F461010

General Info

Members Datasets Scaffolds Average Seq Length
538 206 1076 263

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10081492|Ga0157371_100814922
Length 302
Sequence MLKQVQHDEPLRLGYLFAGGGCSLRHWTKRLFAVAAQLLLTGCLWGPGKFTSDLTLKKDGGFVLDYRGEIVLQVPDDTNTKPWNADMAHCFEGGKTLGNVGVMVPSGSPPPKSRPCTAAEIAQQKATYEKSAAENRKQAEAAAKMFGLPGLDDASNRAFAAKLMKYAGWRSVTYRGSGVFDVDYHFVGSDRQDFVFPALPDNDLLLPFIAIRRRADGSVLVTAPALTGGAGPLMERMAAAGAAGDTKTSMVSHAQGRFTVITDGEILTNNSEDGPSPNPIGHQLHWDVGPASNKIPETLIRL

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
173 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
183 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
184 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
185 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
203 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
204 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
205 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
206 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.09
Rhizosphere 95.54
Stem 0
Stem Tuber 0
Unclassified 1.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10081492 3300013102 Bacteria 2291
2 JGI24736J21556_1006357 3300001904 Bacteria 1988
3 JGI24740J21852_10033410 3300001979 Bacteria 1633
4 JGI24739J22299_10003508 3300001989 Bacteria 5986
5 JGI24737J22298_10035693 3300001990 Bacteria 1538
6 JGI24743J22301_10006225 3300001991 Bacteria 2026
7 JGI24745J21846_1000320 3300002073 Bacteria 4135
8 JGI24738J21930_10016101 3300002075 Bacteria 1584
9 JGI24744J21845_10001176 3300002077 Bacteria 5106
10 Ga0065715_10023864 3300005293 Bacteria 1643
11 Ga0070658_10030078 3300005327 Bacteria 4364
12 Ga0070658_10241649 3300005327 Bacteria 1530
13 Ga0070658_10263215 3300005327 Bacteria 1465
14 Ga0070658_10441670 3300005327 Bacteria 1120
15 Ga0070676_10270303 3300005328 Bacteria 1141
16 Ga0070683_100007562 3300005329 Bacteria 9185
17 Ga0070683_100132886 3300005329 Bacteria 2355
18 Ga0070683_100465238 3300005329 Bacteria 1207
19 Ga0070690_100011960 3300005330 Bacteria 5092
20 Ga0070690_100018834 3300005330 Bacteria 4178
21 Ga0070670_100019731 3300005331 Bacteria 5789
22 Ga0070670_100106439 3300005331 Bacteria 2417
23 Ga0070677_10063613 3300005333 Unclassified 1530
24 Ga0070666_10001395 3300005335 Bacteria 14613
25 Ga0070666_10072281 3300005335 Bacteria 2348
26 Ga0070666_10299218 3300005335 Bacteria 1145
27 Ga0070680_100058798 3300005336 Bacteria 3144
28 Ga0070680_100127793 3300005336 Bacteria 2124
29 Ga0070680_100165145 3300005336 Bacteria 1861
30 Ga0070680_100206759 3300005336 Bacteria 1656
31 Ga0070680_100438228 3300005336 Bacteria 1115
32 Ga0068868_100062661 3300005338 Bacteria 2948
33 Ga0068868_100313774 3300005338 Bacteria 1334
34 Ga0070660_100025462 3300005339 Bacteria 4397
35 Ga0070660_100028978 3300005339 Bacteria 4146
36 Ga0070660_100127611 3300005339 Bacteria 2033
37 Ga0070660_100187603 3300005339 Bacteria 1674
38 Ga0070660_100299409 3300005339 Bacteria 1318
39 Ga0070689_100357935 3300005340 Bacteria 1226
40 Ga0070691_10002189 3300005341 Bacteria 8644
41 Ga0070687_100032179 3300005343 Bacteria 2578
42 Ga0070661_100023500 3300005344 Bacteria 4419
43 Ga0070661_100036027 3300005344 Bacteria 3596
44 Ga0070661_100119197 3300005344 Bacteria 1975
45 Ga0070661_100211871 3300005344 Bacteria 1483
46 Ga0070661_100240290 3300005344 Bacteria 1394
47 Ga0070661_100245007 3300005344 Bacteria 1381
48 Ga0070661_100324829 3300005344 Bacteria 1202
49 Ga0070668_100315104 3300005347 Bacteria 1315
50 Ga0070669_100014919 3300005353 Bacteria 5536
51 Ga0070669_100157857 3300005353 Bacteria 1760
52 Ga0070669_100239667 3300005353 Bacteria 1440
53 Ga0070669_100349396 3300005353 Bacteria 1200
54 Ga0070669_100542031 3300005353 Bacteria 969
55 Ga0070675_100025479 3300005354 Bacteria 4741
56 Ga0070675_100053989 3300005354 Bacteria 3305
57 Ga0070675_100106223 3300005354 Bacteria 2370
58 Ga0070671_100014601 3300005355 Bacteria 6351
59 Ga0070671_100015435 3300005355 Bacteria 6170
60 Ga0070671_100031784 3300005355 Bacteria 4363
61 Ga0070671_100038799 3300005355 Bacteria 3953
62 Ga0070671_100060998 3300005355 Bacteria 3140
63 Ga0070671_100336349 3300005355 Bacteria 1287
64 Ga0070671_100514362 3300005355 Bacteria 1030
65 Ga0070671_100542337 3300005355 Bacteria 1003
66 Ga0070674_100032421 3300005356 Bacteria 3469
67 Ga0070674_100451676 3300005356 Bacteria 1061
68 Ga0070673_100014433 3300005364 Bacteria 5503
69 Ga0070673_100031327 3300005364 Bacteria 3989
70 Ga0070673_100088096 3300005364 Bacteria 2531
71 Ga0070659_100039961 3300005366 Bacteria 3664
72 Ga0070659_100049885 3300005366 Bacteria 3291
73 Ga0070659_100142601 3300005366 Bacteria 1951
74 Ga0070659_100144683 3300005366 Bacteria 1936
75 Ga0070659_100149562 3300005366 Bacteria 1904
76 Ga0070659_100157001 3300005366 Bacteria 1858
77 Ga0070659_100440096 3300005366 Bacteria 1104
78 Ga0070667_100032353 3300005367 Bacteria 4362
79 Ga0070667_100560702 3300005367 Bacteria 1050
80 Ga0070709_10010183 3300005434 Bacteria 5195
81 Ga0070709_10216098 3300005434 Bacteria 1365
82 Ga0070714_100366116 3300005435 Bacteria 1356
83 Ga0070663_100062570 3300005455 Bacteria 2683
84 Ga0070663_100124167 3300005455 Bacteria 1953
85 Ga0070663_100159168 3300005455 Bacteria 1737
86 Ga0070663_100159358 3300005455 Bacteria 1736
87 Ga0070678_100041301 3300005456 Bacteria 3268
88 Ga0070678_100103354 3300005456 Bacteria 2213
89 Ga0070678_100221364 3300005456 Bacteria 1573
90 Ga0070662_100001441 3300005457 Bacteria 14657
91 Ga0070662_100037523 3300005457 Bacteria 3436
92 Ga0070662_100082306 3300005457 Bacteria 2400
93 Ga0070662_100180490 3300005457 Bacteria 1664
94 Ga0070662_100258811 3300005457 Bacteria 1401
95 Ga0070662_100334033 3300005457 Bacteria 1238
96 Ga0070681_10039748 3300005458 Bacteria 4715
97 Ga0070681_10137476 3300005458 Bacteria 2373
98 Ga0068867_100097371 3300005459 Bacteria 2241
99 Ga0070679_100035831 3300005530 Bacteria 4923
100 Ga0070679_100206141 3300005530 Bacteria 1931
101 Ga0070679_100514053 3300005530 Bacteria 1141
102 Ga0068853_100535425 3300005539 Bacteria 1108
103 Ga0070672_100028479 3300005543 Bacteria 4179
104 Ga0070672_100049781 3300005543 Bacteria 3261
105 Ga0070672_100078423 3300005543 Bacteria 2643
106 Ga0070672_100262626 3300005543 Bacteria 1456
107 Ga0070686_100060121 3300005544 Bacteria 2451
108 Ga0070693_100258307 3300005547 Bacteria 1158
109 Ga0070665_100081102 3300005548 Bacteria 3250
110 Ga0070665_100099618 3300005548 Bacteria 2910
111 Ga0070665_100200583 3300005548 Bacteria 1995
112 Ga0068855_100188219 3300005563 Bacteria 2330
113 Ga0068855_100531132 3300005563 Bacteria 1275
114 Ga0068855_100609385 3300005563 Bacteria 1176
115 Ga0070664_100011917 3300005564 Bacteria 7057
116 Ga0070664_100349601 3300005564 Bacteria 1344
117 Ga0070664_100429806 3300005564 Bacteria 1210
118 Ga0068857_100134241 3300005577 Bacteria 2234
119 Ga0068857_100484356 3300005577 Bacteria 1159
120 Ga0068854_100095860 3300005578 Bacteria 2215
121 Ga0068854_100108646 3300005578 Bacteria 2089
122 Ga0068854_100216978 3300005578 Bacteria 1511
123 Ga0068854_100342926 3300005578 Bacteria 1220
124 Ga0068856_100047062 3300005614 Bacteria 4249
125 Ga0068856_100393229 3300005614 Bacteria 1406
126 Ga0068856_100450722 3300005614 Bacteria 1307
127 Ga0070702_100078492 3300005615 Bacteria 1971
128 Ga0068852_100038915 3300005616 Bacteria 4000
129 Ga0068852_100043796 3300005616 Bacteria 3797
130 Ga0068852_100054773 3300005616 Bacteria 3439
131 Ga0068852_100058299 3300005616 Bacteria 3344
132 Ga0068852_100304452 3300005616 Bacteria 1544
133 Ga0068859_100000323 3300005617 Bacteria 47637
134 Ga0068859_100144840 3300005617 Bacteria 2450
135 Ga0068859_100652032 3300005617 Bacteria 1145
136 Ga0068864_100002687 3300005618 Bacteria 14661
137 Ga0068864_100063914 3300005618 Bacteria 3190
138 Ga0068864_100135466 3300005618 Bacteria 2217
139 Ga0068866_10004717 3300005718 Bacteria 5590
140 Ga0068866_10148238 3300005718 Bacteria 1355
141 Ga0068851_10029088 3300005834 Bacteria 2733
142 Ga0068851_10035113 3300005834 Bacteria 2505
143 Ga0068851_10122181 3300005834 Bacteria 1400
144 Ga0068863_100000759 3300005841 Bacteria 32340
145 Ga0068863_100007621 3300005841 Bacteria 10585
146 Ga0068863_100029420 3300005841 Bacteria 5243
147 Ga0068863_100133555 3300005841 Bacteria 2370
148 Ga0068863_100153278 3300005841 Bacteria 2205
149 Ga0068858_100002458 3300005842 Bacteria 18704
150 Ga0068858_100046039 3300005842 Bacteria 4044
151 Ga0068858_100103391 3300005842 Bacteria 2657
152 Ga0068860_100017076 3300005843 Bacteria 7075
153 Ga0068860_100220209 3300005843 Unclassified 1843
154 Ga0068860_100518695 3300005843 Bacteria 1191
155 Ga0068862_100034489 3300005844 Bacteria 4282
156 Ga0068862_100201838 3300005844 Unclassified 1793
157 Ga0068862_100368521 3300005844 Bacteria 1336
158 Ga0070717_10077902 3300006028 Bacteria 2776
159 Ga0070716_100137904 3300006173 Bacteria 1551
160 Ga0070712_100133979 3300006175 Bacteria 1881
161 Ga0097621_100004234 3300006237 Bacteria 9968
162 Ga0068871_100063333 3300006358 Bacteria 3024
163 Ga0068871_100595026 3300006358 Bacteria 1005
164 Ga0075433_10002017 3300006852 Bacteria 15313
165 Ga0068865_100054769 3300006881 Bacteria 2773
166 Ga0068865_100475430 3300006881 Bacteria 1037
167 Ga0097620_100000323 3300006931 Bacteria 47637
168 Ga0097620_100144824 3300006931 Bacteria 2450
169 Ga0097620_100652049 3300006931 Bacteria 1145
170 Ga0105240_10101324 3300009093 Bacteria 3502
171 Ga0105240_10103780 3300009093 Bacteria 3453
172 Ga0105240_10467190 3300009093 Bacteria 1409
173 Ga0105245_10025298 3300009098 Bacteria 5219
174 Ga0105245_10322614 3300009098 Bacteria 1522
175 Ga0105247_10026946 3300009101 Bacteria 3474
176 Ga0105241_10366505 3300009174 Bacteria 1255
177 Ga0105242_10020007 3300009176 Bacteria 5245
178 Ga0105248_10000317 3300009177 Bacteria 57281
179 Ga0105248_10001470 3300009177 Bacteria 26223
180 Ga0105248_10032100 3300009177 Bacteria 5868
181 Ga0105248_10114736 3300009177 Bacteria 3038
182 Ga0105248_10197400 3300009177 Bacteria 2267
183 Ga0105248_10339056 3300009177 Bacteria 1692
184 Ga0105237_10030379 3300009545 Bacteria 5488
185 Ga0105237_10762828 3300009545 Bacteria 974
186 Ga0105238_10017298 3300009551 Bacteria 7325
187 Ga0105238_10061352 3300009551 Bacteria 3763
188 Ga0105238_10573789 3300009551 Bacteria 1134
189 Ga0105249_10142474 3300009553 Bacteria 2300
190 Ga0105239_10594404 3300010375 Bacteria 1262
191 Ga0105246_10000146 3300011119 Bacteria 33218
192 Ga0157373_10015599 3300013100 Bacteria 5552
193 Ga0157373_10077515 3300013100 Bacteria 2345
194 Ga0157373_10129514 3300013100 Bacteria 1774
195 Ga0157373_10146405 3300013100 Bacteria 1661
196 Ga0157373_10161191 3300013100 Bacteria 1578
197 Ga0157373_10305175 3300013100 Bacteria 1130
198 Ga0157371_10005066 3300013102 Bacteria 11255
199 Ga0157371_10021050 3300013102 Bacteria 4794
200 Ga0157371_10317737 3300013102 Bacteria 1130
201 Ga0157371_10422066 3300013102 Bacteria 978
202 Ga0157370_10136145 3300013104 Bacteria 2289
203 Ga0157370_10202870 3300013104 Unclassified 1839
204 Ga0157370_10369101 3300013104 Bacteria 1322
205 Ga0157370_10419344 3300013104 Bacteria 1231
206 Ga0157369_10048911 3300013105 Bacteria 4586
207 Ga0157369_10096033 3300013105 Bacteria 3162
208 Ga0157369_10127048 3300013105 Bacteria 2702
209 Ga0157369_10147624 3300013105 Bacteria 2486
210 Ga0157369_10278652 3300013105 Bacteria 1742
211 Ga0157369_10340130 3300013105 Bacteria 1559
212 Ga0157369_10363835 3300013105 Bacteria 1502
213 Ga0157374_10309843 3300013296 Bacteria 1563
214 Ga0157378_10055430 3300013297 Bacteria 3531
215 Ga0157378_10393503 3300013297 Bacteria 1364
216 Ga0163162_10284795 3300013306 Bacteria 1784
217 Ga0163162_10319193 3300013306 Bacteria 1686
218 Ga0163162_10534814 3300013306 Bacteria 1301
219 Ga0157372_10069548 3300013307 Bacteria 3959
220 Ga0157372_10084595 3300013307 Bacteria 3596
221 Ga0157372_10112370 3300013307 Bacteria 3121
222 Ga0157375_10054348 3300013308 Bacteria 3944
223 Ga0157375_10080329 3300013308 Bacteria 3299
224 Ga0157375_10102074 3300013308 Bacteria 2953
225 Ga0157375_10435848 3300013308 Bacteria 1476
226 Ga0157375_10987992 3300013308 Bacteria 982
227 Ga0163163_10023485 3300014325 Bacteria 5853
228 Ga0163163_10586457 3300014325 Bacteria 1178
229 Ga0157380_10596254 3300014326 Bacteria 1092
230 Ga0157379_10007629 3300014968 Bacteria 9363
231 Ga0157376_10015172 3300014969 Bacteria 5811
232 Ga0163161_10116785 3300017792 Bacteria 2001
233 Ga0213876_10125968 3300021384 Unclassified 1360
234 Ga0207697_10008345 3300025315 Bacteria 4538
235 Ga0207642_10002920 3300025899 Bacteria 5346
236 Ga0207688_10058005 3300025901 Bacteria 2178
237 Ga0207688_10084130 3300025901 Bacteria 1821
238 Ga0207680_10004033 3300025903 Bacteria 6939
239 Ga0207647_10001359 3300025904 Bacteria 18789
240 Ga0207647_10017143 3300025904 Bacteria 4930
241 Ga0207647_10021333 3300025904 Bacteria 4325
242 Ga0207647_10036000 3300025904 Bacteria 3148
243 Ga0207647_10108239 3300025904 Bacteria 1644
244 Ga0207699_10004514 3300025906 Bacteria 6648
245 Ga0207699_10331891 3300025906 Bacteria 1069
246 Ga0207645_10222910 3300025907 Bacteria 1243
247 Ga0207645_10268824 3300025907 Bacteria 1130
248 Ga0207643_10123908 3300025908 Bacteria 1533
249 Ga0207705_10001025 3300025909 Bacteria 22684
250 Ga0207705_10004798 3300025909 Bacteria 10181
251 Ga0207705_10012237 3300025909 Bacteria 6200
252 Ga0207705_10061137 3300025909 Bacteria 2721
253 Ga0207705_10266688 3300025909 Bacteria 1308
254 Ga0207695_10052845 3300025913 Bacteria 4253
255 Ga0207695_10369311 3300025913 Bacteria 1321
256 Ga0207693_10056604 3300025915 Bacteria 3074
257 Ga0207660_10011321 3300025917 Bacteria 5802
258 Ga0207660_10040534 3300025917 Bacteria 3261
259 Ga0207660_10283622 3300025917 Bacteria 1315
260 Ga0207660_10466697 3300025917 Bacteria 1022
261 Ga0207657_10001033 3300025919 Bacteria 29450
262 Ga0207657_10002829 3300025919 Bacteria 18641
263 Ga0207657_10007581 3300025919 Bacteria 11120
264 Ga0207657_10053432 3300025919 Bacteria 3500
265 Ga0207657_10138587 3300025919 Bacteria 1989
266 Ga0207657_10181602 3300025919 Bacteria 1701
267 Ga0207657_10198183 3300025919 Bacteria 1616
268 Ga0207649_10011423 3300025920 Bacteria 4898
269 Ga0207649_10033733 3300025920 Bacteria 3061
270 Ga0207649_10080189 3300025920 Bacteria 2110
271 Ga0207649_10128964 3300025920 Bacteria 1715
272 Ga0207649_10155714 3300025920 Bacteria 1578
273 Ga0207649_10583582 3300025920 Bacteria 858
274 Ga0207652_10123689 3300025921 Bacteria 2303
275 Ga0207652_10187429 3300025921 Bacteria 1860
276 Ga0207652_10210257 3300025921 Bacteria 1752
277 Ga0207681_10006363 3300025923 Bacteria 7251
278 Ga0207694_10033908 3300025924 Bacteria 3913
279 Ga0207694_10382658 3300025924 Bacteria 1168
280 Ga0207650_10016919 3300025925 Bacteria 5100
281 Ga0207650_10107190 3300025925 Bacteria 2158
282 Ga0207650_10138440 3300025925 Bacteria 1912
283 Ga0207650_10331769 3300025925 Bacteria 1248
284 Ga0207659_10191221 3300025926 Bacteria 1629
285 Ga0207687_10052586 3300025927 Bacteria 2843
286 Ga0207700_10090265 3300025928 Bacteria 2417
287 Ga0207664_10308233 3300025929 Bacteria 1394
288 Ga0207664_10617877 3300025929 Bacteria 974
289 Ga0207644_10000812 3300025931 Bacteria 19829
290 Ga0207644_10001056 3300025931 Bacteria 17616
291 Ga0207644_10026619 3300025931 Bacteria 3987
292 Ga0207644_10124742 3300025931 Bacteria 1964
293 Ga0207644_10132090 3300025931 Bacteria 1912
294 Ga0207690_10002009 3300025932 Bacteria 12458
295 Ga0207690_10089591 3300025932 Bacteria 2169
296 Ga0207690_10128355 3300025932 Bacteria 1852
297 Ga0207690_10476489 3300025932 Bacteria 1007
298 Ga0207706_10007017 3300025933 Bacteria 10415
299 Ga0207706_10045606 3300025933 Bacteria 3883
300 Ga0207706_10187227 3300025933 Bacteria 1817
301 Ga0207706_10239151 3300025933 Bacteria 1587
302 Ga0207706_10285437 3300025933 Bacteria 1439
303 Ga0207706_10322419 3300025933 Bacteria 1345
304 Ga0207686_10060207 3300025934 Bacteria 2402
305 Ga0207669_10052270 3300025937 Bacteria 2453
306 Ga0207669_10399349 3300025937 Bacteria 1076
307 Ga0207691_10004530 3300025940 Bacteria 13444
308 Ga0207691_10069186 3300025940 Bacteria 3189
309 Ga0207691_10211692 3300025940 Bacteria 1683
310 Ga0207691_10249698 3300025940 Bacteria 1532
311 Ga0207711_10000042 3300025941 Bacteria 158782
312 Ga0207711_10001129 3300025941 Bacteria 25496
313 Ga0207711_10030287 3300025941 Bacteria 4565
314 Ga0207711_10083341 3300025941 Bacteria 2797
315 Ga0207689_10035823 3300025942 Bacteria 4120
316 Ga0207661_10475840 3300025944 Bacteria 1140
317 Ga0207679_10054693 3300025945 Bacteria 2940
318 Ga0207679_10092909 3300025945 Bacteria 2338
319 Ga0207679_10150543 3300025945 Bacteria 1893
320 Ga0207679_10548191 3300025945 Bacteria 1037
321 Ga0207667_10022562 3300025949 Bacteria 6950
322 Ga0207667_10102149 3300025949 Bacteria 2958
323 Ga0207667_10488678 3300025949 Bacteria 1249
324 Ga0207651_10019206 3300025960 Bacteria 4088
325 Ga0207651_10105264 3300025960 Bacteria 2104
326 Ga0207651_10125996 3300025960 Bacteria 1951
327 Ga0207651_10334756 3300025960 Bacteria 1270
328 Ga0207712_10010393 3300025961 Bacteria 5908
329 Ga0207668_10116830 3300025972 Bacteria 2012
330 Ga0207668_10265399 3300025972 Bacteria 1401
331 Ga0207668_10599792 3300025972 Bacteria 959
332 Ga0207640_10013346 3300025981 Bacteria 4704
333 Ga0207640_10100102 3300025981 Bacteria 2030
334 Ga0207640_10104711 3300025981 Bacteria 1992
335 Ga0207640_10109680 3300025981 Bacteria 1953
336 Ga0207640_10441376 3300025981 Bacteria 1070
337 Ga0207658_10001726 3300025986 Bacteria 16505
338 Ga0207658_10019272 3300025986 Bacteria 4717
339 Ga0207658_10052568 3300025986 Bacteria 3007
340 Ga0207658_10058533 3300025986 Bacteria 2868
341 Ga0207677_10001109 3300026023 Bacteria 14687
342 Ga0207677_10060358 3300026023 Bacteria 2620
343 Ga0207677_10141186 3300026023 Bacteria 1844
344 Ga0207703_10002493 3300026035 Bacteria 15957
345 Ga0207703_10004252 3300026035 Bacteria 11788
346 Ga0207703_10025850 3300026035 Bacteria 4620
347 Ga0207703_10027874 3300026035 Bacteria 4448
348 Ga0207639_10001532 3300026041 Bacteria 15517
349 Ga0207639_10040276 3300026041 Bacteria 3486
350 Ga0207639_10072625 3300026041 Bacteria 2694
351 Ga0207678_10032565 3300026067 Bacteria 4542
352 Ga0207678_10103294 3300026067 Bacteria 2433
353 Ga0207678_10196169 3300026067 Bacteria 1726
354 Ga0207702_10045754 3300026078 Bacteria 3682
355 Ga0207702_10190578 3300026078 Bacteria 1894
356 Ga0207702_10365746 3300026078 Bacteria 1383
357 Ga0207702_10583129 3300026078 Bacteria 1096
358 Ga0207641_10000927 3300026088 Bacteria 30260
359 Ga0207641_10005228 3300026088 Bacteria 11106
360 Ga0207641_10095866 3300026088 Bacteria 2605
361 Ga0207641_10689141 3300026088 Bacteria 1005
362 Ga0207648_10050913 3300026089 Bacteria 3620
363 Ga0207648_10067463 3300026089 Bacteria 3118
364 Ga0207648_10128668 3300026089 Bacteria 2228
365 Ga0207676_10000435 3300026095 Bacteria 35291
366 Ga0207676_10014117 3300026095 Bacteria 5738
367 Ga0207676_10063777 3300026095 Bacteria 2927
368 Ga0207674_10004963 3300026116 Bacteria 15898
369 Ga0207674_10005701 3300026116 Bacteria 14768
370 Ga0207674_10036382 3300026116 Bacteria 5131
371 Ga0207674_10421258 3300026116 Bacteria 1290
372 Ga0207683_10003160 3300026121 Bacteria 14377
373 Ga0207683_10083281 3300026121 Bacteria 2842
374 Ga0207683_10364420 3300026121 Bacteria 1327
375 Ga0207698_10000327 3300026142 Bacteria 28178
376 Ga0207698_10044921 3300026142 Bacteria 3324
377 Ga0207698_10054891 3300026142 Bacteria 3067
378 Ga0207698_10278828 3300026142 Bacteria 1545
379 Ga0207698_10401805 3300026142 Unclassified 1309
380 Ga0207698_10702950 3300026142 Bacteria 1006
381 Ga0268266_10030535 3300028379 Bacteria 4579
382 Ga0268266_10129735 3300028379 Bacteria 2253
383 Ga0268265_10005486 3300028380 Bacteria 8657
384 Ga0268265_10091507 3300028380 Bacteria 2432
385 Ga0268265_10474512 3300028380 Bacteria 1173
386 Ga0268264_10003735 3300028381 Bacteria 13076
387 Ga0268264_10679832 3300028381 Bacteria 1021
388 Ga0307405_10005451 3300031731 Bacteria 6135
389 Ga0307405_10089403 3300031731 Bacteria 2035
390 Ga0307405_10169937 3300031731 Bacteria 1554
391 Ga0307413_10004297 3300031824 Bacteria 6176
392 Ga0307413_10022769 3300031824 Bacteria 3384
393 Ga0307413_10049362 3300031824 Bacteria 2521
394 Ga0307410_10005663 3300031852 Bacteria 6646
395 Ga0307410_10019223 3300031852 Bacteria 4150
396 Ga0307410_10023184 3300031852 Bacteria 3853
397 Ga0307410_10024988 3300031852 Bacteria 3740
398 Ga0307410_10130303 3300031852 Bacteria 1847
399 Ga0307407_10021846 3300031903 Bacteria 3308
400 Ga0307407_10059168 3300031903 Bacteria 2230
401 Ga0307407_10063241 3300031903 Bacteria 2170
402 Ga0307407_10245959 3300031903 Bacteria 1223
403 Ga0307412_10006725 3300031911 Bacteria 6518
404 Ga0307412_10021605 3300031911 Bacteria 3935
405 Ga0307412_10279153 3300031911 Bacteria 1311
406 Ga0307409_100015222 3300031995 Bacteria 5039
407 Ga0307409_100017667 3300031995 Bacteria 4763
408 Ga0307409_100032202 3300031995 Bacteria 3797
409 Ga0307409_100044576 3300031995 Bacteria 3342
410 Ga0307409_100046034 3300031995 Bacteria 3299
411 Ga0307409_100116962 3300031995 Bacteria 2248
412 Ga0307409_100646912 3300031995 Bacteria 1050
413 Ga0307416_100027149 3300032002 Bacteria 4234
414 Ga0307416_100033054 3300032002 Bacteria 3917
415 Ga0307416_100091939 3300032002 Bacteria 2607
416 Ga0307416_100557049 3300032002 Bacteria 1220
417 Ga0307414_10002293 3300032004 Bacteria 9998
418 Ga0307414_10067809 3300032004 Bacteria 2557
419 Ga0307414_10075767 3300032004 Bacteria 2442
420 Ga0307414_10133538 3300032004 Bacteria 1931
421 Ga0307411_10009166 3300032005 Bacteria 5183
422 Ga0307411_10015292 3300032005 Bacteria 4304
423 Ga0307411_10034123 3300032005 Bacteria 3163
424 Ga0307411_10082111 3300032005 Bacteria 2221
425 Ga0307411_10091771 3300032005 Bacteria 2122
426 Ga0307415_100016130 3300032126 Bacteria 4444
427 Ga0307415_100122251 3300032126 Bacteria 1954
428 Ga0307415_100241308 3300032126 Bacteria 1462
429 Ga0373923_0014588 3300035111 Bacteria 2955
430 Ga0373943_0004701 3300035170 Bacteria 6176
431 Ga0373946_0003717 3300035171 Bacteria 5407
432 Ga0373931_0036636 3300035691 Bacteria 2558
433 Ga0373935_0086354 3300035692 Bacteria 2047
434 Ga0373935_0349239 3300035692 Bacteria 1054
435 Ga0373927_0076860 3300035695 Bacteria 2162
436 Ga0373933_0023043 3300035724 Bacteria 3553
437 Ga0373947_0136797 3300035725 Bacteria 1568
438 Ga0373937_0005777 3300036401 Bacteria 10636
439 Ga0373925_0206635 3300037068 Bacteria 1563
440 Ga0395899_0001992 3300037312 Bacteria 16809
441 Ga0395899_0081754 3300037312 Bacteria 2350
442 Ga0395899_0197415 3300037312 Bacteria 1405
443 Ga0395899_0218493 3300037312 Bacteria 1321
444 Ga0395899_0256786 3300037312 Bacteria 1197
445 Ga0395899_0282692 3300037312 Unclassified 1128
446 Ga0395900_0002824 3300037418 Bacteria 18957
447 Ga0395900_0033868 3300037418 Bacteria 5257
448 Ga0395900_0062720 3300037418 Bacteria 3820
449 Ga0395900_0072606 3300037418 Bacteria 3537
450 Ga0395900_0157609 3300037418 Bacteria 2318
451 Ga0395900_0190639 3300037418 Bacteria 2079
452 Ga0395900_0367720 3300037418 Bacteria 1408
453 Ga0395900_0371107 3300037418 Bacteria 1401
454 Ga0395900_0492256 3300037418 Bacteria 1177
455 Ga0395900_0593781 3300037418 Bacteria 1048
456 Ga0395898_0021593 3300037466 Bacteria 6524
457 Ga0395898_0079682 3300037466 Bacteria 3159
458 Ga0395898_0292356 3300037466 Bacteria 1554
459 Ga0395898_0542829 3300037466 Bacteria 1104
460 Ga0395898_0570933 3300037466 Bacteria 1073
461 Ga0395905_0003068 3300037471 Bacteria 18077
462 Ga0395905_0009729 3300037471 Bacteria 9380
463 Ga0395905_0026284 3300037471 Bacteria 5489
464 Ga0395905_0033920 3300037471 Bacteria 4794
465 Ga0395905_0047388 3300037471 Bacteria 4028
466 Ga0395905_0068336 3300037471 Bacteria 3328
467 Ga0395905_0119527 3300037471 Bacteria 2476
468 Ga0395905_0191518 3300037471 Bacteria 1918
469 Ga0395905_0214571 3300037471 Bacteria 1802
470 Ga0395905_0318316 3300037471 Bacteria 1445
471 Ga0395905_0406413 3300037471 Bacteria 1257
472 Ga0395905_0564974 3300037471 Bacteria 1039
473 Ga0395905_0624233 3300037471 Bacteria 980
474 Ga0395901_0028057 3300038443 Bacteria 5789
475 Ga0395901_0042635 3300038443 Bacteria 4705
476 Ga0395901_0169398 3300038443 Bacteria 2291
477 Ga0395901_0309887 3300038443 Bacteria 1635
478 Ga0395901_0423103 3300038443 Bacteria 1365
479 Ga0395901_0449230 3300038443 Bacteria 1318
480 Ga0395901_0823542 3300038443 Unclassified 915
481 Ga0436365_0741130 3300039437 Bacteria 1842
482 Ga0439432_012201 3300042006 Bacteria 2946
483 Ga0439432_020575 3300042006 Bacteria 2192
484 Ga0439464_0002322 3300042439 Bacteria 4657
485 Ga0466972_0089118 3300044658 Bacteria 1464
486 Ga0466966_0016913 3300044684 Bacteria 4821
487 Ga0466961_0018968 3300044693 Bacteria 4427
488 Ga0466963_0003989 3300044694 Bacteria 8537
489 Ga0466963_0024836 3300044694 Bacteria 3816
490 Ga0466963_0222664 3300044694 Bacteria 1321
491 Ga0466963_0509076 3300044694 Unclassified 850
492 Ga0466957_0000132 3300044842 Bacteria 31445
493 Ga0466957_0017456 3300044842 Bacteria 4204
494 Ga0466959_0327643 3300045049 Bacteria 1046
495 Ga0466958_0092485 3300045836 Bacteria 1872
496 Ga0466958_0149486 3300045836 Bacteria 1473
497 Ga0466958_0158043 3300045836 Bacteria 1431
498 Ga0466958_0197335 3300045836 Bacteria 1280
499 Ga0466967_0046479 3300045976 Bacteria 3779
500 Ga0466967_0050293 3300045976 Bacteria 3649
501 Ga0466967_0072196 3300045976 Bacteria 3093
502 Ga0466967_0238021 3300045976 Bacteria 1735
503 Ga0466967_0292302 3300045976 Bacteria 1566
504 Ga0466967_0550672 3300045976 Bacteria 1135
505 Ga0495598_0006860 3300046537 Bacteria 2585
506 Ga0495621_0000038 3300046539 Bacteria 25465
507 Ga0495669_0092819 3300046684 Bacteria 1395
508 Ga0495669_0156026 3300046684 Bacteria 1082
509 Ga0495670_0007185 3300046691 Bacteria 5481
510 Ga0495602_0216528 3300048088 Bacteria 1449
511 Ga0496100_0263253 3300048903 Bacteria 1279
512 Ga0496100_0540346 3300048903 Bacteria 901
513 Ga0496101_0000725 3300048904 Bacteria 19617
514 Ga0496102_0081238 3300048905 Bacteria 2988
515 Ga0496103_0089620 3300048906 Bacteria 1940
516 Ga0496104_0039447 3300048907 Bacteria 4422
517 Ga0496106_0055586 3300048909 Bacteria 2992
518 Ga0496107_0018573 3300048910 Bacteria 4897
519 Ga0496108_0004560 3300048911 Bacteria 11160
520 Ga0496108_0020760 3300048911 Bacteria 5399
521 Ga0496109_0020198 3300048912 Bacteria 5882
522 Ga0496110_0009308 3300048913 Bacteria 7946
523 Ga0496110_0035906 3300048913 Bacteria 4304
524 Ga0496111_0005960 3300048914 Bacteria 7863
525 Ga0496112_0005511 3300048915 Bacteria 10958
526 Ga0496112_0019967 3300048915 Bacteria 6341
527 Ga0496112_0035654 3300048915 Bacteria 4848
528 Ga0496112_0529794 3300048915 Bacteria 1112
529 Ga0496113_0006947 3300048916 Bacteria 7233
530 Ga0496113_0009135 3300048916 Bacteria 6496
531 Ga0496113_0105696 3300048916 Bacteria 2186
532 Ga0496114_0000381 3300048917 Bacteria 32736
533 Ga0501067_0078488 3300049583 Bacteria 1830
534 Ga0501267_000936 3300049764 Bacteria 2398
535 Ga0501268_003185 3300049765 Bacteria 2227
536 Ga0590075_032105 3300059424 Bacteria 1332
537 Ga0466962_0007589 3300061719 Bacteria 5203
538 8054302958 8054302542 Bacteria 5698134
539 Ga0157371_10081492
540 JGI24736J21556_1006357
541 JGI24740J21852_10033410
542 JGI24739J22299_10003508
543 JGI24737J22298_10035693
544 JGI24743J22301_10006225
545 JGI24745J21846_1000320
546 JGI24738J21930_10016101
547 JGI24744J21845_10001176
548 Ga0065715_10023864
549 Ga0070658_10030078
550 Ga0070658_10241649
551 Ga0070658_10263215
552 Ga0070658_10441670
553 Ga0070676_10270303
554 Ga0070683_100007562
555 Ga0070683_100132886
556 Ga0070683_100465238
557 Ga0070690_100011960
558 Ga0070690_100018834
559 Ga0070670_100019731
560 Ga0070670_100106439
561 Ga0070677_10063613
562 Ga0070666_10001395
563 Ga0070666_10072281
564 Ga0070666_10299218
565 Ga0070680_100058798
566 Ga0070680_100127793
567 Ga0070680_100165145
568 Ga0070680_100206759
569 Ga0070680_100438228
570 Ga0068868_100062661
571 Ga0068868_100313774
572 Ga0070660_100025462
573 Ga0070660_100028978
574 Ga0070660_100127611
575 Ga0070660_100187603
576 Ga0070660_100299409
577 Ga0070689_100357935
578 Ga0070691_10002189
579 Ga0070687_100032179
580 Ga0070661_100023500
581 Ga0070661_100036027
582 Ga0070661_100119197
583 Ga0070661_100211871
584 Ga0070661_100240290
585 Ga0070661_100245007
586 Ga0070661_100324829
587 Ga0070668_100315104
588 Ga0070669_100014919
589 Ga0070669_100157857
590 Ga0070669_100239667
591 Ga0070669_100349396
592 Ga0070669_100542031
593 Ga0070675_100025479
594 Ga0070675_100053989
595 Ga0070675_100106223
596 Ga0070671_100014601
597 Ga0070671_100015435
598 Ga0070671_100031784
599 Ga0070671_100038799
600 Ga0070671_100060998
601 Ga0070671_100336349
602 Ga0070671_100514362
603 Ga0070671_100542337
604 Ga0070674_100032421
605 Ga0070674_100451676
606 Ga0070673_100014433
607 Ga0070673_100031327
608 Ga0070673_100088096
609 Ga0070659_100039961
610 Ga0070659_100049885
611 Ga0070659_100142601
612 Ga0070659_100144683
613 Ga0070659_100149562
614 Ga0070659_100157001
615 Ga0070659_100440096
616 Ga0070667_100032353
617 Ga0070667_100560702
618 Ga0070709_10010183
619 Ga0070709_10216098
620 Ga0070714_100366116
621 Ga0070663_100062570
622 Ga0070663_100124167
623 Ga0070663_100159168
624 Ga0070663_100159358
625 Ga0070678_100041301
626 Ga0070678_100103354
627 Ga0070678_100221364
628 Ga0070662_100001441
629 Ga0070662_100037523
630 Ga0070662_100082306
631 Ga0070662_100180490
632 Ga0070662_100258811
633 Ga0070662_100334033
634 Ga0070681_10039748
635 Ga0070681_10137476
636 Ga0068867_100097371
637 Ga0070679_100035831
638 Ga0070679_100206141
639 Ga0070679_100514053
640 Ga0068853_100535425
641 Ga0070672_100028479
642 Ga0070672_100049781
643 Ga0070672_100078423
644 Ga0070672_100262626
645 Ga0070686_100060121
646 Ga0070693_100258307
647 Ga0070665_100081102
648 Ga0070665_100099618
649 Ga0070665_100200583
650 Ga0068855_100188219
651 Ga0068855_100531132
652 Ga0068855_100609385
653 Ga0070664_100011917
654 Ga0070664_100349601
655 Ga0070664_100429806
656 Ga0068857_100134241
657 Ga0068857_100484356
658 Ga0068854_100095860
659 Ga0068854_100108646
660 Ga0068854_100216978
661 Ga0068854_100342926
662 Ga0068856_100047062
663 Ga0068856_100393229
664 Ga0068856_100450722
665 Ga0070702_100078492
666 Ga0068852_100038915
667 Ga0068852_100043796
668 Ga0068852_100054773
669 Ga0068852_100058299
670 Ga0068852_100304452
671 Ga0068859_100000323
672 Ga0068859_100144840
673 Ga0068859_100652032
674 Ga0068864_100002687
675 Ga0068864_100063914
676 Ga0068864_100135466
677 Ga0068866_10004717
678 Ga0068866_10148238
679 Ga0068851_10029088
680 Ga0068851_10035113
681 Ga0068851_10122181
682 Ga0068863_100000759
683 Ga0068863_100007621
684 Ga0068863_100029420
685 Ga0068863_100133555
686 Ga0068863_100153278
687 Ga0068858_100002458
688 Ga0068858_100046039
689 Ga0068858_100103391
690 Ga0068860_100017076
691 Ga0068860_100220209
692 Ga0068860_100518695
693 Ga0068862_100034489
694 Ga0068862_100201838
695 Ga0068862_100368521
696 Ga0070717_10077902
697 Ga0070716_100137904
698 Ga0070712_100133979
699 Ga0097621_100004234
700 Ga0068871_100063333
701 Ga0068871_100595026
702 Ga0075433_10002017
703 Ga0068865_100054769
704 Ga0068865_100475430
705 Ga0097620_100000323
706 Ga0097620_100144824
707 Ga0097620_100652049
708 Ga0105240_10101324
709 Ga0105240_10103780
710 Ga0105240_10467190
711 Ga0105245_10025298
712 Ga0105245_10322614
713 Ga0105247_10026946
714 Ga0105241_10366505
715 Ga0105242_10020007
716 Ga0105248_10000317
717 Ga0105248_10001470
718 Ga0105248_10032100
719 Ga0105248_10114736
720 Ga0105248_10197400
721 Ga0105248_10339056
722 Ga0105237_10030379
723 Ga0105237_10762828
724 Ga0105238_10017298
725 Ga0105238_10061352
726 Ga0105238_10573789
727 Ga0105249_10142474
728 Ga0105239_10594404
729 Ga0105246_10000146
730 Ga0157373_10015599
731 Ga0157373_10077515
732 Ga0157373_10129514
733 Ga0157373_10146405
734 Ga0157373_10161191
735 Ga0157373_10305175
736 Ga0157371_10005066
737 Ga0157371_10021050
738 Ga0157371_10317737
739 Ga0157371_10422066
740 Ga0157370_10136145
741 Ga0157370_10202870
742 Ga0157370_10369101
743 Ga0157370_10419344
744 Ga0157369_10048911
745 Ga0157369_10096033
746 Ga0157369_10127048
747 Ga0157369_10147624
748 Ga0157369_10278652
749 Ga0157369_10340130
750 Ga0157369_10363835
751 Ga0157374_10309843
752 Ga0157378_10055430
753 Ga0157378_10393503
754 Ga0163162_10284795
755 Ga0163162_10319193
756 Ga0163162_10534814
757 Ga0157372_10069548
758 Ga0157372_10084595
759 Ga0157372_10112370
760 Ga0157375_10054348
761 Ga0157375_10080329
762 Ga0157375_10102074
763 Ga0157375_10435848
764 Ga0157375_10987992
765 Ga0163163_10023485
766 Ga0163163_10586457
767 Ga0157380_10596254
768 Ga0157379_10007629
769 Ga0157376_10015172
770 Ga0163161_10116785
771 Ga0213876_10125968
772 Ga0207697_10008345
773 Ga0207642_10002920
774 Ga0207688_10058005
775 Ga0207688_10084130
776 Ga0207680_10004033
777 Ga0207647_10001359
778 Ga0207647_10017143
779 Ga0207647_10021333
780 Ga0207647_10036000
781 Ga0207647_10108239
782 Ga0207699_10004514
783 Ga0207699_10331891
784 Ga0207645_10222910
785 Ga0207645_10268824
786 Ga0207643_10123908
787 Ga0207705_10001025
788 Ga0207705_10004798
789 Ga0207705_10012237
790 Ga0207705_10061137
791 Ga0207705_10266688
792 Ga0207695_10052845
793 Ga0207695_10369311
794 Ga0207693_10056604
795 Ga0207660_10011321
796 Ga0207660_10040534
797 Ga0207660_10283622
798 Ga0207660_10466697
799 Ga0207657_10001033
800 Ga0207657_10002829
801 Ga0207657_10007581
802 Ga0207657_10053432
803 Ga0207657_10138587
804 Ga0207657_10181602
805 Ga0207657_10198183
806 Ga0207649_10011423
807 Ga0207649_10033733
808 Ga0207649_10080189
809 Ga0207649_10128964
810 Ga0207649_10155714
811 Ga0207649_10583582
812 Ga0207652_10123689
813 Ga0207652_10187429
814 Ga0207652_10210257
815 Ga0207681_10006363
816 Ga0207694_10033908
817 Ga0207694_10382658
818 Ga0207650_10016919
819 Ga0207650_10107190
820 Ga0207650_10138440
821 Ga0207650_10331769
822 Ga0207659_10191221
823 Ga0207687_10052586
824 Ga0207700_10090265
825 Ga0207664_10308233
826 Ga0207664_10617877
827 Ga0207644_10000812
828 Ga0207644_10001056
829 Ga0207644_10026619
830 Ga0207644_10124742
831 Ga0207644_10132090
832 Ga0207690_10002009
833 Ga0207690_10089591
834 Ga0207690_10128355
835 Ga0207690_10476489
836 Ga0207706_10007017
837 Ga0207706_10045606
838 Ga0207706_10187227
839 Ga0207706_10239151
840 Ga0207706_10285437
841 Ga0207706_10322419
842 Ga0207686_10060207
843 Ga0207669_10052270
844 Ga0207669_10399349
845 Ga0207691_10004530
846 Ga0207691_10069186
847 Ga0207691_10211692
848 Ga0207691_10249698
849 Ga0207711_10000042
850 Ga0207711_10001129
851 Ga0207711_10030287
852 Ga0207711_10083341
853 Ga0207689_10035823
854 Ga0207661_10475840
855 Ga0207679_10054693
856 Ga0207679_10092909
857 Ga0207679_10150543
858 Ga0207679_10548191
859 Ga0207667_10022562
860 Ga0207667_10102149
861 Ga0207667_10488678
862 Ga0207651_10019206
863 Ga0207651_10105264
864 Ga0207651_10125996
865 Ga0207651_10334756
866 Ga0207712_10010393
867 Ga0207668_10116830
868 Ga0207668_10265399
869 Ga0207668_10599792
870 Ga0207640_10013346
871 Ga0207640_10100102
872 Ga0207640_10104711
873 Ga0207640_10109680
874 Ga0207640_10441376
875 Ga0207658_10001726
876 Ga0207658_10019272
877 Ga0207658_10052568
878 Ga0207658_10058533
879 Ga0207677_10001109
880 Ga0207677_10060358
881 Ga0207677_10141186
882 Ga0207703_10002493
883 Ga0207703_10004252
884 Ga0207703_10025850
885 Ga0207703_10027874
886 Ga0207639_10001532
887 Ga0207639_10040276
888 Ga0207639_10072625
889 Ga0207678_10032565
890 Ga0207678_10103294
891 Ga0207678_10196169
892 Ga0207702_10045754
893 Ga0207702_10190578
894 Ga0207702_10365746
895 Ga0207702_10583129
896 Ga0207641_10000927
897 Ga0207641_10005228
898 Ga0207641_10095866
899 Ga0207641_10689141
900 Ga0207648_10050913
901 Ga0207648_10067463
902 Ga0207648_10128668
903 Ga0207676_10000435
904 Ga0207676_10014117
905 Ga0207676_10063777
906 Ga0207674_10004963
907 Ga0207674_10005701
908 Ga0207674_10036382
909 Ga0207674_10421258
910 Ga0207683_10003160
911 Ga0207683_10083281
912 Ga0207683_10364420
913 Ga0207698_10000327
914 Ga0207698_10044921
915 Ga0207698_10054891
916 Ga0207698_10278828
917 Ga0207698_10401805
918 Ga0207698_10702950
919 Ga0268266_10030535
920 Ga0268266_10129735
921 Ga0268265_10005486
922 Ga0268265_10091507
923 Ga0268265_10474512
924 Ga0268264_10003735
925 Ga0268264_10679832
926 Ga0307405_10005451
927 Ga0307405_10089403
928 Ga0307405_10169937
929 Ga0307413_10004297
930 Ga0307413_10022769
931 Ga0307413_10049362
932 Ga0307410_10005663
933 Ga0307410_10019223
934 Ga0307410_10023184
935 Ga0307410_10024988
936 Ga0307410_10130303
937 Ga0307407_10021846
938 Ga0307407_10059168
939 Ga0307407_10063241
940 Ga0307407_10245959
941 Ga0307412_10006725
942 Ga0307412_10021605
943 Ga0307412_10279153
944 Ga0307409_100015222
945 Ga0307409_100017667
946 Ga0307409_100032202
947 Ga0307409_100044576
948 Ga0307409_100046034
949 Ga0307409_100116962
950 Ga0307409_100646912
951 Ga0307416_100027149
952 Ga0307416_100033054
953 Ga0307416_100091939
954 Ga0307416_100557049
955 Ga0307414_10002293
956 Ga0307414_10067809
957 Ga0307414_10075767
958 Ga0307414_10133538
959 Ga0307411_10009166
960 Ga0307411_10015292
961 Ga0307411_10034123
962 Ga0307411_10082111
963 Ga0307411_10091771
964 Ga0307415_100016130
965 Ga0307415_100122251
966 Ga0307415_100241308
967 Ga0373923_0014588
968 Ga0373943_0004701
969 Ga0373946_0003717
970 Ga0373931_0036636
971 Ga0373935_0086354
972 Ga0373935_0349239
973 Ga0373927_0076860
974 Ga0373933_0023043
975 Ga0373947_0136797
976 Ga0373937_0005777
977 Ga0373925_0206635
978 Ga0395899_0001992
979 Ga0395899_0081754
980 Ga0395899_0197415
981 Ga0395899_0218493
982 Ga0395899_0256786
983 Ga0395899_0282692
984 Ga0395900_0002824
985 Ga0395900_0033868
986 Ga0395900_0062720
987 Ga0395900_0072606
988 Ga0395900_0157609
989 Ga0395900_0190639
990 Ga0395900_0367720
991 Ga0395900_0371107
992 Ga0395900_0492256
993 Ga0395900_0593781
994 Ga0395898_0021593
995 Ga0395898_0079682
996 Ga0395898_0292356
997 Ga0395898_0542829
998 Ga0395898_0570933
999 Ga0395905_0003068
1000 Ga0395905_0009729
1001 Ga0395905_0026284
1002 Ga0395905_0033920
1003 Ga0395905_0047388
1004 Ga0395905_0068336
1005 Ga0395905_0119527
1006 Ga0395905_0191518
1007 Ga0395905_0214571
1008 Ga0395905_0318316
1009 Ga0395905_0406413
1010 Ga0395905_0564974
1011 Ga0395905_0624233
1012 Ga0395901_0028057
1013 Ga0395901_0042635
1014 Ga0395901_0169398
1015 Ga0395901_0309887
1016 Ga0395901_0423103
1017 Ga0395901_0449230
1018 Ga0395901_0823542
1019 Ga0436365_0741130
1020 Ga0439432_012201
1021 Ga0439432_020575
1022 Ga0439464_0002322
1023 Ga0466972_0089118
1024 Ga0466966_0016913
1025 Ga0466961_0018968
1026 Ga0466963_0003989
1027 Ga0466963_0024836
1028 Ga0466963_0222664
1029 Ga0466963_0509076
1030 Ga0466957_0000132
1031 Ga0466957_0017456
1032 Ga0466959_0327643
1033 Ga0466958_0092485
1034 Ga0466958_0149486
1035 Ga0466958_0158043
1036 Ga0466958_0197335
1037 Ga0466967_0046479
1038 Ga0466967_0050293
1039 Ga0466967_0072196
1040 Ga0466967_0238021
1041 Ga0466967_0292302
1042 Ga0466967_0550672
1043 Ga0495598_0006860
1044 Ga0495621_0000038
1045 Ga0495669_0092819
1046 Ga0495669_0156026
1047 Ga0495670_0007185
1048 Ga0495602_0216528
1049 Ga0496100_0263253
1050 Ga0496100_0540346
1051 Ga0496101_0000725
1052 Ga0496102_0081238
1053 Ga0496103_0089620
1054 Ga0496104_0039447
1055 Ga0496106_0055586
1056 Ga0496107_0018573
1057 Ga0496108_0004560
1058 Ga0496108_0020760
1059 Ga0496109_0020198
1060 Ga0496110_0009308
1061 Ga0496110_0035906
1062 Ga0496111_0005960
1063 Ga0496112_0005511
1064 Ga0496112_0019967
1065 Ga0496112_0035654
1066 Ga0496112_0529794
1067 Ga0496113_0006947
1068 Ga0496113_0009135
1069 Ga0496113_0105696
1070 Ga0496114_0000381
1071 Ga0501067_0078488
1072 Ga0501267_000936
1073 Ga0501268_003185
1074 Ga0590075_032105
1075 Ga0466962_0007589
1076 8054302958

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u9r-assembly1.cif.gz_A structure of the n-terminal extension from cupriavidus metallidurans czcp 0.8333 131 165
7si3-assembly1.cif.gz_A consensus structure of atp7b 0.7592 134 164
2ia0-assembly1.cif.gz_A transcriptional regulatory protein pf0864 from pyrococcus furiosus a member of the asnc family (pf0864) 0.7567 133 164
6ff1-assembly1.cif.gz_A csoz metallochaperone 0.7427 132 164
2ia0-assembly1.cif.gz_B transcriptional regulatory protein pf0864 from pyrococcus furiosus a member of the asnc family (pf0864) 0.7413 133 164
ID Description Score Start End Superfamily
4u9rA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8267 131 164 3.30.70.100
af_P9WFW5_3_109_3.30.1360.70 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Arginyl tRNA synthetase N-terminal domain 0.7806 140 162 3.30.1360.70
af_Q9C5D3_169_235_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7723 132 166 3.30.70.100
af_A4I980_10_84_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7492 129 164 3.30.70.100
2ia0B02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.7413 133 164 3.30.70.920
ID Description Score Start End GO Terms
AF-A0A418Q0I9-F1-model_v4 Uncharacterized protein 0.9103 144 280
AF-A0A418Q0I9-F1-model_v4 Uncharacterized protein 0.8977 144 280
AF-A0A7H0G9E1-F1-model_v4 deleted 0.8839 103 282
AF-A0A7H0G9E1-F1-model_v4 deleted 0.8746 103 282
AF-A0A2U1G2T5-F1-model_v4 deleted 0.8422 1 280

Map