F461142

General Info

Members Datasets Scaffolds Average Seq Length
539 270 1078 80

Family's Representative Sequence

Representative Sequence 3300028036|Ga0265355_1008664|Ga0265355_10086642
Length 90
Sequence MVIDHGINDVMKEIAISVFKAKCLGILEEVRKTRKPIRVTRFGKPVAEVIPPSPVEGSVRGLGSMAGTMKIVGDIVGPTGSLDDWEAWRK

Samples

Sample ID Description Type Environment
1 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
113 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
114 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028010 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 Metagenome Rhizosphere
177 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
178 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
183 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
189 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
190 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
191 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
192 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
193 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
194 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
195 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
196 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
200 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
201 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
202 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
203 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
204 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
215 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
216 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
219 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
228 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
231 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
234 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
237 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
242 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
258 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
259 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
260 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.89
Metatranscriptomes 1.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.82
Rhizosphere 94.99
Stem 0
Stem Tuber 0
Unclassified 19.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265355_1008664 3300028036 Unclassified 816
2 LJNas_1000481 3300000546 Bacteria 6994
3 Ga0065712_10223021 3300005290 Bacteria 1035
4 Ga0065712_10774454 3300005290 Unclassified 520
5 Ga0070676_10094392 3300005328 Bacteria 1838
6 Ga0070676_10151251 3300005328 Bacteria 1486
7 Ga0070683_100036148 3300005329 Bacteria 4518
8 Ga0070683_102175864 3300005329 Bacteria 532
9 Ga0070690_100033300 3300005330 Bacteria 3224
10 Ga0070690_100294601 3300005330 Bacteria 1161
11 Ga0070677_10806939 3300005333 Bacteria 536
12 Ga0068869_100021355 3300005334 Bacteria 4452
13 Ga0068869_100347319 3300005334 Unclassified 1208
14 Ga0070666_10078961 3300005335 Bacteria 2247
15 Ga0070680_100117388 3300005336 Bacteria 2219
16 Ga0070680_100186089 3300005336 Bacteria 1749
17 Ga0070682_100217160 3300005337 Bacteria 1358
18 Ga0068868_100046008 3300005338 Bacteria 3416
19 Ga0068868_100067305 3300005338 Bacteria 2850
20 Ga0068868_101295768 3300005338 Bacteria 677
21 Ga0070660_100035322 3300005339 Bacteria 3783
22 Ga0070689_100354123 3300005340 Bacteria 1232
23 Ga0070691_10030964 3300005341 Bacteria 2508
24 Ga0070691_10241753 3300005341 Bacteria 965
25 Ga0070687_100403751 3300005343 Unclassified 897
26 Ga0070687_100751057 3300005343 Bacteria 686
27 Ga0070661_100006404 3300005344 Bacteria 8118
28 Ga0070668_100004795 3300005347 Bacteria 10024
29 Ga0070668_100178014 3300005347 Bacteria 1735
30 Ga0070669_100086284 3300005353 Bacteria 2345
31 Ga0070675_100219380 3300005354 Bacteria 1656
32 Ga0070674_100414341 3300005356 Unclassified 1104
33 Ga0070674_100775760 3300005356 Bacteria 826
34 Ga0070688_100319340 3300005365 Bacteria 1128
35 Ga0070659_100028991 3300005366 Bacteria 4276
36 Ga0070659_100033226 3300005366 Bacteria 4005
37 Ga0070667_100033097 3300005367 Bacteria 4316
38 Ga0070667_100176807 3300005367 Bacteria 1886
39 Ga0070703_10431567 3300005406 Bacteria 580
40 Ga0070709_10006667 3300005434 Bacteria 6305
41 Ga0070709_10008132 3300005434 Bacteria 5758
42 Ga0070709_10131157 3300005434 Bacteria 1711
43 Ga0070709_10178716 3300005434 Bacteria 1488
44 Ga0070709_10305083 3300005434 Unclassified 1164
45 Ga0070714_100000071 3300005435 Bacteria 90189
46 Ga0070714_100010637 3300005435 Bacteria 7279
47 Ga0070714_100058059 3300005435 Bacteria 3314
48 Ga0070714_100059942 3300005435 Bacteria 3265
49 Ga0070714_100245696 3300005435 Bacteria 1653
50 Ga0070714_101709395 3300005435 Bacteria 614
51 Ga0070713_100000176 3300005436 Bacteria 42775
52 Ga0070713_100000672 3300005436 Bacteria 21907
53 Ga0070713_100021362 3300005436 Bacteria 4976
54 Ga0070713_100938585 3300005436 Bacteria 833
55 Ga0070713_101044878 3300005436 Bacteria 789
56 Ga0070713_101789077 3300005436 Bacteria 596
57 Ga0070713_101791951 3300005436 Unclassified 596
58 Ga0070713_102474209 3300005436 Unclassified 502
59 Ga0070710_10010374 3300005437 Bacteria 4575
60 Ga0070710_10033288 3300005437 Bacteria 2798
61 Ga0070710_10438365 3300005437 Unclassified 883
62 Ga0070710_10512791 3300005437 Unclassified 823
63 Ga0070701_10540293 3300005438 Bacteria 763
64 Ga0070711_100001635 3300005439 Bacteria 12381
65 Ga0070711_100006078 3300005439 Bacteria 7257
66 Ga0070711_100236497 3300005439 Bacteria 1426
67 Ga0070711_100713523 3300005439 Bacteria 845
68 Ga0070700_100177591 3300005441 Bacteria 1479
69 Ga0070708_100014715 3300005445 Bacteria 6445
70 Ga0070708_100015361 3300005445 Bacteria 6322
71 Ga0070708_100226919 3300005445 Unclassified 1752
72 Ga0070708_100766321 3300005445 Bacteria 907
73 Ga0070708_100778462 3300005445 Bacteria 899
74 Ga0070708_101995639 3300005445 Unclassified 537
75 Ga0070663_100018760 3300005455 Bacteria 4543
76 Ga0070663_100408349 3300005455 Bacteria 1112
77 Ga0070663_100499836 3300005455 Bacteria 1010
78 Ga0070678_100027051 3300005456 Bacteria 3888
79 Ga0070678_100538229 3300005456 Unclassified 1035
80 Ga0070662_100008569 3300005457 Bacteria 6669
81 Ga0070681_10128443 3300005458 Bacteria 2467
82 Ga0070681_11024649 3300005458 Unclassified 745
83 Ga0068867_100122879 3300005459 Bacteria 2008
84 Ga0070706_100164232 3300005467 Bacteria 2073
85 Ga0070706_100452288 3300005467 Bacteria 1195
86 Ga0070707_100010261 3300005468 Bacteria 8724
87 Ga0070707_100045424 3300005468 Bacteria 4205
88 Ga0070707_100096369 3300005468 Bacteria 2865
89 Ga0070707_100156538 3300005468 Bacteria 2220
90 Ga0070707_100452578 3300005468 Bacteria 1244
91 Ga0070707_101536357 3300005468 Bacteria 632
92 Ga0070698_100068665 3300005471 Bacteria 3561
93 Ga0070698_100909280 3300005471 Unclassified 826
94 Ga0070679_100107999 3300005530 Bacteria 2768
95 Ga0070679_100289794 3300005530 Bacteria 1588
96 Ga0070684_100015758 3300005535 Bacteria 6169
97 Ga0070697_100234594 3300005536 Unclassified 1566
98 Ga0070697_100855355 3300005536 Unclassified 806
99 Ga0070697_102006185 3300005536 Unclassified 518
100 Ga0068853_100074018 3300005539 Bacteria 2971
101 Ga0068853_100086870 3300005539 Bacteria 2743
102 Ga0070686_100014356 3300005544 Bacteria 4566
103 Ga0070686_100552320 3300005544 Bacteria 901
104 Ga0070695_100229057 3300005545 Bacteria 1342
105 Ga0070695_100246656 3300005545 Bacteria 1298
106 Ga0070696_100035762 3300005546 Bacteria 3421
107 Ga0070693_100425267 3300005547 Bacteria 926
108 Ga0070665_100019561 3300005548 Bacteria 6798
109 Ga0070665_100283912 3300005548 Bacteria 1657
110 Ga0070704_100262299 3300005549 Bacteria 1424
111 Ga0070704_100321692 3300005549 Bacteria 1296
112 Ga0068855_100420303 3300005563 Bacteria 1462
113 Ga0068855_100628506 3300005563 Bacteria 1155
114 Ga0068855_101987380 3300005563 Unclassified 587
115 Ga0070664_100061092 3300005564 Bacteria 3210
116 Ga0070664_100315468 3300005564 Bacteria 1415
117 Ga0068857_100115679 3300005577 Bacteria 2412
118 Ga0068857_101268521 3300005577 Bacteria 714
119 Ga0068854_100011622 3300005578 Bacteria 5741
120 Ga0068854_100094219 3300005578 Bacteria 2233
121 Ga0068856_100033058 3300005614 Bacteria 5065
122 Ga0068856_100063104 3300005614 Bacteria 3660
123 Ga0070702_100248805 3300005615 Unclassified 1204
124 Ga0070702_100759551 3300005615 Bacteria 745
125 Ga0068852_102182117 3300005616 Unclassified 575
126 Ga0068859_100107862 3300005617 Bacteria 2845
127 Ga0068859_100141499 3300005617 Bacteria 2479
128 Ga0068864_100306172 3300005618 Bacteria 1489
129 Ga0068864_100378835 3300005618 Bacteria 1340
130 Ga0068866_10040683 3300005718 Bacteria 2302
131 Ga0068866_10068451 3300005718 Bacteria 1867
132 Ga0068861_100096094 3300005719 Bacteria 2347
133 Ga0068861_102335347 3300005719 Unclassified 537
134 Ga0068851_10037216 3300005834 Bacteria 2439
135 Ga0068851_10065010 3300005834 Bacteria 1876
136 Ga0068863_102576076 3300005841 Bacteria 518
137 Ga0068858_100036947 3300005842 Bacteria 4528
138 Ga0068858_100458149 3300005842 Bacteria 1229
139 Ga0068860_100085701 3300005843 Bacteria 2997
140 Ga0068862_100025562 3300005844 Bacteria 4957
141 Ga0070717_10004715 3300006028 Bacteria 9907
142 Ga0070717_10011654 3300006028 Bacteria 6687
143 Ga0070717_10077935 3300006028 Bacteria 2776
144 Ga0070717_10115792 3300006028 Bacteria 2291
145 Ga0070715_10008109 3300006163 Bacteria 3649
146 Ga0070715_10022796 3300006163 Bacteria 2445
147 Ga0070715_10100037 3300006163 Bacteria 1351
148 Ga0070715_11027642 3300006163 Bacteria 515
149 Ga0070716_100002367 3300006173 Bacteria 8676
150 Ga0070716_100009543 3300006173 Bacteria 4838
151 Ga0070716_100406410 3300006173 Bacteria 980
152 Ga0070716_100784432 3300006173 Unclassified 736
153 Ga0070712_100000421 3300006175 Bacteria 24270
154 Ga0070712_100000464 3300006175 Bacteria 23301
155 Ga0070712_100018122 3300006175 Bacteria 4568
156 Ga0070712_100420700 3300006175 Bacteria 1107
157 Ga0070712_100863544 3300006175 Bacteria 779
158 Ga0097621_100072151 3300006237 Bacteria 2856
159 Ga0097621_100141044 3300006237 Bacteria 2059
160 Ga0097621_100156642 3300006237 Bacteria 1955
161 Ga0097621_100184807 3300006237 Bacteria 1802
162 Ga0068871_100026743 3300006358 Bacteria 4506
163 Ga0068871_100079005 3300006358 Bacteria 2721
164 Ga0068871_100186565 3300006358 Bacteria 1785
165 Ga0068871_101412430 3300006358 Bacteria 656
166 Ga0068871_101556610 3300006358 Unclassified 625
167 Ga0075430_100019840 3300006846 Bacteria 5719
168 Ga0075431_100020509 3300006847 Bacteria 6752
169 Ga0075433_10001388 3300006852 Bacteria 17839
170 Ga0075434_100000201 3300006871 Bacteria 40218
171 Ga0075429_100813170 3300006880 Unclassified 818
172 Ga0068865_100880082 3300006881 Unclassified 778
173 Ga0068865_100998779 3300006881 Bacteria 733
174 Ga0068865_102212619 3300006881 Bacteria 501
175 Ga0075436_100005849 3300006914 Bacteria 8448
176 Ga0075436_101544523 3300006914 Unclassified 504
177 Ga0097620_100107857 3300006931 Bacteria 2845
178 Ga0097620_100141506 3300006931 Bacteria 2479
179 Ga0075435_100000888 3300007076 Bacteria 18792
180 Ga0075435_100045124 3300007076 Bacteria 3532
181 Ga0075435_100844079 3300007076 Unclassified 798
182 Ga0099794_10129360 3300007265 Unclassified 1274
183 Ga0099795_10026884 3300007788 Bacteria 1942
184 Ga0105240_10050824 3300009093 Bacteria 5223
185 Ga0105240_11526075 3300009093 Bacteria 700
186 Ga0105245_10343522 3300009098 Bacteria 1477
187 Ga0105245_10638015 3300009098 Bacteria 1094
188 Ga0105247_10067087 3300009101 Bacteria 2235
189 Ga0105247_10109508 3300009101 Bacteria 1776
190 Ga0114129_10093002 3300009147 Bacteria 4178
191 Ga0114129_11801314 3300009147 Bacteria 744
192 Ga0105243_10032244 3300009148 Bacteria 4046
193 Ga0105243_10033010 3300009148 Bacteria 4001
194 Ga0105243_11369286 3300009148 Unclassified 727
195 Ga0105241_10170006 3300009174 Bacteria 1800
196 Ga0105241_10176483 3300009174 Bacteria 1769
197 Ga0105241_11227337 3300009174 Bacteria 711
198 Ga0105241_11441547 3300009174 Unclassified 661
199 Ga0105242_10017393 3300009176 Bacteria 5603
200 Ga0105242_10328584 3300009176 Bacteria 1405
201 Ga0105248_10097356 3300009177 Bacteria 3315
202 Ga0105248_10701140 3300009177 Bacteria 1142
203 Ga0105248_12810471 3300009177 Unclassified 555
204 Ga0105237_10843121 3300009545 Bacteria 923
205 Ga0105237_12553301 3300009545 Unclassified 521
206 Ga0105238_10609944 3300009551 Bacteria 1100
207 Ga0105238_10852071 3300009551 Bacteria 928
208 Ga0105238_12114602 3300009551 Bacteria 597
209 Ga0105238_12119960 3300009551 Unclassified 597
210 Ga0105249_10008176 3300009553 Bacteria 9118
211 Ga0105249_10012029 3300009553 Bacteria 7616
212 Ga0099796_10188121 3300010159 Unclassified 832
213 Ga0105239_10876288 3300010375 Bacteria 1030
214 Ga0105246_10017179 3300011119 Bacteria 4596
215 Ga0105246_10397260 3300011119 Bacteria 1144
216 Ga0157373_10170038 3300013100 Bacteria 1533
217 Ga0157373_10519273 3300013100 Bacteria 862
218 Ga0157371_10054168 3300013102 Bacteria 2849
219 Ga0157371_10100079 3300013102 Bacteria 2056
220 Ga0157370_10480614 3300013104 Unclassified 1141
221 Ga0157370_11461940 3300013104 Bacteria 615
222 Ga0157369_10077941 3300013105 Bacteria 3551
223 Ga0157374_10002857 3300013296 Bacteria 14491
224 Ga0157374_10136354 3300013296 Bacteria 2380
225 Ga0157374_10329048 3300013296 Bacteria 1515
226 Ga0157374_11609844 3300013296 Bacteria 674
227 Ga0157378_10001150 3300013297 Bacteria 24054
228 Ga0157378_10012085 3300013297 Bacteria 7561
229 Ga0157378_10670407 3300013297 Bacteria 1054
230 Ga0157378_10841228 3300013297 Bacteria 945
231 Ga0157378_11046618 3300013297 Unclassified 852
232 Ga0157378_11407233 3300013297 Unclassified 740
233 Ga0163162_10036046 3300013306 Bacteria 4928
234 Ga0163162_10619837 3300013306 Bacteria 1207
235 Ga0157372_10112911 3300013307 Bacteria 3114
236 Ga0157372_10149576 3300013307 Bacteria 2694
237 Ga0157375_10088289 3300013308 Bacteria 3155
238 Ga0157375_10751234 3300013308 Bacteria 1127
239 Ga0163163_10440776 3300014325 Bacteria 1362
240 Ga0163163_10700535 3300014325 Bacteria 1076
241 Ga0163163_11381520 3300014325 Bacteria 766
242 Ga0157379_10075023 3300014968 Bacteria 3027
243 Ga0157379_10082248 3300014968 Bacteria 2885
244 Ga0157376_10004594 3300014969 Bacteria 9614
245 Ga0157376_10063825 3300014969 Bacteria 3104
246 Ga0157376_10116489 3300014969 Bacteria 2361
247 Ga0157376_10120502 3300014969 Bacteria 2324
248 Ga0157376_10372012 3300014969 Unclassified 1374
249 Ga0157376_11167645 3300014969 Bacteria 797
250 Ga0163161_10697737 3300017792 Bacteria 845
251 Ga0224570_101847 3300022730 Bacteria 1488
252 Ga0224569_105659 3300022732 Unclassified 923
253 Ga0224569_106979 3300022732 Bacteria 821
254 Ga0228598_1015452 3300024227 Bacteria 1507
255 Ga0228598_1028815 3300024227 Bacteria 1092
256 Ga0228598_1049930 3300024227 Unclassified 829
257 Ga0228598_1127676 3300024227 Bacteria 517
258 Ga0207697_10106795 3300025315 Bacteria 1197
259 Ga0207697_10116603 3300025315 Bacteria 1147
260 Ga0207656_10036532 3300025321 Bacteria 2062
261 Ga0207656_10217649 3300025321 Unclassified 927
262 Ga0207682_10560265 3300025893 Bacteria 540
263 Ga0207692_10017370 3300025898 Bacteria 3208
264 Ga0207692_10019591 3300025898 Bacteria 3061
265 Ga0207692_10027502 3300025898 Bacteria 2680
266 Ga0207642_10280463 3300025899 Bacteria 958
267 Ga0207688_10542478 3300025901 Unclassified 730
268 Ga0207680_10381141 3300025903 Bacteria 994
269 Ga0207680_10396905 3300025903 Unclassified 974
270 Ga0207647_10194534 3300025904 Bacteria 1174
271 Ga0207685_10014481 3300025905 Bacteria 2470
272 Ga0207685_10070423 3300025905 Bacteria 1415
273 Ga0207699_10005940 3300025906 Bacteria 5874
274 Ga0207699_10009957 3300025906 Bacteria 4753
275 Ga0207699_10035914 3300025906 Unclassified 2822
276 Ga0207699_10090921 3300025906 Bacteria 1916
277 Ga0207699_10356473 3300025906 Bacteria 1033
278 Ga0207699_10731864 3300025906 Unclassified 725
279 Ga0207645_10074333 3300025907 Bacteria 2175
280 Ga0207684_10164937 3300025910 Bacteria 1908
281 Ga0207684_10317705 3300025910 Unclassified 1342
282 Ga0207654_10020947 3300025911 Bacteria 3472
283 Ga0207654_10048751 3300025911 Bacteria 2425
284 Ga0207654_10313899 3300025911 Bacteria 1070
285 Ga0207707_10841059 3300025912 Bacteria 762
286 Ga0207707_10863218 3300025912 Unclassified 750
287 Ga0207695_10033868 3300025913 Bacteria 5563
288 Ga0207695_10836350 3300025913 Bacteria 801
289 Ga0207671_10260555 3300025914 Bacteria 1365
290 Ga0207671_10651602 3300025914 Bacteria 839
291 Ga0207693_10000260 3300025915 Bacteria 48765
292 Ga0207693_10000361 3300025915 Bacteria 41703
293 Ga0207693_10039380 3300025915 Bacteria 3722
294 Ga0207693_10154389 3300025915 Bacteria 1806
295 Ga0207693_10449060 3300025915 Bacteria 1007
296 Ga0207693_10470732 3300025915 Bacteria 981
297 Ga0207663_10001257 3300025916 Bacteria 11746
298 Ga0207663_10001853 3300025916 Bacteria 9996
299 Ga0207663_10665333 3300025916 Bacteria 823
300 Ga0207663_10946234 3300025916 Bacteria 690
301 Ga0207660_11067087 3300025917 Bacteria 658
302 Ga0207660_11578270 3300025917 Bacteria 529
303 Ga0207662_10559504 3300025918 Unclassified 793
304 Ga0207662_10838375 3300025918 Bacteria 649
305 Ga0207657_10001005 3300025919 Bacteria 30014
306 Ga0207657_10004933 3300025919 Bacteria 14030
307 Ga0207649_11321860 3300025920 Bacteria 570
308 Ga0207652_10170164 3300025921 Bacteria 1955
309 Ga0207652_10593777 3300025921 Bacteria 993
310 Ga0207646_10014721 3300025922 Bacteria 7411
311 Ga0207646_10080246 3300025922 Bacteria 2917
312 Ga0207646_10155610 3300025922 Bacteria 2062
313 Ga0207646_10446725 3300025922 Bacteria 1167
314 Ga0207646_10600203 3300025922 Bacteria 988
315 Ga0207646_11198218 3300025922 Bacteria 666
316 Ga0207681_10284006 3300025923 Bacteria 1304
317 Ga0207681_11138119 3300025923 Unclassified 655
318 Ga0207694_10114226 3300025924 Bacteria 2150
319 Ga0207694_10224670 3300025924 Bacteria 1532
320 Ga0207659_11445831 3300025926 Bacteria 589
321 Ga0207687_10001015 3300025927 Bacteria 19072
322 Ga0207700_10000163 3300025928 Bacteria 39724
323 Ga0207700_10002135 3300025928 Bacteria 11317
324 Ga0207700_10054109 3300025928 Bacteria 3011
325 Ga0207700_10917350 3300025928 Bacteria 784
326 Ga0207700_11514553 3300025928 Unclassified 595
327 Ga0207664_10000017 3300025929 Bacteria 230967
328 Ga0207664_10011887 3300025929 Bacteria 6210
329 Ga0207664_10060999 3300025929 Bacteria 3007
330 Ga0207664_10102678 3300025929 Bacteria 2365
331 Ga0207664_10237332 3300025929 Unclassified 1587
332 Ga0207664_10286985 3300025929 Bacteria 1445
333 Ga0207664_11924299 3300025929 Unclassified 514
334 Ga0207644_11342241 3300025931 Bacteria 601
335 Ga0207644_11435432 3300025931 Bacteria 580
336 Ga0207690_10135703 3300025932 Bacteria 1806
337 Ga0207690_10485846 3300025932 Bacteria 997
338 Ga0207706_10001614 3300025933 Bacteria 22381
339 Ga0207706_10001800 3300025933 Bacteria 21070
340 Ga0207686_10062214 3300025934 Bacteria 2369
341 Ga0207709_10300640 3300025935 Bacteria 1193
342 Ga0207670_10275987 3300025936 Bacteria 1308
343 Ga0207669_10380341 3300025937 Unclassified 1100
344 Ga0207704_10190206 3300025938 Bacteria 1492
345 Ga0207665_10006400 3300025939 Bacteria 7812
346 Ga0207665_10024674 3300025939 Bacteria 3965
347 Ga0207665_10149385 3300025939 Bacteria 1672
348 Ga0207665_10446910 3300025939 Bacteria 991
349 Ga0207691_10710830 3300025940 Bacteria 847
350 Ga0207711_10000749 3300025941 Bacteria 31810
351 Ga0207711_10160340 3300025941 Bacteria 2035
352 Ga0207711_10762229 3300025941 Bacteria 902
353 Ga0207689_10011470 3300025942 Bacteria 7596
354 Ga0207661_11051358 3300025944 Bacteria 750
355 Ga0207661_11202784 3300025944 Unclassified 697
356 Ga0207679_10150309 3300025945 Bacteria 1894
357 Ga0207667_10005625 3300025949 Bacteria 15289
358 Ga0207667_10385124 3300025949 Bacteria 1428
359 Ga0207712_10089845 3300025961 Bacteria 2259
360 Ga0207712_10998321 3300025961 Bacteria 743
361 Ga0207668_10005927 3300025972 Bacteria 7200
362 Ga0207668_10415794 3300025972 Bacteria 1140
363 Ga0207640_10034514 3300025981 Bacteria 3158
364 Ga0207658_10230443 3300025986 Bacteria 1563
365 Ga0207658_11766699 3300025986 Bacteria 564
366 Ga0207677_10209495 3300026023 Bacteria 1555
367 Ga0207677_10487663 3300026023 Bacteria 1063
368 Ga0207703_10034960 3300026035 Bacteria 3991
369 Ga0207703_10092276 3300026035 Bacteria 2548
370 Ga0207639_10193474 3300026041 Unclassified 1739
371 Ga0207639_10557723 3300026041 Bacteria 1052
372 Ga0207678_10000103 3300026067 Bacteria 69649
373 Ga0207678_10007271 3300026067 Bacteria 9816
374 Ga0207708_10088057 3300026075 Bacteria 2391
375 Ga0207708_12052746 3300026075 Unclassified 500
376 Ga0207702_10066120 3300026078 Bacteria 3098
377 Ga0207702_10105088 3300026078 Bacteria 2500
378 Ga0207702_10189193 3300026078 Bacteria 1901
379 Ga0207648_10012823 3300026089 Bacteria 7831
380 Ga0207648_10015577 3300026089 Bacteria 6985
381 Ga0207676_10270470 3300026095 Bacteria 1539
382 Ga0207674_10003553 3300026116 Bacteria 19023
383 Ga0207674_10053999 3300026116 Bacteria 4093
384 Ga0207675_101179266 3300026118 Bacteria 786
385 Ga0207683_10009712 3300026121 Bacteria 8207
386 Ga0207683_10197376 3300026121 Bacteria 1829
387 Ga0207683_10578459 3300026121 Unclassified 1039
388 Ga0207698_10707440 3300026142 Bacteria 1003
389 Ga0265358_102106 3300028010 Unclassified 654
390 Ga0265354_1008972 3300028016 Unclassified 961
391 Ga0265356_1000246 3300028017 Bacteria 10178
392 Ga0265355_1001362 3300028036 Bacteria 1571
393 Ga0265355_1008938 3300028036 Unclassified 806
394 Ga0268266_10049093 3300028379 Bacteria 3618
395 Ga0268265_10008142 3300028380 Bacteria 7084
396 Ga0268265_10354410 3300028380 Bacteria 1341
397 Ga0268264_10158904 3300028381 Bacteria 2034
398 Ga0268264_10862717 3300028381 Unclassified 907
399 Ga0265338_10003670 3300028800 Bacteria 21390
400 Ga0265338_10725511 3300028800 Unclassified 684
401 Ga0265762_1005202 3300030760 Bacteria 2331
402 Ga0265762_1029771 3300030760 Unclassified 1033
403 Ga0265760_10000189 3300031090 Bacteria 16199
404 Ga0265760_10015485 3300031090 Bacteria 2186
405 Ga0265760_10060404 3300031090 Unclassified 1151
406 Ga0265340_10034670 3300031247 Bacteria 2509
407 Ga0265339_10047169 3300031249 Bacteria 2366
408 Ga0265339_10071983 3300031249 Bacteria 1840
409 Ga0265339_10098371 3300031249 Bacteria 1526
410 Ga0265316_10048087 3300031344 Bacteria 3371
411 Ga0265316_10113741 3300031344 Bacteria 2048
412 Ga0265314_10440349 3300031711 Unclassified 696
413 Ga0316212_1005333 3300033547 Bacteria 1868
414 Ga0373930_0023930 3300034816 Bacteria 1218
415 Ga0373958_0053952 3300034819 Bacteria 855
416 Ga0373938_0182966 3300034957 Unclassified 573
417 Ga0373926_0208715 3300035083 Unclassified 752
418 Ga0373926_0280066 3300035083 Bacteria 649
419 Ga0373934_0146042 3300035086 Unclassified 968
420 Ga0373940_0038705 3300035088 Bacteria 1303
421 Ga0373940_0239111 3300035088 Bacteria 609
422 Ga0373944_0088009 3300035089 Bacteria 1034
423 Ga0373944_0240180 3300035089 Bacteria 666
424 Ga0373923_0388481 3300035111 Unclassified 670
425 Ga0373923_0523712 3300035111 Unclassified 579
426 Ga0373923_0600066 3300035111 Unclassified 542
427 Ga0373936_0014893 3300035113 Bacteria 2976
428 Ga0373936_0050895 3300035113 Bacteria 1676
429 Ga0373941_0207842 3300035115 Unclassified 747
430 Ga0373945_0024728 3300035116 Bacteria 2083
431 Ga0373945_0040776 3300035116 Unclassified 1677
432 Ga0373956_0123337 3300035119 Unclassified 1211
433 Ga0373943_0001229 3300035170 Bacteria 11455
434 Ga0373943_0065439 3300035170 Unclassified 1828
435 Ga0373946_0011402 3300035171 Bacteria 3316
436 Ga0373946_0520989 3300035171 Unclassified 611
437 Ga0373962_0155160 3300035242 Unclassified 752
438 Ga0373931_0046276 3300035691 Bacteria 2299
439 Ga0373935_0026106 3300035692 Bacteria 3602
440 Ga0373927_0060057 3300035695 Bacteria 2459
441 Ga0373927_0704377 3300035695 Bacteria 667
442 Ga0373933_0038645 3300035724 Bacteria 2805
443 Ga0373947_0215157 3300035725 Unclassified 1261
444 Ga0373947_0467403 3300035725 Unclassified 855
445 Ga0373947_0930388 3300035725 Unclassified 593
446 Ga0373947_1196753 3300035725 Bacteria 517
447 Ga0373937_0678452 3300036401 Unclassified 976
448 Ga0265778_020470 3300036457 Bacteria 814
449 Ga0373925_0004323 3300037068 Bacteria 10754
450 Ga0373925_0020365 3300037068 Bacteria 4828
451 Ga0373925_0047413 3300037068 Bacteria 3198
452 Ga0373925_0068076 3300037068 Bacteria 2686
453 Ga0373925_0600272 3300037068 Bacteria 907
454 Ga0373925_1559634 3300037068 Unclassified 540
455 Ga0395900_1912598 3300037418 Unclassified 504
456 Ga0436362_0374447 3300039453 Unclassified 1231
457 Ga0439448_0091672 3300042005 Bacteria 1027
458 Ga0439458_0194820 3300042157 Bacteria 553
459 Ga0451577_0003187 3300042876 Bacteria 18440
460 Ga0453683_0403318 3300044673 Unclassified 881
461 Ga0453683_0602390 3300044673 Unclassified 716
462 Ga0453684_0000289 3300044712 Bacteria 215476
463 Ga0451576_0009204 3300045051 Bacteria 11477
464 Ga0495603_0141013 3300046455 Bacteria 1402
465 Ga0495629_0006642 3300046459 Bacteria 8560
466 Ga0495653_0558138 3300046463 Unclassified 708
467 Ga0495580_0000491 3300046472 Bacteria 33040
468 Ga0495580_0006771 3300046472 Bacteria 9291
469 Ga0495580_0008704 3300046472 Bacteria 8047
470 Ga0495580_0040986 3300046472 Bacteria 3305
471 Ga0495580_0050895 3300046472 Bacteria 2928
472 Ga0495580_0766134 3300046472 Unclassified 628
473 Ga0495582_0020001 3300046473 Bacteria 3661
474 Ga0495582_0065872 3300046473 Bacteria 2001
475 Ga0495582_0467799 3300046473 Bacteria 728
476 Ga0495639_0041887 3300046475 Bacteria 2064
477 Ga0495584_0205152 3300046491 Unclassified 1002
478 Ga0495594_0304246 3300046499 Bacteria 908
479 Ga0495630_0073766 3300046517 Unclassified 2570
480 Ga0495630_0214014 3300046517 Bacteria 1471
481 Ga0495666_0222081 3300046526 Unclassified 865
482 Ga0495665_0019767 3300046531 Bacteria 3622
483 Ga0495645_0058603 3300046543 Bacteria 2794
484 Ga0495667_0337009 3300046559 Bacteria 954
485 Ga0495634_0766599 3300046642 Bacteria 552
486 Ga0495635_0346219 3300046663 Bacteria 992
487 Ga0495635_0614573 3300046663 Unclassified 709
488 Ga0495657_0091793 3300046675 Unclassified 1947
489 Ga0495669_0200409 3300046684 Bacteria 954
490 Ga0495669_0495713 3300046684 Unclassified 594
491 Ga0495581_0402845 3300047315 Unclassified 798
492 Ga0495674_0243497 3300047319 Bacteria 1481
493 Ga0495684_0390001 3300047471 Bacteria 980
494 Ga0495684_0441276 3300047471 Bacteria 906
495 Ga0495593_0091094 3300047673 Bacteria 1570
496 Ga0495614_0281046 3300048089 Unclassified 766
497 Ga0496100_0061933 3300048903 Bacteria 2467
498 Ga0496100_0176464 3300048903 Bacteria 1543
499 Ga0496100_0201767 3300048903 Bacteria 1450
500 Ga0496100_1237905 3300048903 Bacteria 589
501 Ga0496101_0099415 3300048904 Bacteria 2175
502 Ga0496101_0400109 3300048904 Bacteria 1081
503 Ga0496101_1388732 3300048904 Unclassified 548
504 Ga0496102_0094813 3300048905 Bacteria 2765
505 Ga0496102_0578523 3300048905 Bacteria 1046
506 Ga0496103_0091979 3300048906 Bacteria 1915
507 Ga0496104_0090427 3300048907 Bacteria 2925
508 Ga0496105_0069214 3300048908 Bacteria 2917
509 Ga0496105_0414164 3300048908 Bacteria 1068
510 Ga0496106_0668348 3300048909 Bacteria 829
511 Ga0496107_0351660 3300048910 Bacteria 1097
512 Ga0496107_0603864 3300048910 Bacteria 811
513 Ga0496109_1337762 3300048912 Unclassified 652
514 Ga0496110_1417551 3300048913 Bacteria 604
515 Ga0496112_0271270 3300048915 Bacteria 1645
516 Ga0496112_0385845 3300048915 Bacteria 1341
517 Ga0496113_0045985 3300048916 Bacteria 3240
518 Ga0496114_0225387 3300048917 Bacteria 1646
519 Ga0496115_0003320 3300048918 Bacteria 11553
520 Ga0496115_0051504 3300048918 Bacteria 3301
521 Ga0496115_0163508 3300048918 Bacteria 1840
522 Ga0496115_0698763 3300048918 Bacteria 797
523 Ga0501071_0711156 3300049587 Bacteria 774
524 Ga0501074_0193302 3300049590 Bacteria 1451
525 Ga0501081_0832355 3300049743 Unclassified 695
526 Ga0501045_1393896 3300049824 Bacteria 509
527 nmdc:mga05p37_1796329_c1 3300050507 Unclassified 592
528 nmdc:mga05p37_324415_c1 3300050507 Bacteria 994
529 nmdc:mga0qj67_32297_c1 3300050509 Unclassified 4081
530 nmdc:mga06r32_53633_c1 3300050510 Unclassified 3863
531 nmdc:mga0n895_3164_c1 3300050512 Bacteria 13154
532 nmdc:mga0rr50_1195_c1 3300050513 Bacteria 14098
533 nmdc:mga0rr50_34823_c1 3300050513 Bacteria 3609
534 nmdc:mga08x19_11236_c1 3300050514 Bacteria 5390
535 nmdc:mga08x19_27404_c1 3300050514 Bacteria 3564
536 nmdc:mga0a205_3953_c2 3300050515 Bacteria 10912
537 Ga0495601_0026708 3300053077 Bacteria 3567
538 Ga0495595_0509867 3300053084 Bacteria 613
539 Ga0495619_0654812 3300053085 Unclassified 716
540 Ga0265355_1008664
541 LJNas_1000481
542 Ga0065712_10223021
543 Ga0065712_10774454
544 Ga0070676_10094392
545 Ga0070676_10151251
546 Ga0070683_100036148
547 Ga0070683_102175864
548 Ga0070690_100033300
549 Ga0070690_100294601
550 Ga0070677_10806939
551 Ga0068869_100021355
552 Ga0068869_100347319
553 Ga0070666_10078961
554 Ga0070680_100117388
555 Ga0070680_100186089
556 Ga0070682_100217160
557 Ga0068868_100046008
558 Ga0068868_100067305
559 Ga0068868_101295768
560 Ga0070660_100035322
561 Ga0070689_100354123
562 Ga0070691_10030964
563 Ga0070691_10241753
564 Ga0070687_100403751
565 Ga0070687_100751057
566 Ga0070661_100006404
567 Ga0070668_100004795
568 Ga0070668_100178014
569 Ga0070669_100086284
570 Ga0070675_100219380
571 Ga0070674_100414341
572 Ga0070674_100775760
573 Ga0070688_100319340
574 Ga0070659_100028991
575 Ga0070659_100033226
576 Ga0070667_100033097
577 Ga0070667_100176807
578 Ga0070703_10431567
579 Ga0070709_10006667
580 Ga0070709_10008132
581 Ga0070709_10131157
582 Ga0070709_10178716
583 Ga0070709_10305083
584 Ga0070714_100000071
585 Ga0070714_100010637
586 Ga0070714_100058059
587 Ga0070714_100059942
588 Ga0070714_100245696
589 Ga0070714_101709395
590 Ga0070713_100000176
591 Ga0070713_100000672
592 Ga0070713_100021362
593 Ga0070713_100938585
594 Ga0070713_101044878
595 Ga0070713_101789077
596 Ga0070713_101791951
597 Ga0070713_102474209
598 Ga0070710_10010374
599 Ga0070710_10033288
600 Ga0070710_10438365
601 Ga0070710_10512791
602 Ga0070701_10540293
603 Ga0070711_100001635
604 Ga0070711_100006078
605 Ga0070711_100236497
606 Ga0070711_100713523
607 Ga0070700_100177591
608 Ga0070708_100014715
609 Ga0070708_100015361
610 Ga0070708_100226919
611 Ga0070708_100766321
612 Ga0070708_100778462
613 Ga0070708_101995639
614 Ga0070663_100018760
615 Ga0070663_100408349
616 Ga0070663_100499836
617 Ga0070678_100027051
618 Ga0070678_100538229
619 Ga0070662_100008569
620 Ga0070681_10128443
621 Ga0070681_11024649
622 Ga0068867_100122879
623 Ga0070706_100164232
624 Ga0070706_100452288
625 Ga0070707_100010261
626 Ga0070707_100045424
627 Ga0070707_100096369
628 Ga0070707_100156538
629 Ga0070707_100452578
630 Ga0070707_101536357
631 Ga0070698_100068665
632 Ga0070698_100909280
633 Ga0070679_100107999
634 Ga0070679_100289794
635 Ga0070684_100015758
636 Ga0070697_100234594
637 Ga0070697_100855355
638 Ga0070697_102006185
639 Ga0068853_100074018
640 Ga0068853_100086870
641 Ga0070686_100014356
642 Ga0070686_100552320
643 Ga0070695_100229057
644 Ga0070695_100246656
645 Ga0070696_100035762
646 Ga0070693_100425267
647 Ga0070665_100019561
648 Ga0070665_100283912
649 Ga0070704_100262299
650 Ga0070704_100321692
651 Ga0068855_100420303
652 Ga0068855_100628506
653 Ga0068855_101987380
654 Ga0070664_100061092
655 Ga0070664_100315468
656 Ga0068857_100115679
657 Ga0068857_101268521
658 Ga0068854_100011622
659 Ga0068854_100094219
660 Ga0068856_100033058
661 Ga0068856_100063104
662 Ga0070702_100248805
663 Ga0070702_100759551
664 Ga0068852_102182117
665 Ga0068859_100107862
666 Ga0068859_100141499
667 Ga0068864_100306172
668 Ga0068864_100378835
669 Ga0068866_10040683
670 Ga0068866_10068451
671 Ga0068861_100096094
672 Ga0068861_102335347
673 Ga0068851_10037216
674 Ga0068851_10065010
675 Ga0068863_102576076
676 Ga0068858_100036947
677 Ga0068858_100458149
678 Ga0068860_100085701
679 Ga0068862_100025562
680 Ga0070717_10004715
681 Ga0070717_10011654
682 Ga0070717_10077935
683 Ga0070717_10115792
684 Ga0070715_10008109
685 Ga0070715_10022796
686 Ga0070715_10100037
687 Ga0070715_11027642
688 Ga0070716_100002367
689 Ga0070716_100009543
690 Ga0070716_100406410
691 Ga0070716_100784432
692 Ga0070712_100000421
693 Ga0070712_100000464
694 Ga0070712_100018122
695 Ga0070712_100420700
696 Ga0070712_100863544
697 Ga0097621_100072151
698 Ga0097621_100141044
699 Ga0097621_100156642
700 Ga0097621_100184807
701 Ga0068871_100026743
702 Ga0068871_100079005
703 Ga0068871_100186565
704 Ga0068871_101412430
705 Ga0068871_101556610
706 Ga0075430_100019840
707 Ga0075431_100020509
708 Ga0075433_10001388
709 Ga0075434_100000201
710 Ga0075429_100813170
711 Ga0068865_100880082
712 Ga0068865_100998779
713 Ga0068865_102212619
714 Ga0075436_100005849
715 Ga0075436_101544523
716 Ga0097620_100107857
717 Ga0097620_100141506
718 Ga0075435_100000888
719 Ga0075435_100045124
720 Ga0075435_100844079
721 Ga0099794_10129360
722 Ga0099795_10026884
723 Ga0105240_10050824
724 Ga0105240_11526075
725 Ga0105245_10343522
726 Ga0105245_10638015
727 Ga0105247_10067087
728 Ga0105247_10109508
729 Ga0114129_10093002
730 Ga0114129_11801314
731 Ga0105243_10032244
732 Ga0105243_10033010
733 Ga0105243_11369286
734 Ga0105241_10170006
735 Ga0105241_10176483
736 Ga0105241_11227337
737 Ga0105241_11441547
738 Ga0105242_10017393
739 Ga0105242_10328584
740 Ga0105248_10097356
741 Ga0105248_10701140
742 Ga0105248_12810471
743 Ga0105237_10843121
744 Ga0105237_12553301
745 Ga0105238_10609944
746 Ga0105238_10852071
747 Ga0105238_12114602
748 Ga0105238_12119960
749 Ga0105249_10008176
750 Ga0105249_10012029
751 Ga0099796_10188121
752 Ga0105239_10876288
753 Ga0105246_10017179
754 Ga0105246_10397260
755 Ga0157373_10170038
756 Ga0157373_10519273
757 Ga0157371_10054168
758 Ga0157371_10100079
759 Ga0157370_10480614
760 Ga0157370_11461940
761 Ga0157369_10077941
762 Ga0157374_10002857
763 Ga0157374_10136354
764 Ga0157374_10329048
765 Ga0157374_11609844
766 Ga0157378_10001150
767 Ga0157378_10012085
768 Ga0157378_10670407
769 Ga0157378_10841228
770 Ga0157378_11046618
771 Ga0157378_11407233
772 Ga0163162_10036046
773 Ga0163162_10619837
774 Ga0157372_10112911
775 Ga0157372_10149576
776 Ga0157375_10088289
777 Ga0157375_10751234
778 Ga0163163_10440776
779 Ga0163163_10700535
780 Ga0163163_11381520
781 Ga0157379_10075023
782 Ga0157379_10082248
783 Ga0157376_10004594
784 Ga0157376_10063825
785 Ga0157376_10116489
786 Ga0157376_10120502
787 Ga0157376_10372012
788 Ga0157376_11167645
789 Ga0163161_10697737
790 Ga0224570_101847
791 Ga0224569_105659
792 Ga0224569_106979
793 Ga0228598_1015452
794 Ga0228598_1028815
795 Ga0228598_1049930
796 Ga0228598_1127676
797 Ga0207697_10106795
798 Ga0207697_10116603
799 Ga0207656_10036532
800 Ga0207656_10217649
801 Ga0207682_10560265
802 Ga0207692_10017370
803 Ga0207692_10019591
804 Ga0207692_10027502
805 Ga0207642_10280463
806 Ga0207688_10542478
807 Ga0207680_10381141
808 Ga0207680_10396905
809 Ga0207647_10194534
810 Ga0207685_10014481
811 Ga0207685_10070423
812 Ga0207699_10005940
813 Ga0207699_10009957
814 Ga0207699_10035914
815 Ga0207699_10090921
816 Ga0207699_10356473
817 Ga0207699_10731864
818 Ga0207645_10074333
819 Ga0207684_10164937
820 Ga0207684_10317705
821 Ga0207654_10020947
822 Ga0207654_10048751
823 Ga0207654_10313899
824 Ga0207707_10841059
825 Ga0207707_10863218
826 Ga0207695_10033868
827 Ga0207695_10836350
828 Ga0207671_10260555
829 Ga0207671_10651602
830 Ga0207693_10000260
831 Ga0207693_10000361
832 Ga0207693_10039380
833 Ga0207693_10154389
834 Ga0207693_10449060
835 Ga0207693_10470732
836 Ga0207663_10001257
837 Ga0207663_10001853
838 Ga0207663_10665333
839 Ga0207663_10946234
840 Ga0207660_11067087
841 Ga0207660_11578270
842 Ga0207662_10559504
843 Ga0207662_10838375
844 Ga0207657_10001005
845 Ga0207657_10004933
846 Ga0207649_11321860
847 Ga0207652_10170164
848 Ga0207652_10593777
849 Ga0207646_10014721
850 Ga0207646_10080246
851 Ga0207646_10155610
852 Ga0207646_10446725
853 Ga0207646_10600203
854 Ga0207646_11198218
855 Ga0207681_10284006
856 Ga0207681_11138119
857 Ga0207694_10114226
858 Ga0207694_10224670
859 Ga0207659_11445831
860 Ga0207687_10001015
861 Ga0207700_10000163
862 Ga0207700_10002135
863 Ga0207700_10054109
864 Ga0207700_10917350
865 Ga0207700_11514553
866 Ga0207664_10000017
867 Ga0207664_10011887
868 Ga0207664_10060999
869 Ga0207664_10102678
870 Ga0207664_10237332
871 Ga0207664_10286985
872 Ga0207664_11924299
873 Ga0207644_11342241
874 Ga0207644_11435432
875 Ga0207690_10135703
876 Ga0207690_10485846
877 Ga0207706_10001614
878 Ga0207706_10001800
879 Ga0207686_10062214
880 Ga0207709_10300640
881 Ga0207670_10275987
882 Ga0207669_10380341
883 Ga0207704_10190206
884 Ga0207665_10006400
885 Ga0207665_10024674
886 Ga0207665_10149385
887 Ga0207665_10446910
888 Ga0207691_10710830
889 Ga0207711_10000749
890 Ga0207711_10160340
891 Ga0207711_10762229
892 Ga0207689_10011470
893 Ga0207661_11051358
894 Ga0207661_11202784
895 Ga0207679_10150309
896 Ga0207667_10005625
897 Ga0207667_10385124
898 Ga0207712_10089845
899 Ga0207712_10998321
900 Ga0207668_10005927
901 Ga0207668_10415794
902 Ga0207640_10034514
903 Ga0207658_10230443
904 Ga0207658_11766699
905 Ga0207677_10209495
906 Ga0207677_10487663
907 Ga0207703_10034960
908 Ga0207703_10092276
909 Ga0207639_10193474
910 Ga0207639_10557723
911 Ga0207678_10000103
912 Ga0207678_10007271
913 Ga0207708_10088057
914 Ga0207708_12052746
915 Ga0207702_10066120
916 Ga0207702_10105088
917 Ga0207702_10189193
918 Ga0207648_10012823
919 Ga0207648_10015577
920 Ga0207676_10270470
921 Ga0207674_10003553
922 Ga0207674_10053999
923 Ga0207675_101179266
924 Ga0207683_10009712
925 Ga0207683_10197376
926 Ga0207683_10578459
927 Ga0207698_10707440
928 Ga0265358_102106
929 Ga0265354_1008972
930 Ga0265356_1000246
931 Ga0265355_1001362
932 Ga0265355_1008938
933 Ga0268266_10049093
934 Ga0268265_10008142
935 Ga0268265_10354410
936 Ga0268264_10158904
937 Ga0268264_10862717
938 Ga0265338_10003670
939 Ga0265338_10725511
940 Ga0265762_1005202
941 Ga0265762_1029771
942 Ga0265760_10000189
943 Ga0265760_10015485
944 Ga0265760_10060404
945 Ga0265340_10034670
946 Ga0265339_10047169
947 Ga0265339_10071983
948 Ga0265339_10098371
949 Ga0265316_10048087
950 Ga0265316_10113741
951 Ga0265314_10440349
952 Ga0316212_1005333
953 Ga0373930_0023930
954 Ga0373958_0053952
955 Ga0373938_0182966
956 Ga0373926_0208715
957 Ga0373926_0280066
958 Ga0373934_0146042
959 Ga0373940_0038705
960 Ga0373940_0239111
961 Ga0373944_0088009
962 Ga0373944_0240180
963 Ga0373923_0388481
964 Ga0373923_0523712
965 Ga0373923_0600066
966 Ga0373936_0014893
967 Ga0373936_0050895
968 Ga0373941_0207842
969 Ga0373945_0024728
970 Ga0373945_0040776
971 Ga0373956_0123337
972 Ga0373943_0001229
973 Ga0373943_0065439
974 Ga0373946_0011402
975 Ga0373946_0520989
976 Ga0373962_0155160
977 Ga0373931_0046276
978 Ga0373935_0026106
979 Ga0373927_0060057
980 Ga0373927_0704377
981 Ga0373933_0038645
982 Ga0373947_0215157
983 Ga0373947_0467403
984 Ga0373947_0930388
985 Ga0373947_1196753
986 Ga0373937_0678452
987 Ga0265778_020470
988 Ga0373925_0004323
989 Ga0373925_0020365
990 Ga0373925_0047413
991 Ga0373925_0068076
992 Ga0373925_0600272
993 Ga0373925_1559634
994 Ga0395900_1912598
995 Ga0436362_0374447
996 Ga0439448_0091672
997 Ga0439458_0194820
998 Ga0451577_0003187
999 Ga0453683_0403318
1000 Ga0453683_0602390
1001 Ga0453684_0000289
1002 Ga0451576_0009204
1003 Ga0495603_0141013
1004 Ga0495629_0006642
1005 Ga0495653_0558138
1006 Ga0495580_0000491
1007 Ga0495580_0006771
1008 Ga0495580_0008704
1009 Ga0495580_0040986
1010 Ga0495580_0050895
1011 Ga0495580_0766134
1012 Ga0495582_0020001
1013 Ga0495582_0065872
1014 Ga0495582_0467799
1015 Ga0495639_0041887
1016 Ga0495584_0205152
1017 Ga0495594_0304246
1018 Ga0495630_0073766
1019 Ga0495630_0214014
1020 Ga0495666_0222081
1021 Ga0495665_0019767
1022 Ga0495645_0058603
1023 Ga0495667_0337009
1024 Ga0495634_0766599
1025 Ga0495635_0346219
1026 Ga0495635_0614573
1027 Ga0495657_0091793
1028 Ga0495669_0200409
1029 Ga0495669_0495713
1030 Ga0495581_0402845
1031 Ga0495674_0243497
1032 Ga0495684_0390001
1033 Ga0495684_0441276
1034 Ga0495593_0091094
1035 Ga0495614_0281046
1036 Ga0496100_0061933
1037 Ga0496100_0176464
1038 Ga0496100_0201767
1039 Ga0496100_1237905
1040 Ga0496101_0099415
1041 Ga0496101_0400109
1042 Ga0496101_1388732
1043 Ga0496102_0094813
1044 Ga0496102_0578523
1045 Ga0496103_0091979
1046 Ga0496104_0090427
1047 Ga0496105_0069214
1048 Ga0496105_0414164
1049 Ga0496106_0668348
1050 Ga0496107_0351660
1051 Ga0496107_0603864
1052 Ga0496109_1337762
1053 Ga0496110_1417551
1054 Ga0496112_0271270
1055 Ga0496112_0385845
1056 Ga0496113_0045985
1057 Ga0496114_0225387
1058 Ga0496115_0003320
1059 Ga0496115_0051504
1060 Ga0496115_0163508
1061 Ga0496115_0698763
1062 Ga0501071_0711156
1063 Ga0501074_0193302
1064 Ga0501081_0832355
1065 Ga0501045_1393896
1066 nmdc:mga05p37_1796329_c1
1067 nmdc:mga05p37_324415_c1
1068 nmdc:mga0qj67_32297_c1
1069 nmdc:mga06r32_53633_c1
1070 nmdc:mga0n895_3164_c1
1071 nmdc:mga0rr50_1195_c1
1072 nmdc:mga0rr50_34823_c1
1073 nmdc:mga08x19_11236_c1
1074 nmdc:mga08x19_27404_c1
1075 nmdc:mga0a205_3953_c2
1076 Ga0495601_0026708
1077 Ga0495595_0509867
1078 Ga0495619_0654812

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map