacteria 5205
382 Ga0495583_0100665 3300046506 Bacteria 1234
383 Ga0495616_0007564 3300046513 Bacteria 6502
384 Ga0495620_0009018 3300046515 Bacteria 5325
385 Ga0495630_0162781 3300046517 Bacteria 1699
386 Ga0495637_0010820 3300046520 Bacteria 4398
387 Ga0495654_0005078 3300046530 Bacteria 7701
388 Ga0495621_0001120 3300046539 Bacteria 6910
389 Ga0495656_0000376 3300046615 Bacteria 14908
390 Ga0495625_0000903 3300046660 Bacteria 39973
391 Ga0495625_0002069 3300046660 Bacteria 22491
392 Ga0495588_0002276 3300046674 Bacteria 8218
393 Ga0495588_0016509 3300046674 Bacteria 3569
394 Ga0495588_0036047 3300046674 Bacteria 2508
395 Ga0495658_0051834 3300046683 Bacteria 2325
396 Ga0495671_0001383 3300046692 Bacteria 16422
397 Ga0495660_0072928 3300046810 Bacteria 1817
398 Ga0495676_0001292 3300047321 Bacteria 21470
399 Ga0495593_0000578 3300047673 Bacteria 20838
400 Ga0496100_0017325 3300048903 Bacteria 4250
401 Ga0496101_0011100 3300048904 Bacteria 5969
402 Ga0496101_0016205 3300048904 Bacteria 5030
403 Ga0496101_0027947 3300048904 Bacteria 3934
404 Ga0496102_0031175 3300048905 Bacteria 4780
405 Ga0496102_0160303 3300048905 Bacteria 2116
406 Ga0496104_0012070 3300048907 Bacteria 7754
407 Ga0496104_0039954 3300048907 Bacteria 4395
408 Ga0496105_0000491 3300048908 Bacteria 26041
409 Ga0496106_0020175 3300048909 Bacteria 4945
410 Ga0496107_0064911 3300048910 Bacteria 2647
411 Ga0496108_0085381 3300048911 Bacteria 2679
412 Ga0496108_0335717 3300048911 Bacteria 1318
413 Ga0496109_0006606 3300048912 Bacteria 9767
414 Ga0496109_0047567 3300048912 Bacteria 3901
415 Ga0496109_0226332 3300048912 Bacteria 1759
416 Ga0496110_0181433 3300048913 Bacteria 1911
417 Ga0496110_0403454 3300048913 Unclassified 1246
418 Ga0496111_0310197 3300048914 Bacteria 1169
419 Ga0496112_0024323 3300048915 Bacteria 5797
420 Ga0496113_0011158 3300048916 Bacteria 5978
421 Ga0496114_0059646 3300048917 Bacteria 3188
422 Ga0496114_0336974 3300048917 Bacteria 1333
423 Ga0496116_0022039 3300048919 Bacteria 4790
424 Ga0496117_0012358 3300048920 Bacteria 7536
425 Ga0496117_0013542 3300048920 Bacteria 7109
426 Ga0496117_0194293 3300048920 Bacteria 1152
427 Ga0496121_0008084 3300048924 Bacteria 12519
428 Ga0496122_0000546 3300048925 Bacteria 77920
429 Ga0496123_0000235 3300048926 Bacteria 111823
430 Ga0496123_0061436 3300048926 Bacteria 2414
431 Ga0496123_0070397 3300048926 Bacteria 2189
432 Ga0496123_0153162 3300048926 Bacteria 1240
433 Ga0496124_0011928 3300048927 Bacteria 8648
434 Ga0496124_0037347 3300048927 Bacteria 4225
435 Ga0496124_0075799 3300048927 Bacteria 2778
436 Ga0496124_0111068 3300048927 Bacteria 2206
437 Ga0496125_0007132 3300048928 Bacteria 11926
438 Ga0496125_0009295 3300048928 Bacteria 10138
439 Ga0496125_0017195 3300048928 Bacteria 6912
440 Ga0496125_0023235 3300048928 Bacteria 5728
441 Ga0496126_0003351 3300048929 Bacteria 20338
442 Ga0496126_0185700 3300048929 Bacteria 1763
443 Ga0496126_0219421 3300048929 Bacteria 1598
444 Ga0501076_0007680 3300049592 Bacteria 7853
445 Ga0501077_0000896 3300049593 Bacteria 17896
446 Ga0501225_0009324 3300049705 Bacteria 2797
447 nmdc:mga03683_14561_c1 3300050489 Bacteria 2913
448 nmdc:mga03683_16008_c1 3300050489 Bacteria 2808
449 nmdc:mga03683_36570_c1 3300050489 Bacteria 1998
450 nmdc:mga03n38_1379_c1 3300050490 Bacteria 6409
451 nmdc:mga0yw44_23816_c1 3300050492 Bacteria 3455
452 nmdc:mga0k408_214107_c1 3300050493 Bacteria 1150
453 nmdc:mga0k408_83753_c1 3300050493 Bacteria 1870
454 nmdc:mga0k408_873_c1 3300050493 Bacteria 16613
455 nmdc:mga06z11_28981_c1 3300050494 Bacteria 2662
456 nmdc:mga07m45_2418_c1 3300050496 Bacteria 8758
457 nmdc:mga07m45_2915_c1 3300050496 Bacteria 8112
458 nmdc:mga07m45_3329_c1 3300050496 Bacteria 7742
459 nmdc:mga07m45_498_c1 3300050496 Bacteria 16631
460 nmdc:mga07m45_621_c1 3300050496 Bacteria 15097
461 nmdc:mga07m45_66243_c1 3300050496 Bacteria 2052
462 nmdc:mga07m45_8196_c1 3300050496 Bacteria 5361
463 nmdc:mga07m45_87396_c1 3300050496 Bacteria 1784
464 nmdc:mga05p37_110082_c1 3300050507 Bacteria 3388
465 nmdc:mga0qj67_39860_c1 3300050509 Bacteria 3690
466 nmdc:mga0qj67_7157_c1 3300050509 Bacteria 8230
467 nmdc:mga06r32_21297_c1 3300050510 Bacteria 5984
468 nmdc:mga06r32_546014_c1 3300050510 Bacteria 1133
469 Ga0495601_0042243 3300053077 Bacteria 2860
470 Ga0500610_0069524 3300053079 Bacteria 1836
471 Ga0500643_009328 3300053087 Bacteria 3756
472 Ga0500651_0000024 3300053093 Bacteria 129450
473 Ga0500562_008924 3300053108 Bacteria 2533
474 Ga0500571_000051 3300053110 Bacteria 35723
475 Ga0500593_001191 3300053117 Bacteria 9383
476 Ga0500594_0001839 3300053118 Bacteria 4599
477 Ga0500597_021474 3300053120 Bacteria 2552
478 Ga0500607_002042 3300053121 Bacteria 17000
479 Ga0500618_016722 3300053125 Bacteria 1832
480 Ga0500658_0004356 3300053134 Bacteria 5305
481 Ga0500658_0004518 3300053134 Bacteria 5190
482 Ga0500559_0002990 3300053136 Bacteria 8472
483 Ga0500559_0069593 3300053136 Bacteria 1582
484 Ga0500561_0032706 3300053137 Bacteria 1324
485 Ga0500564_005638 3300053138 Bacteria 5137
486 Ga0500568_0001905 3300053139 Bacteria 12829
487 Ga0500574_003174 3300053141 Bacteria 2857
488 Ga0500586_051216 3300053145 Bacteria 1424
489 Ga0500616_0028215 3300053153 Bacteria 3094
490 Ga0500627_0002056 3300053158 Bacteria 5823
491 Ga0500634_0006380 3300053161 Bacteria 5699
492 Ga0500634_0040982 3300053161 Bacteria 2515
493 Ga0500638_019801 3300053162 Bacteria 3161
494 Ga0500636_0073113 3300053177 Bacteria 1986
495 Ga0501082_0001587 3300060353 Bacteria 20051

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044842 Ga0466957_0037016 Ga0466957_0037016_16_882 288
2 3300031730 Ga0307516_10175878 Ga0307516_101758782 300
3 3300031507 Ga0307509_10246250 Ga0307509_102462501 309
4 3300046492 Ga0495585_0011629 Ga0495585_0011629_2850_3842 309
5 3300005548 Ga0070665_100050948 Ga0070665_1000509485 310
6 3300028379 Ga0268266_10011319 Ga0268266_100113197 310
7 iso_pu_bacteria 2902405164 2902408016 310
8 3300006051 Ga0075364_10079218 Ga0075364_100792182 312
9 3300050509 nmdc:mga0qj67_7157_c1 nmdc:mga0qj67_7157_c1_676_1659 312
10 3300009545 Ga0105237_10160992 Ga0105237_101609923 313
11 iso_pu_bacteria 2671180195 2671836908 313
12 iso_pu_bacteria 2684623035 2686534272 313
13 iso_pu_bacteria 2687453743 2689996096 313
14 iso_pu_bacteria 2841957949 2841965954 314
15 iso_pu_bacteria 2884634485 2884635786 314
16 3300046660 Ga0495625_0002069 Ga0495625_0002069_8483_9469 315
17 3300009147 Ga0114129_10137733 Ga0114129_101377333 317
18 3300042438 Ga0439459_0000616 Ga0439459_0000616_3403_4428 317
19 3300046459 Ga0495629_0339552 Ga0495629_0339552_27_1013 317
20 3300005328 Ga0070676_10045344 Ga0070676_100453441 318
21 3300005331 Ga0070670_100012421 Ga0070670_1000124215 318
22 3300005333 Ga0070677_10001510 Ga0070677_100015106 318
23 3300005335 Ga0070666_10130524 Ga0070666_101305242 318
24 3300005338 Ga0068868_100081282 Ga0068868_1000812822 318
25 3300005339 Ga0070660_100220041 Ga0070660_1002200412 318
26 3300005344 Ga0070661_100000767 Ga0070661_10000076717 318
27 3300005353 Ga0070669_100010837 Ga0070669_1000108372 318
28 3300005354 Ga0070675_100006830 Ga0070675_1000068305 318
29 3300005355 Ga0070671_100046601 Ga0070671_1000466011 318
30 3300005355 Ga0070671_100240976 Ga0070671_1002409761 318
31 3300005356 Ga0070674_100018662 Ga0070674_1000186621 318
32 3300005356 Ga0070674_100034321 Ga0070674_1000343212 318
33 3300005364 Ga0070673_100005364 Ga0070673_1000053641 318
34 3300005366 Ga0070659_100013378 Ga0070659_1000133783 318
35 3300005366 Ga0070659_100315664 Ga0070659_1003156643 318
36 3300005456 Ga0070678_100012308 Ga0070678_1000123082 318
37 3300005456 Ga0070678_100160147 Ga0070678_1001601473 318
38 3300005543 Ga0070672_100009777 Ga0070672_1000097773 318
39 3300005543 Ga0070672_100259887 Ga0070672_1002598872 318
40 3300005548 Ga0070665_100254545 Ga0070665_1002545452 318
41 3300005564 Ga0070664_100014641 Ga0070664_1000146412 318
42 3300005564 Ga0070664_100110854 Ga0070664_1001108542 318
43 3300005618 Ga0068864_100179375 Ga0068864_1001793752 318
44 3300005618 Ga0068864_100261685 Ga0068864_1002616851 318
45 3300005840 Ga0068870_10022991 Ga0068870_100229913 318
46 3300006051 Ga0075364_10075885 Ga0075364_100758852 318
47 3300006237 Ga0097621_100204896 Ga0097621_1002048962 318
48 3300006844 Ga0075428_100453895 Ga0075428_1004538952 318
49 3300006846 Ga0075430_100052669 Ga0075430_1000526693 318
50 3300006847 Ga0075431_100018133 Ga0075431_1000181332 318
51 3300006847 Ga0075431_100429624 Ga0075431_1004296242 318
52 3300009147 Ga0114129_10277347 Ga0114129_102773472 318
53 3300009177 Ga0105248_10159948 Ga0105248_101599483 318
54 3300013296 Ga0157374_10302284 Ga0157374_103022842 318
55 3300013297 Ga0157378_10345216 Ga0157378_103452161 318
56 3300014745 Ga0157377_10173042 Ga0157377_101730422 318
57 3300014969 Ga0157376_10019651 Ga0157376_100196514 318
58 3300017792 Ga0163161_10006762 Ga0163161_100067623 318
59 3300025273 Ga0209673_1031424 Ga0209673_10314241 318
60 3300025295 Ga0209564_1000005 Ga0209564_1000005892 318
61 3300025893 Ga0207682_10000464 Ga0207682_100004645 318
62 3300025907 Ga0207645_10022034 Ga0207645_100220341 318
63 3300025908 Ga0207643_10031527 Ga0207643_100315273 318
64 3300025919 Ga0207657_10279196 Ga0207657_102791962 318
65 3300025920 Ga0207649_10001113 Ga0207649_100011137 318
66 3300025923 Ga0207681_10007123 Ga0207681_100071232 318
67 3300025925 Ga0207650_10001129 Ga0207650_100011298 318
68 3300025926 Ga0207659_10025290 Ga0207659_100252903 318
69 3300025931 Ga0207644_10001847 Ga0207644_1000184713 318
70 3300025932 Ga0207690_10006023 Ga0207690_100060235 318
71 3300025937 Ga0207669_10005124 Ga0207669_100051246 318
72 3300025937 Ga0207669_10027498 Ga0207669_100274982 318
73 3300025940 Ga0207691_10001003 Ga0207691_1000100313 318
74 3300025940 Ga0207691_10261323 Ga0207691_102613231 318
75 3300025945 Ga0207679_10000533 Ga0207679_1000053317 318
76 3300025945 Ga0207679_10089935 Ga0207679_100899352 318
77 3300025960 Ga0207651_10046747 Ga0207651_100467472 318
78 3300025981 Ga0207640_10167062 Ga0207640_101670622 318
79 3300026023 Ga0207677_10040550 Ga0207677_100405502 318
80 3300026089 Ga0207648_10086470 Ga0207648_100864703 318
81 3300026095 Ga0207676_10291412 Ga0207676_102914122 318
82 3300026121 Ga0207683_10033606 Ga0207683_100336066 318
83 3300026142 Ga0207698_10041932 Ga0207698_100419322 318
84 3300028379 Ga0268266_10051651 Ga0268266_100516514 318
85 3300028379 Ga0268266_10161128 Ga0268266_101611282 318
86 3300028786 Ga0307517_10097239 Ga0307517_100972392 318
87 3300031238 Ga0265332_10000037 Ga0265332_1000003713 318
88 3300031251 Ga0265327_10000419 Ga0265327_1000041953 318
89 3300031344 Ga0265316_10000144 Ga0265316_1000014453 318
90 3300031730 Ga0307516_10000138 Ga0307516_1000013818 318
91 3300031730 Ga0307516_10091699 Ga0307516_100916993 318
92 3300031731 Ga0307405_10198417 Ga0307405_101984172 318
93 3300031824 Ga0307413_10006289 Ga0307413_100062894 318
94 3300031824 Ga0307413_10276077 Ga0307413_102760772 318
95 3300031852 Ga0307410_10009037 Ga0307410_100090373 318
96 3300031901 Ga0307406_10025829 Ga0307406_100258292 318
97 3300031903 Ga0307407_10112764 Ga0307407_101127643 318
98 3300031911 Ga0307412_10004788 Ga0307412_100047888 318
99 3300031995 Ga0307409_100047074 Ga0307409_1000470741 318
100 3300032004 Ga0307414_10118737 Ga0307414_101187371 318
101 3300032005 Ga0307411_10001360 Ga0307411_100013606 318
102 3300032005 Ga0307411_10360022 Ga0307411_103600222 318
103 3300035086 Ga0373934_0103333 Ga0373934_0103333_73_1104 318
104 3300035691 Ga0373931_0031066 Ga0373931_0031066_1691_2665 318
105 3300037418 Ga0395900_0000046 Ga0395900_0000046_128375_129406 318
106 3300037471 Ga0395905_0001198 Ga0395905_0001198_2885_3862 318
107 3300037471 Ga0395905_0066690 Ga0395905_0066690_1700_2674 318
108 3300038443 Ga0395901_0038776 Ga0395901_0038776_1616_2611 318
109 3300044684 Ga0466966_0013814 Ga0466966_0013814_614_1588 318
110 3300044694 Ga0466963_0006321 Ga0466963_0006321_1619_2593 318
111 3300044842 Ga0466957_0045907 Ga0466957_0045907_798_1772 318
112 3300044842 Ga0466957_0307769 Ga0466957_0307769_51_1025 318
113 3300045836 Ga0466958_0004614 Ga0466958_0004614_1660_2634 318
114 3300045976 Ga0466967_0078246 Ga0466967_0078246_1155_2129 318
115 3300045976 Ga0466967_0175423 Ga0466967_0175423_82_1056 318
116 3300048904 Ga0496101_0016205 Ga0496101_0016205_2304_3332 318
117 3300048907 Ga0496104_0039954 Ga0496104_0039954_3254_4231 318
118 3300048912 Ga0496109_0006606 Ga0496109_0006606_5651_6628 318
119 3300048912 Ga0496109_0047567 Ga0496109_0047567_582_1559 318
120 3300048913 Ga0496110_0403454 Ga0496110_0403454_162_1136 318
121 3300048914 Ga0496111_0310197 Ga0496111_0310197_100_1077 318
122 3300048915 Ga0496112_0024323 Ga0496112_0024323_310_1287 318
123 3300048916 Ga0496113_0011158 Ga0496113_0011158_4751_5728 318
124 3300048926 Ga0496123_0153162 Ga0496123_0153162_114_1142 318
125 3300048927 Ga0496124_0011928 Ga0496124_0011928_4268_5278 318
126 3300048929 Ga0496126_0003351 Ga0496126_0003351_9932_10960 318
127 3300049592 Ga0501076_0007680 Ga0501076_0007680_2253_3227 318
128 3300049593 Ga0501077_0000896 Ga0501077_0000896_8207_9181 318
129 3300050496 nmdc:mga07m45_2418_c1 nmdc:mga07m45_2418_c1_7090_8121 318
130 3300050507 nmdc:mga05p37_110082_c1 nmdc:mga05p37_110082_c1_809_1810 318
131 3300050509 nmdc:mga0qj67_39860_c1 nmdc:mga0qj67_39860_c1_294_1280 318
132 3300050510 nmdc:mga06r32_21297_c1 nmdc:mga06r32_21297_c1_389_1375 318
133 3300050510 nmdc:mga06r32_546014_c1 nmdc:mga06r32_546014_c1_76_1077 318
134 3300053077 Ga0495601_0042243 Ga0495601_0042243_1175_2149 318
135 3300053136 Ga0500559_0069593 Ga0500559_0069593_212_1198 318
136 3300060353 Ga0501082_0001587 Ga0501082_0001587_18365_19339 318
137 iso_pu_bacteria 2513020051 2513227938 318
138 iso_pu_bacteria 2599185214 2599624107 318
139 iso_pu_bacteria 2599185226 2599672118 318
140 iso_pu_bacteria 2599185227 2599681799 318
141 iso_pu_bacteria 2599185229 2599693813 318
142 iso_pu_bacteria 2643221628 2644162660 318
143 iso_pu_bacteria 2643221658 2644328857 318
144 iso_pu_bacteria 2643221672 2644397924 318
145 iso_pu_bacteria 2643221683 2644469091 318
146 iso_pu_bacteria 2738541277 2738719869 318
147 iso_pu_bacteria 2738541307 2738879718 318
148 iso_pu_bacteria 2738543013 2739252217 318
149 iso_pu_bacteria 2738543019 2739279068 318
150 iso_pu_bacteria 2818991446 2819596551 318
151 iso_pu_bacteria 2842677519 2842677854 318
152 iso_pu_bacteria 2842733646 2842734652 318
153 iso_pu_bacteria 2842747753 2842748577 318
154 iso_pu_bacteria 2881101125 2881105120 318
155 iso_pu_bacteria 2885192300 2885195547 318
156 iso_pu_bacteria 2885198086 2885199268 318
157 iso_pu_bacteria 2899924645 2899931269 318
158 iso_pu_bacteria 2904449895 2904450129 318
159 iso_pu_bacteria 2904541872 2904543985 318
160 iso_pu_bacteria 2928037797 2928037958 318
161 iso_pu_bacteria 2928044640 2928046436 318
162 iso_pu_bacteria 2928051484 2928054132 318
163 iso_pu_bacteria 2928064002 2928065885 318
164 iso_pu_bacteria 2928070936 2928076791 318
165 iso_pu_bacteria 2928084124 2928090460 318
166 iso_pu_bacteria 2928115317 2928117839 318
167 iso_pu_bacteria 2929160207 2929162456 318
168 iso_pu_bacteria 2945945610 2945948790 318
169 iso_pu_bacteria 2945972063 2945972909 318
170 iso_pu_bacteria 2954767861 2954772927 318
171 3300002739 JGI25158J39367_1011817 JGI25158J39367_10118171 319
172 3300002773 JGI25152J39213_1000055 JGI25152J39213_100005580 319
173 3300002773 JGI25152J39213_1001621 JGI25152J39213_100162112 319
174 3300002774 JGI25150J39212_1000424 JGI25150J39212_10004244 319
175 3300002774 JGI25150J39212_1010843 JGI25150J39212_10108432 319
176 3300002987 JGI25159J45721_1001930 JGI25159J45721_100193011 319
177 3300002987 JGI25159J45721_1007937 JGI25159J45721_10079373 319
178 3300003187 JGI25151J46595_10000194 JGI25151J46595_100001943 319
179 3300003187 JGI25151J46595_10014216 JGI25151J46595_100142163 319
180 3300003215 JGI25153J46596_10000139 JGI25153J46596_100001393 319
181 3300003215 JGI25153J46596_10009622 JGI25153J46596_100096223 319
182 3300003323 rootH1_10087963 rootH1_100879632 319
183 3300003354 JGI25160J50197_1001900 JGI25160J50197_10019004 319
184 3300003354 JGI25160J50197_1009738 JGI25160J50197_10097381 319
185 3300003374 JGI25161J50226_1000647 JGI25161J50226_100064711 319
186 3300003374 JGI25161J50226_1010014 JGI25161J50226_10100141 319
187 3300003761 Ga0055535_1000084 Ga0055535_100008471 319
188 3300003762 Ga0055542_1000033 Ga0055542_1000033118 319
189 3300003771 Ga0055526_1000103 Ga0055526_10001033 319
190 3300003771 Ga0055526_1004793 Ga0055526_100479310 319
191 3300003773 Ga0055537_1003250 Ga0055537_10032505 319
192 3300003773 Ga0055537_1010407 Ga0055537_10104073 319
193 3300003775 Ga0055524_1000190 Ga0055524_10001903 319
194 3300003775 Ga0055524_1003218 Ga0055524_100321810 319
195 3300003781 Ga0055536_1003831 Ga0055536_10038313 319
196 3300003781 Ga0055536_1005161 Ga0055536_10051612 319
197 3300003781 Ga0055536_1012297 Ga0055536_10122973 319
198 3300003784 Ga0055534_1001600 Ga0055534_10016004 319
199 3300003784 Ga0055534_1003357 Ga0055534_10033575 319
200 3300003790 Ga0055528_1011449 Ga0055528_10114492 319
201 3300003790 Ga0055528_1018653 Ga0055528_10186534 319
202 3300003791 Ga0055530_10001926 Ga0055530_100019266 319
203 3300003792 Ga0055540_1002430 Ga0055540_10024304 319
204 3300003792 Ga0055540_1003273 Ga0055540_10032733 319
205 3300003792 Ga0055540_1004027 Ga0055540_10040277 319
206 3300003794 Ga0055531_10002763 Ga0055531_1000276314 319
207 3300003794 Ga0055531_10004862 Ga0055531_100048623 319
208 3300003794 Ga0055531_10021272 Ga0055531_100212723 319
209 3300004625 Ga0055543_1002294 Ga0055543_10022943 319
210 3300004625 Ga0055543_1005665 Ga0055543_10056653 319
211 3300005262 Ga0065165_1004284 Ga0065165_100428411 319
212 3300005344 Ga0070661_100286813 Ga0070661_1002868131 319
213 3300005457 Ga0070662_100093193 Ga0070662_1000931933 319
214 3300005539 Ga0068853_100007702 Ga0068853_1000077023 319
215 3300005539 Ga0068853_100194105 Ga0068853_1001941051 319
216 3300005548 Ga0070665_100012242 Ga0070665_1000122425 319
217 3300005577 Ga0068857_100069216 Ga0068857_1000692164 319
218 3300005577 Ga0068857_100436595 Ga0068857_1004365951 319
219 3300005614 Ga0068856_100354409 Ga0068856_1003544092 319
220 3300005616 Ga0068852_100284530 Ga0068852_1002845302 319
221 3300006177 Ga0075362_10035104 Ga0075362_100351044 319
222 3300006195 Ga0075366_10086680 Ga0075366_100866802 319
223 3300006353 Ga0075370_10000393 Ga0075370_1000039312 319
224 3300006353 Ga0075370_10074439 Ga0075370_100744392 319
225 3300006358 Ga0068871_100256300 Ga0068871_1002563001 319
226 3300009036 Ga0105244_10005004 Ga0105244_100050048 319
227 3300009093 Ga0105240_10254760 Ga0105240_102547602 319
228 3300009098 Ga0105245_10333297 Ga0105245_103332972 319
229 3300009148 Ga0105243_10002013 Ga0105243_100020134 319
230 3300009148 Ga0105243_10007917 Ga0105243_100079174 319
231 3300009174 Ga0105241_10053862 Ga0105241_100538622 319
232 3300009545 Ga0105237_10063202 Ga0105237_100632024 319
233 3300010375 Ga0105239_10139085 Ga0105239_101390854 319
234 3300010375 Ga0105239_10163272 Ga0105239_101632723 319
235 3300011119 Ga0105246_10014393 Ga0105246_100143935 319
236 3300013100 Ga0157373_10065691 Ga0157373_100656914 319
237 3300013104 Ga0157370_10006222 Ga0157370_100062227 319
238 3300013104 Ga0157370_10359633 Ga0157370_103596331 319
239 3300014497 Ga0182008_10007756 Ga0182008_100077561 319
240 3300014497 Ga0182008_10052550 Ga0182008_100525502 319
241 3300015261 Ga0182006_1001945 Ga0182006_10019452 319
242 3300015262 Ga0182007_10001457 Ga0182007_1000145710 319
243 3300015265 Ga0182005_1010784 Ga0182005_10107842 319
244 3300017792 Ga0163161_10000128 Ga0163161_1000012864 319
245 3300017792 Ga0163161_10009175 Ga0163161_100091753 319
246 3300025208 Ga0209436_101842 Ga0209436_1018428 319
247 3300025208 Ga0209436_102448 Ga0209436_1024484 319
248 3300025228 Ga0209672_100228 Ga0209672_10022817 319
249 3300025229 Ga0209147_100951 Ga0209147_1009518 319
250 3300025242 Ga0209258_100089 Ga0209258_100089117 319
251 3300025245 Ga0207425_1000103 Ga0207425_10001034 319
252 3300025245 Ga0207425_1002258 Ga0207425_10022582 319
253 3300025254 Ga0209148_1000097 Ga0209148_1000097117 319
254 3300025258 Ga0209129_1000033 Ga0209129_1000033283 319
255 3300025258 Ga0209129_1006595 Ga0209129_10065954 319
256 3300025263 Ga0209565_1000516 Ga0209565_10005169 319
257 3300025263 Ga0209565_1000980 Ga0209565_100098011 319
258 3300025273 Ga0209673_1000372 Ga0209673_10003724 319
259 3300025273 Ga0209673_1000899 Ga0209673_100089910 319
260 3300025284 Ga0209130_1000105 Ga0209130_1000105107 319
261 3300025284 Ga0209130_1000615 Ga0209130_100061520 319
262 3300025291 Ga0209675_1000588 Ga0209675_10005885 319
263 3300025291 Ga0209675_1001425 Ga0209675_10014254 319
264 3300025292 Ga0209676_1000179 Ga0209676_1000179144 319
265 3300025292 Ga0209676_1000260 Ga0209676_100026038 319
266 3300025292 Ga0209676_1001146 Ga0209676_100114621 319
267 3300025292 Ga0209676_1004929 Ga0209676_10049293 319
268 3300025294 Ga0209025_1000221 Ga0209025_1000221103 319
269 3300025295 Ga0209564_1000151 Ga0209564_1000151132 319
270 3300025295 Ga0209564_1000246 Ga0209564_100024641 319
271 3300025297 Ga0209758_1000027 Ga0209758_1000027283 319
272 3300025298 Ga0209050_1000172 Ga0209050_10001727 319
273 3300025298 Ga0209050_1000977 Ga0209050_100097721 319
274 3300025299 Ga0209256_1000069 Ga0209256_1000069180 319
275 3300025299 Ga0209256_1000506 Ga0209256_100050629 319
276 3300025302 Ga0207426_1000027 Ga0207426_1000027248 319
277 3300025302 Ga0207426_1000115 Ga0207426_10001156 319
278 3300025303 Ga0209051_1000046 Ga0209051_10000467 319
279 3300025303 Ga0209051_1000707 Ga0209051_100070714 319
280 3300025303 Ga0209051_1001434 Ga0209051_100143419 319
281 3300025303 Ga0209051_1024551 Ga0209051_10245514 319
282 3300025304 Ga0209257_1000281 Ga0209257_1000281100 319
283 3300025304 Ga0209257_1001995 Ga0209257_100199514 319
284 3300025304 Ga0209257_1003764 Ga0209257_10037644 319
285 3300025304 Ga0209257_1010979 Ga0209257_10109797 319
286 3300025321 Ga0207656_10019055 Ga0207656_100190554 319
287 3300025728 Ga0207655_1000566 Ga0207655_100056625 319
288 3300025907 Ga0207645_10212981 Ga0207645_102129811 319
289 3300025914 Ga0207671_10156318 Ga0207671_101563181 319
290 3300025933 Ga0207706_10015537 Ga0207706_100155377 319
291 3300025935 Ga0207709_10000230 Ga0207709_1000023025 319
292 3300025935 Ga0207709_10000240 Ga0207709_1000024038 319
293 3300026041 Ga0207639_10065773 Ga0207639_100657734 319
294 3300026041 Ga0207639_10098548 Ga0207639_100985482 319
295 3300026116 Ga0207674_10232422 Ga0207674_102324222 319
296 3300026142 Ga0207698_10071918 Ga0207698_100719183 319
297 3300026142 Ga0207698_10572996 Ga0207698_105729961 319
298 3300028379 Ga0268266_10020280 Ga0268266_100202804 319
299 3300031731 Ga0307405_10023742 Ga0307405_100237423 319
300 3300031731 Ga0307405_10108396 Ga0307405_101083962 319
301 3300032002 Ga0307416_100400113 Ga0307416_1004001132 319
302 3300032002 Ga0307416_100654862 Ga0307416_1006548621 319
303 3300041406 Ga0439439_0004068 Ga0439439_0004068_487_1473 319
304 3300041411 Ga0439466_0004497 Ga0439466_0004497_3466_4452 319
305 3300041413 Ga0439465_0001703 Ga0439465_0001703_3603_4589 319
306 3300041997 Ga0439431_0001388 Ga0439431_0001388_3634_4620 319
307 3300041999 Ga0439433_0000999 Ga0439433_0000999_537_1523 319
308 3300042004 Ga0439445_0000173 Ga0439445_0000173_6035_7021 319
309 3300042006 Ga0439432_006435 Ga0439432_006435_2719_3705 319
310 3300042006 Ga0439432_022472 Ga0439432_022472_144_1130 319
311 3300042007 Ga0439449_0000240 Ga0439449_0000240_3418_4404 319
312 3300042007 Ga0439449_0000914 Ga0439449_0000914_6927_7913 319
313 3300042010 Ga0439452_000848 Ga0439452_000848_7946_8932 319
314 3300042010 Ga0439452_004833 Ga0439452_004833_3322_4308 319
315 3300042015 Ga0439462_0000417 Ga0439462_0000417_5543_6529 319
316 3300042015 Ga0439462_0003767 Ga0439462_0003767_301_1287 319
317 3300042128 Ga0450897_000274 Ga0450897_000274_1257_2243 319
318 3300042156 Ga0439446_0002543 Ga0439446_0002543_680_1666 319
319 3300042435 Ga0439434_0000514 Ga0439434_0000514_3645_4631 319
320 3300042435 Ga0439434_0005021 Ga0439434_0005021_2167_3153 319
321 3300042532 Ga0450893_0007724 Ga0450893_0007724_403_1389 319
322 3300046513 Ga0495616_0007564 Ga0495616_0007564_3984_4970 319
323 3300046515 Ga0495620_0009018 Ga0495620_0009018_2118_3104 319
324 3300046520 Ga0495637_0010820 Ga0495637_0010820_449_1435 319
325 3300046530 Ga0495654_0005078 Ga0495654_0005078_5424_6410 319
326 3300046539 Ga0495621_0001120 Ga0495621_0001120_4710_5696 319
327 3300046615 Ga0495656_0000376 Ga0495656_0000376_13476_14462 319
328 3300046674 Ga0495588_0002276 Ga0495588_0002276_2375_3361 319
329 3300046674 Ga0495588_0016509 Ga0495588_0016509_2465_3451 319
330 3300047321 Ga0495676_0001292 Ga0495676_0001292_6434_7420 319
331 3300047673 Ga0495593_0000578 Ga0495593_0000578_8540_9526 319
332 3300048904 Ga0496101_0011100 Ga0496101_0011100_2688_3674 319
333 3300048905 Ga0496102_0160303 Ga0496102_0160303_866_1852 319
334 3300048910 Ga0496107_0064911 Ga0496107_0064911_1606_2592 319
335 3300048920 Ga0496117_0012358 Ga0496117_0012358_5317_6303 319
336 3300048920 Ga0496117_0013542 Ga0496117_0013542_5326_6312 319
337 3300048926 Ga0496123_0061436 Ga0496123_0061436_57_1043 319
338 3300048927 Ga0496124_0075799 Ga0496124_0075799_17_1003 319
339 3300048927 Ga0496124_0111068 Ga0496124_0111068_470_1456 319
340 3300048928 Ga0496125_0017195 Ga0496125_0017195_4311_5297 319
341 3300048928 Ga0496125_0023235 Ga0496125_0023235_2533_3519 319
342 3300048929 Ga0496126_0185700 Ga0496126_0185700_519_1505 319
343 3300050489 nmdc:mga03683_36570_c1 nmdc:mga03683_36570_c1_577_1563 319
344 3300050493 nmdc:mga0k408_83753_c1 nmdc:mga0k408_83753_c1_343_1329 319
345 3300050496 nmdc:mga07m45_3329_c1 nmdc:mga07m45_3329_c1_3882_4868 319
346 3300050496 nmdc:mga07m45_66243_c1 nmdc:mga07m45_66243_c1_575_1561 319
347 3300053087 Ga0500643_009328 Ga0500643_009328_2362_3348 319
348 3300053093 Ga0500651_0000024 Ga0500651_0000024_99663_100649 319
349 3300053110 Ga0500571_000051 Ga0500571_000051_16261_17247 319
350 3300053118 Ga0500594_0001839 Ga0500594_0001839_1171_2157 319
351 3300053120 Ga0500597_021474 Ga0500597_021474_1358_2344 319
352 3300053121 Ga0500607_002042 Ga0500607_002042_10801_11787 319
353 3300053134 Ga0500658_0004356 Ga0500658_0004356_3776_4762 319
354 3300053134 Ga0500658_0004518 Ga0500658_0004518_434_1420 319
355 3300053136 Ga0500559_0002990 Ga0500559_0002990_4555_5541 319
356 3300053137 Ga0500561_0032706 Ga0500561_0032706_327_1313 319
357 3300053138 Ga0500564_005638 Ga0500564_005638_2631_3617 319
358 3300053139 Ga0500568_0001905 Ga0500568_0001905_6206_7192 319
359 3300053141 Ga0500574_003174 Ga0500574_003174_1841_2827 319
360 3300053153 Ga0500616_0028215 Ga0500616_0028215_704_1690 319
361 3300053161 Ga0500634_0006380 Ga0500634_0006380_3419_4405 319
362 3300053161 Ga0500634_0040982 Ga0500634_0040982_92_1078 319
363 3300053162 Ga0500638_019801 Ga0500638_019801_1961_2947 319
364 3300053177 Ga0500636_0073113 Ga0500636_0073113_955_1941 319
365 3300048925 Ga0496122_0000546 Ga0496122_0000546_53896_54882 320
366 3300048926 Ga0496123_0000235 Ga0496123_0000235_58217_59203 320
367 3300003187 JGI25151J46595_10002906 JGI25151J46595_100029069 321
368 3300003773 Ga0055537_1000163 Ga0055537_100016334 321
369 3300003784 Ga0055534_1000150 Ga0055534_100015034 321
370 3300003790 Ga0055528_1003203 Ga0055528_10032033 321
371 3300005288 Ga0065714_10069768 Ga0065714_100697682 321
372 3300005328 Ga0070676_10008255 Ga0070676_100082553 321
373 3300005331 Ga0070670_100015997 Ga0070670_1000159977 321
374 3300005354 Ga0070675_100253858 Ga0070675_1002538581 321
375 3300005367 Ga0070667_100115139 Ga0070667_1001151393 321
376 3300005367 Ga0070667_100129136 Ga0070667_1001291361 321
377 3300005459 Ga0068867_100016609 Ga0068867_1000166093 321
378 3300006353 Ga0075370_10005973 Ga0075370_100059732 321
379 3300006948 Ga0099826_10000055 Ga0099826_1000005520 321
380 3300009098 Ga0105245_10062901 Ga0105245_100629013 321
381 3300009148 Ga0105243_10230216 Ga0105243_102302161 321
382 3300011119 Ga0105246_10047338 Ga0105246_100473382 321
383 3300013104 Ga0157370_10415378 Ga0157370_104153781 321
384 3300013308 Ga0157375_10070629 Ga0157375_100706293 321
385 3300014497 Ga0182008_10002785 Ga0182008_1000278510 321
386 3300015262 Ga0182007_10000940 Ga0182007_100009409 321
387 3300025263 Ga0209565_1000120 Ga0209565_100012066 321
388 3300025273 Ga0209673_1000099 Ga0209673_1000099134 321
389 3300025291 Ga0209675_1000054 Ga0209675_1000054134 321
390 3300025294 Ga0209025_1000732 Ga0209025_100073229 321
391 3300025295 Ga0209564_1019875 Ga0209564_10198752 321
392 3300025299 Ga0209256_1021207 Ga0209256_10212071 321
393 3300025303 Ga0209051_1058005 Ga0209051_10580051 321
394 3300025907 Ga0207645_10005669 Ga0207645_100056693 321
395 3300025925 Ga0207650_10033329 Ga0207650_100333293 321
396 3300025926 Ga0207659_10060126 Ga0207659_100601264 321
397 3300025927 Ga0207687_10062855 Ga0207687_100628553 321
398 3300025940 Ga0207691_10116224 Ga0207691_101162243 321
399 3300025942 Ga0207689_10039581 Ga0207689_100395813 321
400 3300025986 Ga0207658_10110704 Ga0207658_101107041 321
401 3300025986 Ga0207658_10341562 Ga0207658_103415622 321
402 3300026089 Ga0207648_10010746 Ga0207648_1001074610 321
403 3300026116 Ga0207674_10045346 Ga0207674_100453464 321
404 3300026121 Ga0207683_10029398 Ga0207683_100293983 321
405 3300026121 Ga0207683_10041842 Ga0207683_100418424 321
406 3300027666 Ga0209282_1000363 Ga0209282_100036328 321
407 3300028794 Ga0307515_10001286 Ga0307515_1000128660 321
408 3300028794 Ga0307515_10005581 Ga0307515_1000558120 321
409 3300028794 Ga0307515_10239168 Ga0307515_102391682 321
410 3300030733 Ga0314311_1116647 Ga0314311_111664718 321
411 3300030735 Ga0316178_1051159 Ga0316178_10511594 321
412 3300030736 Ga0316180_1180628 Ga0316180_11806282 321
413 3300030742 Ga0316183_1009415 Ga0316183_10094152 321
414 3300030742 Ga0316183_1031412 Ga0316183_103141210 321
415 3300030744 Ga0316181_1174844 Ga0316181_117484414 321
416 3300030745 Ga0316182_1426068 Ga0316182_14260683 321
417 3300031507 Ga0307509_10004147 Ga0307509_100041471 321
418 3300031507 Ga0307509_10038659 Ga0307509_100386595 321
419 3300031507 Ga0307509_10098159 Ga0307509_100981592 321
420 3300031616 Ga0307508_10000163 Ga0307508_1000016315 321
421 3300032002 Ga0307416_100345313 Ga0307416_1003453132 321
422 3300032005 Ga0307411_10063848 Ga0307411_100638483 321
423 3300033179 Ga0307507_10147619 Ga0307507_101476192 321
424 3300033180 Ga0307510_10298405 Ga0307510_102984051 321
425 3300041404 Ga0439436_0006136 Ga0439436_0006136_129_1115 321
426 3300042002 Ga0439442_001828 Ga0439442_001828_1099_2085 321
427 3300042007 Ga0439449_0013617 Ga0439449_0013617_957_1943 321
428 3300042134 Ga0450898_007811 Ga0450898_007811_220_1206 321
429 3300042435 Ga0439434_0001272 Ga0439434_0001272_4922_5908 321
430 3300042531 Ga0450918_001344 Ga0450918_001344_2906_3892 321
431 3300046475 Ga0495639_0008096 Ga0495639_0008096_2641_3627 321
432 3300046506 Ga0495583_0100665 Ga0495583_0100665_75_1061 321
433 3300046674 Ga0495588_0036047 Ga0495588_0036047_453_1439 321
434 3300046683 Ga0495658_0051834 Ga0495658_0051834_1243_2229 321
435 3300046810 Ga0495660_0072928 Ga0495660_0072928_257_1243 321
436 3300048903 Ga0496100_0017325 Ga0496100_0017325_767_1753 321
437 3300048904 Ga0496101_0027947 Ga0496101_0027947_2208_3194 321
438 3300048905 Ga0496102_0031175 Ga0496102_0031175_2427_3413 321
439 3300048907 Ga0496104_0012070 Ga0496104_0012070_5621_6607 321
440 3300048909 Ga0496106_0020175 Ga0496106_0020175_127_1113 321
441 3300048911 Ga0496108_0085381 Ga0496108_0085381_564_1550 321
442 3300048911 Ga0496108_0335717 Ga0496108_0335717_140_1126 321
443 3300048912 Ga0496109_0226332 Ga0496109_0226332_117_1103 321
444 3300048913 Ga0496110_0181433 Ga0496110_0181433_390_1376 321
445 3300048917 Ga0496114_0336974 Ga0496114_0336974_199_1185 321
446 3300049705 Ga0501225_0009324 Ga0501225_0009324_1757_2743 321
447 3300050496 nmdc:mga07m45_2915_c1 nmdc:mga07m45_2915_c1_879_1865 321
448 3300053079 Ga0500610_0069524 Ga0500610_0069524_212_1198 321
449 3300053125 Ga0500618_016722 Ga0500618_016722_81_1073 321
450 3300001989 JGI24739J22299_10026299 JGI24739J22299_100262991 322
451 3300003187 JGI25151J46595_10003641 JGI25151J46595_100036413 322
452 3300003187 JGI25151J46595_10005584 JGI25151J46595_100055849 322
453 3300003781 Ga0055536_1031780 Ga0055536_10317801 322
454 3300003784 Ga0055534_1000944 Ga0055534_10009444 322
455 3300003792 Ga0055540_1002120 Ga0055540_10021203 322
456 3300005456 Ga0070678_100165367 Ga0070678_1001653673 322
457 3300005459 Ga0068867_100386394 Ga0068867_1003863941 322
458 3300006038 Ga0075365_10137585 Ga0075365_101375852 322
459 3300006048 Ga0075363_100020663 Ga0075363_1000206634 322
460 3300006051 Ga0075364_10114218 Ga0075364_101142182 322
461 3300006058 Ga0075432_10002635 Ga0075432_100026356 322
462 3300006058 Ga0075432_10005605 Ga0075432_100056057 322
463 3300006178 Ga0075367_10132007 Ga0075367_101320072 322
464 3300006195 Ga0075366_10001075 Ga0075366_100010753 322
465 3300006353 Ga0075370_10001974 Ga0075370_100019747 322
466 3300006353 Ga0075370_10002696 Ga0075370_1000269611 322
467 3300006353 Ga0075370_10005479 Ga0075370_100054798 322
468 3300006353 Ga0075370_10247352 Ga0075370_102473521 322
469 3300009148 Ga0105243_10084820 Ga0105243_100848202 322
470 3300013100 Ga0157373_10020640 Ga0157373_100206404 322
471 3300014497 Ga0182008_10000282 Ga0182008_100002826 322
472 3300014497 Ga0182008_10009182 Ga0182008_100091822 322
473 3300015683 Ga0183362_10001 Ga0183362_10001592 322
474 3300017792 Ga0163161_10009688 Ga0163161_100096888 322
475 3300017792 Ga0163161_10076782 Ga0163161_100767822 322
476 3300025258 Ga0209129_1001321 Ga0209129_100132116 322
477 3300025284 Ga0209130_1001622 Ga0209130_10016226 322
478 3300025291 Ga0209675_1001203 Ga0209675_100120313 322
479 3300025291 Ga0209675_1001574 Ga0209675_10015743 322
480 3300025292 Ga0209676_1004118 Ga0209676_10041188 322
481 3300025292 Ga0209676_1025274 Ga0209676_10252742 322
482 3300025294 Ga0209025_1001070 Ga0209025_100107025 322
483 3300025294 Ga0209025_1044137 Ga0209025_10441371 322
484 3300025295 Ga0209564_1036861 Ga0209564_10368612 322
485 3300025298 Ga0209050_1011057 Ga0209050_10110574 322
486 3300025303 Ga0209051_1000510 Ga0209051_100051030 322
487 3300025304 Ga0209257_1008565 Ga0209257_10085654 322
488 3300025935 Ga0207709_10062674 Ga0207709_100626742 322
489 3300026121 Ga0207683_10218717 Ga0207683_102187173 322
490 3300027907 Ga0207428_10179321 Ga0207428_101793211 322
491 3300028379 Ga0268266_10310814 Ga0268266_103108141 322
492 3300028794 Ga0307515_10105599 Ga0307515_101055993 322
493 3300030732 Ga0316176_1042615 Ga0316176_10426158 322
494 3300031251 Ga0265327_10022905 Ga0265327_100229054 322
495 3300031548 Ga0307408_100079020 Ga0307408_1000790201 322
496 3300031548 Ga0307408_100154216 Ga0307408_1001542162 322
497 3300031649 Ga0307514_10098955 Ga0307514_100989554 322
498 3300031731 Ga0307405_10167516 Ga0307405_101675161 322
499 3300031901 Ga0307406_10000879 Ga0307406_1000087919 322
500 3300031903 Ga0307407_10050585 Ga0307407_100505852 322
501 3300031911 Ga0307412_10251946 Ga0307412_102519461 322
502 3300032004 Ga0307414_10026973 Ga0307414_100269735 322
503 3300041494 Ga0451837_1331497 Ga0451837_1331497_29_1015 322
504 3300042007 Ga0439449_0001046 Ga0439449_0001046_3378_4364 322
505 3300042115 Ga0450911_000459 Ga0450911_000459_6066_7061 322
506 3300042435 Ga0439434_0009974 Ga0439434_0009974_855_1844 322
507 3300044683 Ga0466965_0022522 Ga0466965_0022522_173_1159 322
508 3300046517 Ga0495630_0162781 Ga0495630_0162781_174_1160 322
509 3300046660 Ga0495625_0000903 Ga0495625_0000903_20514_21500 322
510 3300046692 Ga0495671_0001383 Ga0495671_0001383_6456_7442 322
511 3300048908 Ga0496105_0000491 Ga0496105_0000491_17158_18144 322
512 3300048917 Ga0496114_0059646 Ga0496114_0059646_740_1726 322
513 3300048919 Ga0496116_0022039 Ga0496116_0022039_280_1266 322
514 3300048920 Ga0496117_0194293 Ga0496117_0194293_109_1095 322
515 3300048924 Ga0496121_0008084 Ga0496121_0008084_9028_10023 322
516 3300048926 Ga0496123_0070397 Ga0496123_0070397_760_1746 322
517 3300048927 Ga0496124_0037347 Ga0496124_0037347_986_1981 322
518 3300048928 Ga0496125_0007132 Ga0496125_0007132_5067_6062 322
519 3300048928 Ga0496125_0009295 Ga0496125_0009295_3397_4392 322
520 3300048929 Ga0496126_0219421 Ga0496126_0219421_311_1306 322
521 3300050489 nmdc:mga03683_14561_c1 nmdc:mga03683_14561_c1_419_1405 322
522 3300050489 nmdc:mga03683_16008_c1 nmdc:mga03683_16008_c1_997_2010 322
523 3300050490 nmdc:mga03n38_1379_c1 nmdc:mga03n38_1379_c1_1874_2860 322
524 3300050492 nmdc:mga0yw44_23816_c1 nmdc:mga0yw44_23816_c1_1713_2699 322
525 3300050493 nmdc:mga0k408_214107_c1 nmdc:mga0k408_214107_c1_27_1013 322
526 3300050493 nmdc:mga0k408_873_c1 nmdc:mga0k408_873_c1_1890_2903 322
527 3300050494 nmdc:mga06z11_28981_c1 nmdc:mga06z11_28981_c1_446_1432 322
528 3300050496 nmdc:mga07m45_498_c1 nmdc:mga07m45_498_c1_6323_7309 322
529 3300050496 nmdc:mga07m45_621_c1 nmdc:mga07m45_621_c1_6585_7598 322
530 3300050496 nmdc:mga07m45_8196_c1 nmdc:mga07m45_8196_c1_2697_3683 322
531 3300050496 nmdc:mga07m45_87396_c1 nmdc:mga07m45_87396_c1_128_1114 322
532 3300053108 Ga0500562_008924 Ga0500562_008924_1427_2416 322
533 3300053117 Ga0500593_001191 Ga0500593_001191_2177_3163 322
534 3300053145 Ga0500586_051216 Ga0500586_051216_208_1197 322
535 3300053158 Ga0500627_0002056 Ga0500627_0002056_2621_3607 322
536 iso_pu_bacteria 2831265667 2831267978 322
537 iso_pu_bacteria 2838054893 2838060080 322
538 iso_pu_bacteria 2919462493 2919464939 322
539 iso_pu_bacteria 2945984333 2945984557 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

78

162

0.93

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

203

340

0.89

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

235

378

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pqw-assembly1.cif.gz_B putative enoyl reductase domain of polyketide synthase 0.8857 114 288
4eye-assembly2.cif.gz_B crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad 0.8745 1 322
6lhr-assembly2.cif.gz_C crystal structure of the complex between vesicle amine transport-1 and nadp 0.8733 15 321
7ayc-assembly1.cif.gz_A-2 crystal structure of human mitochondrial 2-enoyl thioester reductase (mecr) with single mutation g165q 0.8703 15 321
3gms-assembly1.cif.gz_A crystal structure of putative nadph:quinone reductase from bacillus thuringiensis 0.8692 15 322
ID Description Score Start End Superfamily
af_Q3UNZ8_155_284_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9709 126 256 3.40.50.720
af_B0BNC9_147_315_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9632 118 287 3.40.50.720
af_Q3UNZ8_155_284_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.949 126 256 3.40.50.720
af_B0BNC9_147_315_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9465 118 287 3.40.50.720
af_Q08257_129_296_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.941 116 288 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A355B5N3-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.975 110 321 GO:0008270
GO:0016491
AF-A0A7X7JHQ4-F1-model_v4 Zinc-binding dehydrogenase 0.9741 102 320 GO:0016491
AF-A0A670Y0B9-F1-model_v4 Alcohol dehydrogenase-like C-terminal domain-containing protein 0.9732 135 322 GO:0005739
GO:0016491
AF-A0A2E2JFP5-F1-model_v4 NADPH:quinone oxidoreductase 0.971 150 322 GO:0016491
AF-A0A7X5WVL9-F1-model_v4 Alcohol dehydrogenase catalytic domain-containing protein 0.968 21 107 GO:0016491

Feature Viewer

pLDDT pTM Quality
95.18 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map