F461074

General Info

Members Datasets Scaffolds Average Seq Length
538 270 1076 290

Family's Representative Sequence

Representative Sequence 3300053077|Ga0495601_0209363|Ga0495601_0209363_209_1258
Length 349
Sequence VDLATLSLVNHGAELPGTSLEAEVEGVMSVATPDGLRRFHELNDQAPEAKRIDEREGDIVKLGLHLPDFTWPNGPSGLGADLGAVARAADDAGFDRMSVMDHVWQIGNVGPPEHEMLEAYTTLGFLAAHTTRIKLLTLVTGIVYREPGLLAKMVTTLDVLSGGRAMAGVGAAWNEQESRGLGLPFPPTAERFERLEEALQILQQMWNDTDTPFTGNHYRLGRTLNSPQALSKPQPPILIGGSGERKTLRLVARYAQACNLFPGPDLGHKLDVLRRHCENEGRDYDEIEKTTLFNFDVGPDGERVPETIDGLRQLAEQGFQVGHGRVADVWQITPLEIIGREVLPAVADL

Samples

Sample ID Description Type Environment
1 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
124 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
125 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
127 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
137 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
138 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
139 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
140 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
141 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
142 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
143 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
144 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
145 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
146 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
147 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
148 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
149 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
152 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
154 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
157 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
176 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
180 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
193 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
213 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
214 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
243 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
244 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
245 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
246 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
247 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
248 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
249 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
260 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
261 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
262 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
263 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
264 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
265 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
266 2643221679 Angustibacter sp. Root456 Isolate Unclassified
267 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
268 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
269 2891562705 Microbispora tritici MT50 Isolate Unclassified
270 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.21
Metatranscriptomes 1.86
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.74
Nodule 0
Rhizoplane 7.25
Rhizosphere 88.66
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495601_0209363 3300053077 Bacteria 1274
2 JGI25406J46586_10008317 3300003203 Bacteria 4706
3 Ga0070658_10010175 3300005327 Bacteria 7545
4 Ga0070658_10073379 3300005327 Bacteria 2806
5 Ga0070680_100050102 3300005336 Bacteria 3405
6 Ga0068868_100318212 3300005338 Bacteria 1325
7 Ga0070660_100446841 3300005339 Bacteria 1072
8 Ga0070691_10049379 3300005341 Bacteria 2004
9 Ga0070661_100037644 3300005344 Bacteria 3519
10 Ga0070675_100132550 3300005354 Bacteria 2124
11 Ga0070673_100004845 3300005364 Bacteria 8562
12 Ga0070667_100051499 3300005367 Bacteria 3472
13 Ga0070709_10131813 3300005434 Bacteria 1707
14 Ga0070714_100006417 3300005435 Bacteria 9084
15 Ga0070714_100023325 3300005435 Bacteria 5082
16 Ga0070714_100142265 3300005435 Bacteria 2154
17 Ga0070713_100016548 3300005436 Bacteria 5545
18 Ga0070713_100026862 3300005436 Bacteria 4526
19 Ga0070713_100033242 3300005436 Bacteria 4129
20 Ga0070710_10000336 3300005437 Bacteria 22360
21 Ga0070711_100005243 3300005439 Bacteria 7733
22 Ga0070705_100094900 3300005440 Bacteria 1869
23 Ga0070694_100027474 3300005444 Bacteria 3695
24 Ga0070694_100443169 3300005444 Bacteria 1024
25 Ga0070708_100041365 3300005445 Bacteria 4040
26 Ga0070708_100047992 3300005445 Bacteria 3774
27 Ga0070708_100049980 3300005445 Bacteria 3700
28 Ga0070708_100104824 3300005445 Bacteria 2593
29 Ga0070663_100026575 3300005455 Bacteria 3922
30 Ga0070678_100085129 3300005456 Bacteria 2408
31 Ga0070681_10096162 3300005458 Bacteria 2910
32 Ga0070685_10023010 3300005466 Bacteria 3406
33 Ga0070706_100037923 3300005467 Bacteria 4449
34 Ga0070706_100086697 3300005467 Bacteria 2901
35 Ga0070706_100126907 3300005467 Bacteria 2379
36 Ga0070706_100455415 3300005467 Bacteria 1190
37 Ga0070707_100005661 3300005468 Bacteria 11669
38 Ga0070707_100010434 3300005468 Bacteria 8651
39 Ga0070707_100013020 3300005468 Bacteria 7772
40 Ga0070707_100033553 3300005468 Bacteria 4895
41 Ga0070707_100055613 3300005468 Bacteria 3794
42 Ga0070707_100056390 3300005468 Bacteria 3769
43 Ga0070707_100140128 3300005468 Bacteria 2354
44 Ga0070707_100400502 3300005468 Bacteria 1332
45 Ga0070707_100579060 3300005468 Bacteria 1085
46 Ga0070698_100000355 3300005471 Bacteria 47387
47 Ga0070698_100007881 3300005471 Bacteria 11528
48 Ga0070698_100024934 3300005471 Bacteria 6234
49 Ga0070698_100040689 3300005471 Bacteria 4775
50 Ga0070699_100022201 3300005518 Bacteria 5467
51 Ga0070699_100045446 3300005518 Bacteria 3800
52 Ga0070699_100249370 3300005518 Bacteria 1586
53 Ga0070684_100239963 3300005535 Bacteria 1656
54 Ga0070684_100272890 3300005535 Bacteria 1548
55 Ga0070697_100043348 3300005536 Bacteria 3643
56 Ga0068853_100076455 3300005539 Bacteria 2923
57 Ga0070695_100290975 3300005545 Bacteria 1204
58 Ga0070696_100008249 3300005546 Bacteria 6972
59 Ga0070693_100010861 3300005547 Bacteria 4572
60 Ga0068855_100001083 3300005563 Bacteria 33850
61 Ga0068855_100043992 3300005563 Bacteria 5287
62 Ga0068855_100142149 3300005563 Bacteria 2734
63 Ga0068855_100190330 3300005563 Bacteria 2315
64 Ga0068855_100220195 3300005563 Bacteria 2129
65 Ga0070664_100082579 3300005564 Bacteria 2771
66 Ga0068857_100119858 3300005577 Bacteria 2368
67 Ga0068856_100029337 3300005614 Bacteria 5374
68 Ga0068856_100060015 3300005614 Bacteria 3757
69 Ga0068856_100127121 3300005614 Bacteria 2552
70 Ga0068856_100143904 3300005614 Bacteria 2392
71 Ga0070702_100007162 3300005615 Bacteria 5328
72 Ga0068859_100043164 3300005617 Bacteria 4531
73 Ga0068859_100407366 3300005617 Bacteria 1456
74 Ga0068864_100210743 3300005618 Bacteria 1789
75 Ga0068864_100225875 3300005618 Bacteria 1729
76 Ga0068866_10013180 3300005718 Bacteria 3620
77 Ga0068870_10008358 3300005840 Bacteria 4655
78 Ga0068863_100058322 3300005841 Bacteria 3653
79 Ga0068863_100090343 3300005841 Bacteria 2904
80 Ga0068863_100149744 3300005841 Bacteria 2233
81 Ga0068858_100048198 3300005842 Bacteria 3948
82 Ga0068858_100144544 3300005842 Bacteria 2233
83 Ga0068860_100046580 3300005843 Bacteria 4134
84 Ga0068862_100637440 3300005844 Bacteria 1027
85 Ga0081540_1000132 3300005983 Bacteria 79179
86 Ga0081539_10000015 3300005985 Bacteria 395781
87 Ga0070717_10064692 3300006028 Bacteria 3038
88 Ga0070717_10078985 3300006028 Bacteria 2758
89 Ga0070717_10079437 3300006028 Bacteria 2751
90 Ga0070717_10271218 3300006028 Bacteria 1503
91 Ga0070717_10400701 3300006028 Bacteria 1233
92 Ga0070715_10000754 3300006163 Bacteria 8752
93 Ga0070715_10005656 3300006163 Bacteria 4188
94 Ga0070712_100006353 3300006175 Bacteria 7327
95 Ga0070712_100024989 3300006175 Bacteria 3965
96 Ga0070712_100031618 3300006175 Bacteria 3567
97 Ga0097621_100243574 3300006237 Bacteria 1572
98 Ga0068871_100041011 3300006358 Bacteria 3710
99 Ga0068871_100141305 3300006358 Bacteria 2047
100 Ga0068871_100176675 3300006358 Bacteria 1833
101 Ga0075433_10019473 3300006852 Bacteria 5656
102 Ga0075434_100028754 3300006871 Bacteria 5466
103 Ga0075434_100069278 3300006871 Bacteria 3517
104 Ga0068865_100029414 3300006881 Bacteria 3645
105 Ga0075436_100114568 3300006914 Bacteria 1882
106 Ga0097620_100043165 3300006931 Bacteria 4531
107 Ga0097620_100407366 3300006931 Bacteria 1456
108 Ga0075435_100004241 3300007076 Bacteria 9848
109 Ga0099794_10025020 3300007265 Bacteria 2745
110 Ga0105240_10028808 3300009093 Bacteria 7244
111 Ga0105240_10137562 3300009093 Bacteria 2924
112 Ga0105240_10138623 3300009093 Bacteria 2911
113 Ga0105245_10085087 3300009098 Bacteria 2898
114 Ga0105245_10146452 3300009098 Bacteria 2228
115 Ga0105247_10038986 3300009101 Bacteria 2902
116 Ga0105247_10283970 3300009101 Bacteria 1143
117 Ga0114129_10426533 3300009147 Bacteria 1743
118 Ga0105243_10043682 3300009148 Bacteria 3513
119 Ga0105241_10029996 3300009174 Bacteria 4062
120 Ga0105239_10390260 3300010375 Bacteria 1575
121 Ga0105239_10474733 3300010375 Bacteria 1420
122 Ga0105246_10011708 3300011119 Bacteria 5451
123 Ga0157373_10040176 3300013100 Bacteria 3348
124 Ga0157371_10030460 3300013102 Bacteria 3893
125 Ga0157370_10015626 3300013104 Bacteria 7710
126 Ga0157369_10029978 3300013105 Bacteria 6005
127 Ga0157369_10075246 3300013105 Bacteria 3621
128 Ga0157374_10183970 3300013296 Bacteria 2042
129 Ga0157374_10195162 3300013296 Bacteria 1981
130 Ga0157378_10177420 3300013297 Bacteria 2002
131 Ga0163162_10390193 3300013306 Bacteria 1525
132 Ga0163162_10513232 3300013306 Bacteria 1328
133 Ga0157375_10309625 3300013308 Bacteria 1743
134 Ga0163163_10039141 3300014325 Bacteria 4625
135 Ga0163163_10096611 3300014325 Bacteria 2975
136 Ga0157380_10473137 3300014326 Bacteria 1210
137 Ga0157379_10025329 3300014968 Bacteria 5270
138 Ga0157379_10032461 3300014968 Bacteria 4655
139 Ga0157376_10411482 3300014969 Bacteria 1310
140 Ga0197907_10019031 3300020069 Bacteria 2597
141 Ga0197907_10192407 3300020069 Bacteria 2819
142 Ga0197907_10409793 3300020069 Bacteria 1237
143 Ga0206356_10825707 3300020070 Bacteria 2405
144 Ga0206353_10804599 3300020082 Bacteria 1756
145 Ga0206353_11789829 3300020082 Bacteria 1849
146 Ga0154015_1446024 3300020610 Bacteria 1328
147 Ga0224712_10003245 3300022467 Bacteria 4187
148 Ga0224712_10029169 3300022467 Bacteria 1979
149 Ga0207653_10004047 3300025885 Bacteria 4614
150 Ga0207692_10013547 3300025898 Bacteria 3540
151 Ga0207710_10040997 3300025900 Bacteria 2053
152 Ga0207710_10120322 3300025900 Bacteria 1253
153 Ga0207680_10022929 3300025903 Bacteria 3401
154 Ga0207685_10000415 3300025905 Bacteria 7054
155 Ga0207699_10000941 3300025906 Bacteria 13889
156 Ga0207699_10007024 3300025906 Bacteria 5485
157 Ga0207699_10023015 3300025906 Bacteria 3385
158 Ga0207699_10062790 3300025906 Bacteria 2241
159 Ga0207705_10001502 3300025909 Bacteria 18535
160 Ga0207705_10014606 3300025909 Bacteria 5651
161 Ga0207705_10033182 3300025909 Bacteria 3688
162 Ga0207705_10085220 3300025909 Bacteria 2308
163 Ga0207684_10033335 3300025910 Bacteria 4379
164 Ga0207684_10042989 3300025910 Bacteria 3830
165 Ga0207684_10165930 3300025910 Bacteria 1903
166 Ga0207684_10228544 3300025910 Bacteria 1605
167 Ga0207654_10155902 3300025911 Bacteria 1470
168 Ga0207695_10022677 3300025913 Bacteria 7117
169 Ga0207695_10024155 3300025913 Bacteria 6846
170 Ga0207671_10195296 3300025914 Bacteria 1579
171 Ga0207693_10006588 3300025915 Bacteria 9606
172 Ga0207693_10006804 3300025915 Bacteria 9440
173 Ga0207693_10017271 3300025915 Bacteria 5755
174 Ga0207693_10043130 3300025915 Bacteria 3551
175 Ga0207693_10124511 3300025915 Bacteria 2025
176 Ga0207693_10141609 3300025915 Bacteria 1891
177 Ga0207663_10011720 3300025916 Bacteria 4717
178 Ga0207663_10031226 3300025916 Bacteria 3150
179 Ga0207662_10029768 3300025918 Bacteria 3166
180 Ga0207657_10009487 3300025919 Bacteria 9776
181 Ga0207652_10460681 3300025921 Bacteria 1146
182 Ga0207646_10002653 3300025922 Bacteria 20973
183 Ga0207646_10011302 3300025922 Bacteria 8667
184 Ga0207646_10018714 3300025922 Bacteria 6456
185 Ga0207646_10082586 3300025922 Bacteria 2873
186 Ga0207646_10508753 3300025922 Bacteria 1085
187 Ga0207659_10059980 3300025926 Bacteria 2737
188 Ga0207687_10011367 3300025927 Bacteria 5819
189 Ga0207687_10039901 3300025927 Bacteria 3216
190 Ga0207700_10002936 3300025928 Bacteria 9838
191 Ga0207700_10023836 3300025928 Bacteria 4228
192 Ga0207700_10027016 3300025928 Bacteria 4012
193 Ga0207700_10059433 3300025928 Bacteria 2891
194 Ga0207700_10083836 3300025928 Bacteria 2496
195 Ga0207664_10000959 3300025929 Bacteria 19459
196 Ga0207664_10003542 3300025929 Bacteria 10427
197 Ga0207664_10022450 3300025929 Bacteria 4712
198 Ga0207664_10029360 3300025929 Bacteria 4187
199 Ga0207664_10057422 3300025929 Bacteria 3093
200 Ga0207664_10161767 3300025929 Bacteria 1910
201 Ga0207670_10049780 3300025936 Bacteria 2804
202 Ga0207665_10026505 3300025939 Bacteria 3826
203 Ga0207665_10133846 3300025939 Bacteria 1762
204 Ga0207665_10231252 3300025939 Bacteria 1359
205 Ga0207711_10494947 3300025941 Bacteria 1139
206 Ga0207689_10002033 3300025942 Bacteria 19112
207 Ga0207667_10013247 3300025949 Bacteria 9451
208 Ga0207667_10088960 3300025949 Bacteria 3193
209 Ga0207667_10100825 3300025949 Bacteria 2978
210 Ga0207651_10056228 3300025960 Bacteria 2707
211 Ga0207712_10057420 3300025961 Bacteria 2746
212 Ga0207677_10409499 3300026023 Bacteria 1152
213 Ga0207678_10054098 3300026067 Bacteria 3457
214 Ga0207708_10052909 3300026075 Bacteria 3093
215 Ga0207702_10034646 3300026078 Bacteria 4222
216 Ga0207702_10064725 3300026078 Bacteria 3129
217 Ga0207702_10429190 3300026078 Bacteria 1279
218 Ga0207702_10452070 3300026078 Bacteria 1246
219 Ga0207641_10002608 3300026088 Bacteria 16539
220 Ga0207641_10107794 3300026088 Bacteria 2464
221 Ga0207674_10011736 3300026116 Bacteria 9830
222 Ga0207674_10134542 3300026116 Bacteria 2434
223 Ga0207675_100120602 3300026118 Bacteria 2481
224 Ga0207683_10000422 3300026121 Bacteria 39048
225 Ga0268265_10026986 3300028380 Bacteria 4093
226 Ga0265319_1009055 3300028563 Bacteria 4290
227 Ga0265318_10008546 3300028577 Bacteria 4550
228 Ga0265318_10086879 3300028577 Bacteria 1153
229 Ga0265318_10088429 3300028577 Bacteria 1141
230 Ga0265760_10031383 3300031090 Bacteria 1567
231 Ga0265330_10065143 3300031235 Bacteria 1582
232 Ga0265332_10031621 3300031238 Bacteria 2308
233 Ga0265325_10052985 3300031241 Bacteria 2081
234 Ga0265325_10179366 3300031241 Bacteria 987
235 Ga0265340_10006749 3300031247 Bacteria 6281
236 Ga0265339_10029581 3300031249 Bacteria 3108
237 Ga0265313_10072417 3300031595 Bacteria 1584
238 Ga0265314_10018030 3300031711 Bacteria 5520
239 Ga0307406_10019040 3300031901 Bacteria 4024
240 Ga0307409_100047770 3300031995 Bacteria 3252
241 Ga0307416_100058346 3300032002 Bacteria 3129
242 Ga0316214_1002767 3300033545 Bacteria 2174
243 Ga0373930_0017166 3300034816 Bacteria 1377
244 Ga0373948_0009513 3300034817 Bacteria 1677
245 Ga0373950_0010527 3300034818 Bacteria 1496
246 Ga0373959_0005280 3300034820 Bacteria 2116
247 Ga0373959_0014566 3300034820 Bacteria 1433
248 Ga0373938_0004471 3300034957 Bacteria 2339
249 Ga0373926_0000438 3300035083 Bacteria 10813
250 Ga0373926_0003473 3300035083 Bacteria 5089
251 Ga0373926_0114213 3300035083 Bacteria 1016
252 Ga0373928_0004214 3300035084 Bacteria 2743
253 Ga0373928_0005211 3300035084 Bacteria 2480
254 Ga0373929_0012819 3300035085 Bacteria 1598
255 Ga0373934_0011268 3300035086 Bacteria 3364
256 Ga0373934_0015102 3300035086 Bacteria 2927
257 Ga0373944_0002942 3300035089 Bacteria 4377
258 Ga0373944_0006271 3300035089 Bacteria 3152
259 Ga0373949_0019714 3300035090 Bacteria 1538
260 Ga0373949_0053265 3300035090 Bacteria 1025
261 Ga0373951_0024737 3300035091 Bacteria 1392
262 Ga0373952_0003247 3300035092 Bacteria 2926
263 Ga0373923_0000944 3300035111 Bacteria 7780
264 Ga0373923_0020780 3300035111 Bacteria 2555
265 Ga0373932_0057858 3300035112 Bacteria 1170
266 Ga0373932_0059479 3300035112 Bacteria 1157
267 Ga0373936_0001919 3300035113 Bacteria 7680
268 Ga0373936_0003402 3300035113 Bacteria 5963
269 Ga0373936_0010907 3300035113 Bacteria 3434
270 Ga0373936_0061973 3300035113 Bacteria 1528
271 Ga0373939_0003195 3300035114 Bacteria 3840
272 Ga0373945_0000622 3300035116 Bacteria 10187
273 Ga0373954_0019840 3300035118 Bacteria 3035
274 Ga0373956_0033744 3300035119 Bacteria 2251
275 Ga0373957_0002613 3300035120 Bacteria 5170
276 Ga0373957_0036696 3300035120 Bacteria 1827
277 Ga0373960_0005954 3300035121 Bacteria 2842
278 Ga0373960_0017444 3300035121 Bacteria 1861
279 Ga0373943_0001787 3300035170 Bacteria 9735
280 Ga0373943_0003664 3300035170 Bacteria 6981
281 Ga0373946_0000227 3300035171 Bacteria 17640
282 Ga0373955_0026567 3300035172 Bacteria 2983
283 Ga0373955_0039513 3300035172 Bacteria 2519
284 Ga0373955_0119952 3300035172 Bacteria 1528
285 Ga0373962_0003337 3300035242 Bacteria 3859
286 Ga0373962_0010480 3300035242 Bacteria 2312
287 Ga0373931_0034646 3300035691 Bacteria 2621
288 Ga0373935_0001488 3300035692 Bacteria 13018
289 Ga0373935_0011108 3300035692 Bacteria 5406
290 Ga0373927_0001041 3300035695 Bacteria 21095
291 Ga0373927_0004954 3300035695 Bacteria 9237
292 Ga0373933_0004036 3300035724 Bacteria 8089
293 Ga0373933_0004166 3300035724 Bacteria 7965
294 Ga0373933_0056020 3300035724 Bacteria 2365
295 Ga0373933_0062535 3300035724 Bacteria 2248
296 Ga0373947_0001031 3300035725 Bacteria 17035
297 Ga0373937_0033467 3300036401 Bacteria 4667
298 Ga0373937_0143370 3300036401 Bacteria 2235
299 Ga0373925_0003756 3300037068 Bacteria 11667
300 Ga0373925_0184889 3300037068 Bacteria 1651
301 Ga0373925_0266779 3300037068 Bacteria 1376
302 Ga0395899_0106056 3300037312 Bacteria 2024
303 Ga0395900_0137301 3300037418 Bacteria 2505
304 Ga0395900_0164058 3300037418 Bacteria 2265
305 Ga0395900_0211223 3300037418 Bacteria 1960
306 Ga0395898_0093092 3300037466 Bacteria 2897
307 Ga0395898_0240910 3300037466 Bacteria 1725
308 Ga0395898_0583314 3300037466 Bacteria 1060
309 Ga0436364_0417224 3300037853 Bacteria 1909
310 Ga0436364_0857250 3300037853 Bacteria 8151
311 Ga0395901_0039945 3300038443 Bacteria 4857
312 Ga0395901_0209946 3300038443 Bacteria 2038
313 Ga0436363_1059712 3300039450 Bacteria 1318
314 Ga0466969_0139712 3300044656 Bacteria 1120
315 Ga0466966_0004339 3300044684 Bacteria 9349
316 Ga0466966_0028708 3300044684 Bacteria 3621
317 Ga0466961_0221517 3300044693 Bacteria 1166
318 Ga0466964_0078564 3300044706 Bacteria 1411
319 Ga0466971_0024249 3300044719 Bacteria 2707
320 Ga0466970_0075071 3300044765 Bacteria 1821
321 Ga0466959_0160609 3300045049 Bacteria 1580
322 Ga0466958_0097662 3300045836 Bacteria 1823
323 Ga0466958_0103939 3300045836 Bacteria 1769
324 Ga0466967_0001200 3300045976 Bacteria 14571
325 Ga0466967_0049934 3300045976 Bacteria 3661
326 Ga0466967_0061507 3300045976 Bacteria 3331
327 Ga0466967_0367406 3300045976 Bacteria 1395
328 Ga0466967_0377540 3300045976 Bacteria 1376
329 Ga0495592_0000540 3300046454 Bacteria 26898
330 Ga0495592_0027663 3300046454 Bacteria 4296
331 Ga0495592_0081364 3300046454 Bacteria 2341
332 Ga0495592_0119307 3300046454 Bacteria 1857
333 Ga0495592_0165870 3300046454 Bacteria 1516
334 Ga0495603_0057528 3300046455 Bacteria 2300
335 Ga0495629_0002204 3300046459 Bacteria 15026
336 Ga0495629_0014661 3300046459 Bacteria 5638
337 Ga0495629_0057317 3300046459 Bacteria 2724
338 Ga0495641_0008218 3300046461 Bacteria 6397
339 Ga0495651_0000634 3300046462 Bacteria 27128
340 Ga0495651_0033500 3300046462 Bacteria 4006
341 Ga0495651_0054802 3300046462 Bacteria 3064
342 Ga0495651_0120175 3300046462 Bacteria 1931
343 Ga0495653_0013244 3300046463 Bacteria 6724
344 Ga0495653_0093384 3300046463 Bacteria 2194
345 Ga0495653_0174665 3300046463 Bacteria 1479
346 Ga0495580_0013566 3300046472 Bacteria 6215
347 Ga0495580_0070447 3300046472 Bacteria 2443
348 Ga0495582_0007358 3300046473 Bacteria 6100
349 Ga0495639_0004070 3300046475 Bacteria 6269
350 Ga0495639_0045004 3300046475 Bacteria 1996
351 Ga0495662_0001075 3300046476 Bacteria 13426
352 Ga0495662_0004656 3300046476 Bacteria 6887
353 Ga0495662_0021175 3300046476 Bacteria 3145
354 Ga0495664_0003214 3300046477 Bacteria 8867
355 Ga0495664_0005199 3300046477 Bacteria 7139
356 Ga0495664_0023036 3300046477 Bacteria 3611
357 Ga0495664_0024245 3300046477 Bacteria 3525
358 Ga0495664_0101486 3300046477 Bacteria 1733
359 Ga0495608_0001820 3300046511 Bacteria 15228
360 Ga0495608_0003945 3300046511 Bacteria 10665
361 Ga0495608_0045159 3300046511 Bacteria 2938
362 Ga0495608_0047582 3300046511 Bacteria 2850
363 Ga0495608_0049166 3300046511 Bacteria 2799
364 Ga0495608_0106939 3300046511 Bacteria 1800
365 Ga0495618_0020328 3300046514 Bacteria 4086
366 Ga0495618_0024336 3300046514 Bacteria 3750
367 Ga0495618_0097423 3300046514 Bacteria 1881
368 Ga0495618_0112091 3300046514 Bacteria 1746
369 Ga0495628_0004834 3300046516 Bacteria 11852
370 Ga0495628_0031227 3300046516 Bacteria 4309
371 Ga0495628_0085062 3300046516 Bacteria 2454
372 Ga0495628_0293988 3300046516 Bacteria 1203
373 Ga0495630_0004198 3300046517 Bacteria 10086
374 Ga0495630_0004911 3300046517 Bacteria 9397
375 Ga0495630_0029651 3300046517 Bacteria 4066
376 Ga0495630_0059792 3300046517 Bacteria 2859
377 Ga0495666_0008648 3300046526 Bacteria 5100
378 Ga0495666_0161241 3300046526 Bacteria 1040
379 Ga0495666_0189661 3300046526 Bacteria 947
380 Ga0495652_0037372 3300046529 Bacteria 4213
381 Ga0495652_0041270 3300046529 Bacteria 3984
382 Ga0495652_0096931 3300046529 Bacteria 2400
383 Ga0495652_0183872 3300046529 Bacteria 1601
384 Ga0495652_0403995 3300046529 Bacteria 966
385 Ga0495665_0003013 3300046531 Bacteria 9104
386 Ga0495665_0099307 3300046531 Bacteria 1528
387 Ga0495640_0016000 3300046533 Bacteria 5625
388 Ga0495640_0138609 3300046533 Bacteria 1569
389 Ga0495640_0294108 3300046533 Bacteria 1009
390 Ga0495586_0007550 3300046535 Bacteria 5800
391 Ga0495586_0177738 3300046535 Bacteria 1203
392 Ga0495587_0002844 3300046536 Bacteria 11595
393 Ga0495587_0022299 3300046536 Bacteria 3898
394 Ga0495587_0043881 3300046536 Bacteria 2661
395 Ga0495645_0007316 3300046543 Bacteria 7678
396 Ga0495645_0078859 3300046543 Bacteria 2366
397 Ga0495667_0000478 3300046559 Bacteria 25490
398 Ga0495667_0015401 3300046559 Bacteria 5165
399 Ga0495667_0019219 3300046559 Bacteria 4610
400 Ga0495667_0023726 3300046559 Bacteria 4132
401 Ga0495667_0194222 3300046559 Bacteria 1300
402 Ga0495634_0006363 3300046642 Bacteria 8979
403 Ga0495635_0009542 3300046663 Bacteria 6782
404 Ga0495635_0034043 3300046663 Bacteria 3534
405 Ga0495635_0102626 3300046663 Bacteria 1954
406 Ga0495635_0138729 3300046663 Bacteria 1656
407 Ga0495635_0141538 3300046663 Bacteria 1638
408 Ga0495657_0007147 3300046675 Bacteria 8661
409 Ga0495657_0021515 3300046675 Bacteria 4626
410 Ga0495657_0050169 3300046675 Bacteria 2806
411 Ga0495657_0055354 3300046675 Bacteria 2646
412 Ga0495657_0070970 3300046675 Bacteria 2275
413 Ga0495657_0077797 3300046675 Bacteria 2151
414 Ga0495657_0097371 3300046675 Bacteria 1878
415 Ga0495599_0000393 3300046678 Bacteria 25011
416 Ga0495599_0040246 3300046678 Bacteria 2935
417 Ga0495599_0098815 3300046678 Bacteria 1819
418 Ga0495623_0014571 3300046679 Bacteria 5086
419 Ga0495623_0147262 3300046679 Bacteria 1395
420 Ga0495646_0031481 3300046680 Bacteria 3305
421 Ga0495646_0048345 3300046680 Bacteria 2584
422 Ga0495646_0216760 3300046680 Bacteria 1036
423 Ga0495647_0021457 3300046681 Bacteria 2325
424 Ga0495658_0006584 3300046683 Bacteria 5705
425 Ga0495658_0012771 3300046683 Bacteria 4264
426 Ga0495658_0289913 3300046683 Bacteria 1034
427 Ga0495613_0003091 3300046689 Bacteria 12442
428 Ga0495613_0006351 3300046689 Bacteria 8839
429 Ga0495613_0043597 3300046689 Bacteria 3319
430 Ga0495624_0001706 3300046690 Bacteria 16803
431 Ga0495624_0011451 3300046690 Bacteria 6094
432 Ga0495624_0038954 3300046690 Bacteria 3050
433 Ga0495600_0016674 3300046809 Bacteria 4667
434 Ga0495600_0027888 3300046809 Bacteria 3652
435 Ga0495600_0068921 3300046809 Bacteria 2312
436 Ga0495600_0079867 3300046809 Bacteria 2135
437 Ga0495581_0001502 3300047315 Bacteria 12985
438 Ga0495581_0006617 3300047315 Bacteria 6714
439 Ga0495581_0007968 3300047315 Bacteria 6135
440 Ga0495581_0154558 3300047315 Bacteria 1341
441 Ga0495674_0001061 3300047319 Bacteria 26431
442 Ga0495674_0044676 3300047319 Bacteria 3937
443 Ga0495674_0363819 3300047319 Bacteria 1172
444 Ga0495680_0000911 3300047322 Bacteria 32800
445 Ga0495680_0003897 3300047322 Bacteria 14443
446 Ga0495680_0010904 3300047322 Bacteria 8076
447 Ga0495680_0047192 3300047322 Bacteria 3389
448 Ga0495680_0067560 3300047322 Bacteria 2732
449 Ga0495675_0003029 3300047444 Bacteria 10097
450 Ga0495675_0148653 3300047444 Bacteria 1448
451 Ga0495684_0014273 3300047471 Bacteria 6112
452 Ga0495684_0017800 3300047471 Bacteria 5473
453 Ga0495684_0087551 3300047471 Bacteria 2360
454 Ga0495593_0001345 3300047673 Bacteria 14384
455 Ga0495593_0039264 3300047673 Bacteria 2552
456 Ga0495593_0052569 3300047673 Bacteria 2153
457 Ga0495602_0011649 3300048088 Bacteria 9083
458 Ga0495602_0021482 3300048088 Bacteria 6352
459 Ga0495602_0045510 3300048088 Bacteria 3970
460 Ga0495602_0053942 3300048088 Bacteria 3554
461 Ga0495614_0035955 3300048089 Bacteria 2127
462 Ga0495614_0057994 3300048089 Bacteria 1662
463 Ga0496100_0006099 3300048903 Bacteria 6552
464 Ga0496100_0036217 3300048903 Bacteria 3110
465 Ga0496100_0101432 3300048903 Bacteria 1984
466 Ga0496100_0116101 3300048903 Bacteria 1867
467 Ga0496100_0339772 3300048903 Bacteria 1132
468 Ga0496101_0003131 3300048904 Bacteria 10232
469 Ga0496102_0000275 3300048905 Bacteria 65564
470 Ga0496102_0031025 3300048905 Bacteria 4789
471 Ga0496102_0526628 3300048905 Bacteria 1104
472 Ga0496103_0000138 3300048906 Bacteria 76227
473 Ga0496103_0026306 3300048906 Bacteria 3522
474 Ga0496103_0047805 3300048906 Bacteria 2644
475 Ga0496104_0006105 3300048907 Bacteria 10575
476 Ga0496104_0040389 3300048907 Bacteria 4372
477 Ga0496105_0018713 3300048908 Bacteria 5576
478 Ga0496105_0060616 3300048908 Bacteria 3122
479 Ga0496105_0062401 3300048908 Bacteria 3075
480 Ga0496106_0018730 3300048909 Bacteria 5127
481 Ga0496106_0124243 3300048909 Bacteria 2019
482 Ga0496106_0160291 3300048909 Bacteria 1779
483 Ga0496107_0120560 3300048910 Bacteria 1932
484 Ga0496107_0339736 3300048910 Bacteria 1117
485 Ga0496108_0043194 3300048911 Bacteria 3765
486 Ga0496108_0067211 3300048911 Bacteria 3023
487 Ga0496108_0096280 3300048911 Bacteria 2521
488 Ga0496109_0153395 3300048912 Bacteria 2157
489 Ga0496109_0426737 3300048912 Bacteria 1252
490 Ga0496110_0010841 3300048913 Bacteria 7433
491 Ga0496110_0056706 3300048913 Bacteria 3447
492 Ga0496110_0057417 3300048913 Bacteria 3426
493 Ga0496110_0104862 3300048913 Bacteria 2536
494 Ga0496110_0523088 3300048913 Bacteria 1079
495 Ga0496111_0139364 3300048914 Bacteria 1797
496 Ga0496113_0057569 3300048916 Bacteria 2922
497 Ga0496113_0065804 3300048916 Bacteria 2744
498 Ga0496113_0446245 3300048916 Bacteria 1039
499 Ga0496114_0031366 3300048917 Bacteria 4374
500 Ga0496114_0179799 3300048917 Bacteria 1847
501 Ga0496115_0101574 3300048918 Bacteria 2358
502 Ga0496116_0002940 3300048919 Bacteria 17356
503 Ga0496117_0000488 3300048920 Bacteria 65578
504 Ga0496118_0000235 3300048921 Bacteria 97453
505 Ga0496119_0000148 3300048922 Bacteria 98160
506 Ga0496120_0003375 3300048923 Bacteria 14621
507 Ga0496121_0008506 3300048924 Bacteria 12042
508 Ga0496124_0023957 3300048927 Bacteria 5558
509 Ga0496125_0177614 3300048928 Bacteria 1423
510 Ga0496126_0000635 3300048929 Bacteria 65555
511 Ga0501042_0057634 3300049578 Bacteria 2772
512 Ga0501069_0248908 3300049585 Bacteria 1036
513 Ga0501070_0061384 3300049586 Bacteria 3114
514 Ga0501080_0001061 3300049742 Bacteria 22598
515 Ga0501080_0018166 3300049742 Bacteria 6509
516 Ga0501080_0025154 3300049742 Bacteria 5525
517 Ga0501083_0000011 3300049744 Bacteria 181041
518 nmdc:mga0n895_171917_c1 3300050512 Bacteria 2199
519 nmdc:mga0n895_88484_c1 3300050512 Bacteria 3097
520 nmdc:mga08x19_139890_c1 3300050514 Bacteria 1634
521 nmdc:mga0a205_150020_c1 3300050515 Bacteria 2231
522 Ga0495601_0000691 3300053077 Bacteria 18089
523 Ga0495612_0006996 3300053078 Bacteria 4614
524 Ga0495612_0008123 3300053078 Bacteria 4269
525 Ga0495595_0008364 3300053084 Bacteria 4247
526 Ga0495595_0018767 3300053084 Bacteria 2992
527 Ga0495619_0000611 3300053085 Bacteria 23627
528 Ga0495619_0009773 3300053085 Bacteria 6049
529 Ga0495619_0052453 3300053085 Bacteria 2696
530 Ga0500607_049067 3300053121 Bacteria 2254
531 Ga0500559_0028844 3300053136 Bacteria 2373
532 Ga0500636_0000046 3300053177 Bacteria 63059
533 Ga0500625_052181 3300053729 Bacteria 1884
534 2644446128 2643221679 Bacteria 3839507
535 2808871835 2808606365 Bacteria 4301966
536 2856741502 2856741275 Bacteria 8096094
537 2891564755 2891562705 Bacteria 8039471
538 2915360160 2915358134 Bacteria 6050864
539 Ga0495601_0209363
540 JGI25406J46586_10008317
541 Ga0070658_10010175
542 Ga0070658_10073379
543 Ga0070680_100050102
544 Ga0068868_100318212
545 Ga0070660_100446841
546 Ga0070691_10049379
547 Ga0070661_100037644
548 Ga0070675_100132550
549 Ga0070673_100004845
550 Ga0070667_100051499
551 Ga0070709_10131813
552 Ga0070714_100006417
553 Ga0070714_100023325
554 Ga0070714_100142265
555 Ga0070713_100016548
556 Ga0070713_100026862
557 Ga0070713_100033242
558 Ga0070710_10000336
559 Ga0070711_100005243
560 Ga0070705_100094900
561 Ga0070694_100027474
562 Ga0070694_100443169
563 Ga0070708_100041365
564 Ga0070708_100047992
565 Ga0070708_100049980
566 Ga0070708_100104824
567 Ga0070663_100026575
568 Ga0070678_100085129
569 Ga0070681_10096162
570 Ga0070685_10023010
571 Ga0070706_100037923
572 Ga0070706_100086697
573 Ga0070706_100126907
574 Ga0070706_100455415
575 Ga0070707_100005661
576 Ga0070707_100010434
577 Ga0070707_100013020
578 Ga0070707_100033553
579 Ga0070707_100055613
580 Ga0070707_100056390
581 Ga0070707_100140128
582 Ga0070707_100400502
583 Ga0070707_100579060
584 Ga0070698_100000355
585 Ga0070698_100007881
586 Ga0070698_100024934
587 Ga0070698_100040689
588 Ga0070699_100022201
589 Ga0070699_100045446
590 Ga0070699_100249370
591 Ga0070684_100239963
592 Ga0070684_100272890
593 Ga0070697_100043348
594 Ga0068853_100076455
595 Ga0070695_100290975
596 Ga0070696_100008249
597 Ga0070693_100010861
598 Ga0068855_100001083
599 Ga0068855_100043992
600 Ga0068855_100142149
601 Ga0068855_100190330
602 Ga0068855_100220195
603 Ga0070664_100082579
604 Ga0068857_100119858
605 Ga0068856_100029337
606 Ga0068856_100060015
607 Ga0068856_100127121
608 Ga0068856_100143904
609 Ga0070702_100007162
610 Ga0068859_100043164
611 Ga0068859_100407366
612 Ga0068864_100210743
613 Ga0068864_100225875
614 Ga0068866_10013180
615 Ga0068870_10008358
616 Ga0068863_100058322
617 Ga0068863_100090343
618 Ga0068863_100149744
619 Ga0068858_100048198
620 Ga0068858_100144544
621 Ga0068860_100046580
622 Ga0068862_100637440
623 Ga0081540_1000132
624 Ga0081539_10000015
625 Ga0070717_10064692
626 Ga0070717_10078985
627 Ga0070717_10079437
628 Ga0070717_10271218
629 Ga0070717_10400701
630 Ga0070715_10000754
631 Ga0070715_10005656
632 Ga0070712_100006353
633 Ga0070712_100024989
634 Ga0070712_100031618
635 Ga0097621_100243574
636 Ga0068871_100041011
637 Ga0068871_100141305
638 Ga0068871_100176675
639 Ga0075433_10019473
640 Ga0075434_100028754
641 Ga0075434_100069278
642 Ga0068865_100029414
643 Ga0075436_100114568
644 Ga0097620_100043165
645 Ga0097620_100407366
646 Ga0075435_100004241
647 Ga0099794_10025020
648 Ga0105240_10028808
649 Ga0105240_10137562
650 Ga0105240_10138623
651 Ga0105245_10085087
652 Ga0105245_10146452
653 Ga0105247_10038986
654 Ga0105247_10283970
655 Ga0114129_10426533
656 Ga0105243_10043682
657 Ga0105241_10029996
658 Ga0105239_10390260
659 Ga0105239_10474733
660 Ga0105246_10011708
661 Ga0157373_10040176
662 Ga0157371_10030460
663 Ga0157370_10015626
664 Ga0157369_10029978
665 Ga0157369_10075246
666 Ga0157374_10183970
667 Ga0157374_10195162
668 Ga0157378_10177420
669 Ga0163162_10390193
670 Ga0163162_10513232
671 Ga0157375_10309625
672 Ga0163163_10039141
673 Ga0163163_10096611
674 Ga0157380_10473137
675 Ga0157379_10025329
676 Ga0157379_10032461
677 Ga0157376_10411482
678 Ga0197907_10019031
679 Ga0197907_10192407
680 Ga0197907_10409793
681 Ga0206356_10825707
682 Ga0206353_10804599
683 Ga0206353_11789829
684 Ga0154015_1446024
685 Ga0224712_10003245
686 Ga0224712_10029169
687 Ga0207653_10004047
688 Ga0207692_10013547
689 Ga0207710_10040997
690 Ga0207710_10120322
691 Ga0207680_10022929
692 Ga0207685_10000415
693 Ga0207699_10000941
694 Ga0207699_10007024
695 Ga0207699_10023015
696 Ga0207699_10062790
697 Ga0207705_10001502
698 Ga0207705_10014606
699 Ga0207705_10033182
700 Ga0207705_10085220
701 Ga0207684_10033335
702 Ga0207684_10042989
703 Ga0207684_10165930
704 Ga0207684_10228544
705 Ga0207654_10155902
706 Ga0207695_10022677
707 Ga0207695_10024155
708 Ga0207671_10195296
709 Ga0207693_10006588
710 Ga0207693_10006804
711 Ga0207693_10017271
712 Ga0207693_10043130
713 Ga0207693_10124511
714 Ga0207693_10141609
715 Ga0207663_10011720
716 Ga0207663_10031226
717 Ga0207662_10029768
718 Ga0207657_10009487
719 Ga0207652_10460681
720 Ga0207646_10002653
721 Ga0207646_10011302
722 Ga0207646_10018714
723 Ga0207646_10082586
724 Ga0207646_10508753
725 Ga0207659_10059980
726 Ga0207687_10011367
727 Ga0207687_10039901
728 Ga0207700_10002936
729 Ga0207700_10023836
730 Ga0207700_10027016
731 Ga0207700_10059433
732 Ga0207700_10083836
733 Ga0207664_10000959
734 Ga0207664_10003542
735 Ga0207664_10022450
736 Ga0207664_10029360
737 Ga0207664_10057422
738 Ga0207664_10161767
739 Ga0207670_10049780
740 Ga0207665_10026505
741 Ga0207665_10133846
742 Ga0207665_10231252
743 Ga0207711_10494947
744 Ga0207689_10002033
745 Ga0207667_10013247
746 Ga0207667_10088960
747 Ga0207667_10100825
748 Ga0207651_10056228
749 Ga0207712_10057420
750 Ga0207677_10409499
751 Ga0207678_10054098
752 Ga0207708_10052909
753 Ga0207702_10034646
754 Ga0207702_10064725
755 Ga0207702_10429190
756 Ga0207702_10452070
757 Ga0207641_10002608
758 Ga0207641_10107794
759 Ga0207674_10011736
760 Ga0207674_10134542
761 Ga0207675_100120602
762 Ga0207683_10000422
763 Ga0268265_10026986
764 Ga0265319_1009055
765 Ga0265318_10008546
766 Ga0265318_10086879
767 Ga0265318_10088429
768 Ga0265760_10031383
769 Ga0265330_10065143
770 Ga0265332_10031621
771 Ga0265325_10052985
772 Ga0265325_10179366
773 Ga0265340_10006749
774 Ga0265339_10029581
775 Ga0265313_10072417
776 Ga0265314_10018030
777 Ga0307406_10019040
778 Ga0307409_100047770
779 Ga0307416_100058346
780 Ga0316214_1002767
781 Ga0373930_0017166
782 Ga0373948_0009513
783 Ga0373950_0010527
784 Ga0373959_0005280
785 Ga0373959_0014566
786 Ga0373938_0004471
787 Ga0373926_0000438
788 Ga0373926_0003473
789 Ga0373926_0114213
790 Ga0373928_0004214
791 Ga0373928_0005211
792 Ga0373929_0012819
793 Ga0373934_0011268
794 Ga0373934_0015102
795 Ga0373944_0002942
796 Ga0373944_0006271
797 Ga0373949_0019714
798 Ga0373949_0053265
799 Ga0373951_0024737
800 Ga0373952_0003247
801 Ga0373923_0000944
802 Ga0373923_0020780
803 Ga0373932_0057858
804 Ga0373932_0059479
805 Ga0373936_0001919
806 Ga0373936_0003402
807 Ga0373936_0010907
808 Ga0373936_0061973
809 Ga0373939_0003195
810 Ga0373945_0000622
811 Ga0373954_0019840
812 Ga0373956_0033744
813 Ga0373957_0002613
814 Ga0373957_0036696
815 Ga0373960_0005954
816 Ga0373960_0017444
817 Ga0373943_0001787
818 Ga0373943_0003664
819 Ga0373946_0000227
820 Ga0373955_0026567
821 Ga0373955_0039513
822 Ga0373955_0119952
823 Ga0373962_0003337
824 Ga0373962_0010480
825 Ga0373931_0034646
826 Ga0373935_0001488
827 Ga0373935_0011108
828 Ga0373927_0001041
829 Ga0373927_0004954
830 Ga0373933_0004036
831 Ga0373933_0004166
832 Ga0373933_0056020
833 Ga0373933_0062535
834 Ga0373947_0001031
835 Ga0373937_0033467
836 Ga0373937_0143370
837 Ga0373925_0003756
838 Ga0373925_0184889
839 Ga0373925_0266779
840 Ga0395899_0106056
841 Ga0395900_0137301
842 Ga0395900_0164058
843 Ga0395900_0211223
844 Ga0395898_0093092
845 Ga0395898_0240910
846 Ga0395898_0583314
847 Ga0436364_0417224
848 Ga0436364_0857250
849 Ga0395901_0039945
850 Ga0395901_0209946
851 Ga0436363_1059712
852 Ga0466969_0139712
853 Ga0466966_0004339
854 Ga0466966_0028708
855 Ga0466961_0221517
856 Ga0466964_0078564
857 Ga0466971_0024249
858 Ga0466970_0075071
859 Ga0466959_0160609
860 Ga0466958_0097662
861 Ga0466958_0103939
862 Ga0466967_0001200
863 Ga0466967_0049934
864 Ga0466967_0061507
865 Ga0466967_0367406
866 Ga0466967_0377540
867 Ga0495592_0000540
868 Ga0495592_0027663
869 Ga0495592_0081364
870 Ga0495592_0119307
871 Ga0495592_0165870
872 Ga0495603_0057528
873 Ga0495629_0002204
874 Ga0495629_0014661
875 Ga0495629_0057317
876 Ga0495641_0008218
877 Ga0495651_0000634
878 Ga0495651_0033500
879 Ga0495651_0054802
880 Ga0495651_0120175
881 Ga0495653_0013244
882 Ga0495653_0093384
883 Ga0495653_0174665
884 Ga0495580_0013566
885 Ga0495580_0070447
886 Ga0495582_0007358
887 Ga0495639_0004070
888 Ga0495639_0045004
889 Ga0495662_0001075
890 Ga0495662_0004656
891 Ga0495662_0021175
892 Ga0495664_0003214
893 Ga0495664_0005199
894 Ga0495664_0023036
895 Ga0495664_0024245
896 Ga0495664_0101486
897 Ga0495608_0001820
898 Ga0495608_0003945
899 Ga0495608_0045159
900 Ga0495608_0047582
901 Ga0495608_0049166
902 Ga0495608_0106939
903 Ga0495618_0020328
904 Ga0495618_0024336
905 Ga0495618_0097423
906 Ga0495618_0112091
907 Ga0495628_0004834
908 Ga0495628_0031227
909 Ga0495628_0085062
910 Ga0495628_0293988
911 Ga0495630_0004198
912 Ga0495630_0004911
913 Ga0495630_0029651
914 Ga0495630_0059792
915 Ga0495666_0008648
916 Ga0495666_0161241
917 Ga0495666_0189661
918 Ga0495652_0037372
919 Ga0495652_0041270
920 Ga0495652_0096931
921 Ga0495652_0183872
922 Ga0495652_0403995
923 Ga0495665_0003013
924 Ga0495665_0099307
925 Ga0495640_0016000
926 Ga0495640_0138609
927 Ga0495640_0294108
928 Ga0495586_0007550
929 Ga0495586_0177738
930 Ga0495587_0002844
931 Ga0495587_0022299
932 Ga0495587_0043881
933 Ga0495645_0007316
934 Ga0495645_0078859
935 Ga0495667_0000478
936 Ga0495667_0015401
937 Ga0495667_0019219
938 Ga0495667_0023726
939 Ga0495667_0194222
940 Ga0495634_0006363
941 Ga0495635_0009542
942 Ga0495635_0034043
943 Ga0495635_0102626
944 Ga0495635_0138729
945 Ga0495635_0141538
946 Ga0495657_0007147
947 Ga0495657_0021515
948 Ga0495657_0050169
949 Ga0495657_0055354
950 Ga0495657_0070970
951 Ga0495657_0077797
952 Ga0495657_0097371
953 Ga0495599_0000393
954 Ga0495599_0040246
955 Ga0495599_0098815
956 Ga0495623_0014571
957 Ga0495623_0147262
958 Ga0495646_0031481
959 Ga0495646_0048345
960 Ga0495646_0216760
961 Ga0495647_0021457
962 Ga0495658_0006584
963 Ga0495658_0012771
964 Ga0495658_0289913
965 Ga0495613_0003091
966 Ga0495613_0006351
967 Ga0495613_0043597
968 Ga0495624_0001706
969 Ga0495624_0011451
970 Ga0495624_0038954
971 Ga0495600_0016674
972 Ga0495600_0027888
973 Ga0495600_0068921
974 Ga0495600_0079867
975 Ga0495581_0001502
976 Ga0495581_0006617
977 Ga0495581_0007968
978 Ga0495581_0154558
979 Ga0495674_0001061
980 Ga0495674_0044676
981 Ga0495674_0363819
982 Ga0495680_0000911
983 Ga0495680_0003897
984 Ga0495680_0010904
985 Ga0495680_0047192
986 Ga0495680_0067560
987 Ga0495675_0003029
988 Ga0495675_0148653
989 Ga0495684_0014273
990 Ga0495684_0017800
991 Ga0495684_0087551
992 Ga0495593_0001345
993 Ga0495593_0039264
994 Ga0495593_0052569
995 Ga0495602_0011649
996 Ga0495602_0021482
997 Ga0495602_0045510
998 Ga0495602_0053942
999 Ga0495614_0035955
1000 Ga0495614_0057994
1001 Ga0496100_0006099
1002 Ga0496100_0036217
1003 Ga0496100_0101432
1004 Ga0496100_0116101
1005 Ga0496100_0339772
1006 Ga0496101_0003131
1007 Ga0496102_0000275
1008 Ga0496102_0031025
1009 Ga0496102_0526628
1010 Ga0496103_0000138
1011 Ga0496103_0026306
1012 Ga0496103_0047805
1013 Ga0496104_0006105
1014 Ga0496104_0040389
1015 Ga0496105_0018713
1016 Ga0496105_0060616
1017 Ga0496105_0062401
1018 Ga0496106_0018730
1019 Ga0496106_0124243
1020 Ga0496106_0160291
1021 Ga0496107_0120560
1022 Ga0496107_0339736
1023 Ga0496108_0043194
1024 Ga0496108_0067211
1025 Ga0496108_0096280
1026 Ga0496109_0153395
1027 Ga0496109_0426737
1028 Ga0496110_0010841
1029 Ga0496110_0056706
1030 Ga0496110_0057417
1031 Ga0496110_0104862
1032 Ga0496110_0523088
1033 Ga0496111_0139364
1034 Ga0496113_0057569
1035 Ga0496113_0065804
1036 Ga0496113_0446245
1037 Ga0496114_0031366
1038 Ga0496114_0179799
1039 Ga0496115_0101574
1040 Ga0496116_0002940
1041 Ga0496117_0000488
1042 Ga0496118_0000235
1043 Ga0496119_0000148
1044 Ga0496120_0003375
1045 Ga0496121_0008506
1046 Ga0496124_0023957
1047 Ga0496125_0177614
1048 Ga0496126_0000635
1049 Ga0501042_0057634
1050 Ga0501069_0248908
1051 Ga0501070_0061384
1052 Ga0501080_0001061
1053 Ga0501080_0018166
1054 Ga0501080_0025154
1055 Ga0501083_0000011
1056 nmdc:mga0n895_171917_c1
1057 nmdc:mga0n895_88484_c1
1058 nmdc:mga08x19_139890_c1
1059 nmdc:mga0a205_150020_c1
1060 Ga0495601_0000691
1061 Ga0495612_0006996
1062 Ga0495612_0008123
1063 Ga0495595_0008364
1064 Ga0495595_0018767
1065 Ga0495619_0000611
1066 Ga0495619_0009773
1067 Ga0495619_0052453
1068 Ga0500607_049067
1069 Ga0500559_0028844
1070 Ga0500636_0000046
1071 Ga0500625_052181
1072 2644446128
1073 2808871835
1074 2856741502
1075 2891564755
1076 2915360160

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

61

334

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rao-assembly2.cif.gz_B crystal structure of the luciferase-like monooxygenase from bacillus cereus atcc 10987. 0.8815 1 289
3rao-assembly2.cif.gz_B crystal structure of the luciferase-like monooxygenase from bacillus cereus atcc 10987. 0.8757 1 289
3c8n-assembly2.cif.gz_D crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.8516 1 288
3c8n-assembly2.cif.gz_C crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.8485 1 288
5lxe-assembly1.cif.gz_B f420-dependent glucose-6-phosphate dehydrogenase from rhodococcus jostii rha1 0.8471 1 290
ID Description Score Start End Superfamily
af_I6X9T8_35_343_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9206 31 287 3.20.20.30
af_P95159_1_299_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9126 1 281 3.20.20.30
af_P71701_5_258_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9069 2 279 3.20.20.30
af_P95159_1_299_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8821 1 281 3.20.20.30
af_P71701_5_258_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.876 2 279 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A418KTH0-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9944 1 290 GO:0008726
GO:0046306
AF-C1AXM4-F1-model_v4 Luciferase-like domain-containing protein 0.987 1 187 GO:0008726
GO:0046306
AF-A0A838DNK8-F1-model_v4 TIGR03560 family F420-dependent LLM class oxidoreductase 0.9868 29 199 GO:0008726
GO:0046306
AF-A0A1V2QI88-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9782 1 290 GO:0008726
GO:0046306
AF-A0A7Z0WR58-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9758 1 290 GO:0008726
GO:0046306

Map