F460926

General Info

Members Datasets Scaffolds Average Seq Length
537 219 1074 336

Family's Representative Sequence

Representative Sequence 3300035118|Ga0373954_0091988|Ga0373954_0091988_42_1256
Length 391
Sequence MPYATRGFSSEPMIPERLFRLTSEAAGRDAEIFGSPGRVAGCRFVRERRDGAGTGGLMSQVDGVSGQPAILVEGLTKSFGDVRALRGIDLSVPRGTVLGVLGPNGAGKTTAVRILTTLLLPDEGQALVEGYDVVRQAAAVRRSIGLAGQSAAIQEELTGRENLEIVGRLYHLSWPQARSRATELLEQFDLTDAADRAAKNYSGGMQRRLDLAASLVGQPKVLFLDEPTTGLDPRSRLGMWDIIRSLAADGTTLLLTTQYLDEADELADEIVVIDHGLVIAAGTAEELKGRVGGDVVEFTVPDRGLIGDAVSAVTKIGETEPIADSETGVVSIRVGSRGSDALVETVRALDAAGLETRGLAMRRPSLDDVFLALTGHAAGAKRGKDMERTAS

Samples

Sample ID Description Type Environment
1 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
91 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
92 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
93 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
94 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
95 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
96 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
97 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
98 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
99 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
101 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
103 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
104 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
105 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
108 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
109 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
110 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
111 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
119 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
165 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
168 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
207 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
210 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
211 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
212 2643221649 Leifsonia sp. Root4 Isolate Unclassified
213 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
214 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
215 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
216 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
217 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
218 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
219 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.72
Metatranscriptomes 2.42
Isolates 1.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.35
Rhizosphere 92.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373954_0091988 3300035118 Bacteria 1457
2 Ga0070683_100039876 3300005329 Bacteria 4314
3 Ga0070683_100180504 3300005329 Bacteria 2003
4 Ga0070680_100001066 3300005336 Bacteria 19665
5 Ga0070680_100059901 3300005336 Bacteria 3116
6 Ga0070680_100129990 3300005336 Bacteria 2106
7 Ga0070682_100079737 3300005337 Bacteria 2115
8 Ga0068868_100211686 3300005338 Bacteria 1620
9 Ga0070660_100118362 3300005339 Bacteria 2113
10 Ga0070691_10034393 3300005341 Bacteria 2385
11 Ga0070671_100054052 3300005355 Bacteria 3338
12 Ga0070709_10000381 3300005434 Bacteria 27425
13 Ga0070709_10019463 3300005434 Bacteria 3925
14 Ga0070709_10181966 3300005434 Bacteria 1476
15 Ga0070714_100000551 3300005435 Bacteria 27034
16 Ga0070714_100006524 3300005435 Bacteria 9020
17 Ga0070714_100038741 3300005435 Bacteria 4008
18 Ga0070714_100311695 3300005435 Bacteria 1469
19 Ga0070713_100000809 3300005436 Bacteria 20063
20 Ga0070713_100055425 3300005436 Bacteria 3294
21 Ga0070713_100176395 3300005436 Bacteria 1918
22 Ga0070713_100420218 3300005436 Bacteria 1251
23 Ga0070710_10000101 3300005437 Bacteria 39498
24 Ga0070710_10001653 3300005437 Bacteria 10524
25 Ga0070710_10094595 3300005437 Bacteria 1768
26 Ga0070710_10129191 3300005437 Bacteria 1538
27 Ga0070711_100001082 3300005439 Bacteria 14544
28 Ga0070711_100034560 3300005439 Bacteria 3373
29 Ga0070711_100095042 3300005439 Bacteria 2156
30 Ga0070711_100272318 3300005439 Bacteria 1336
31 Ga0070705_100008219 3300005440 Bacteria 5163
32 Ga0070705_100012714 3300005440 Bacteria 4288
33 Ga0070694_100227598 3300005444 Bacteria 1401
34 Ga0070708_100007977 3300005445 Bacteria 8481
35 Ga0070681_10000154 3300005458 Bacteria 52563
36 Ga0070681_10010006 3300005458 Bacteria 9349
37 Ga0070706_100002164 3300005467 Bacteria 19999
38 Ga0070706_100009817 3300005467 Bacteria 8897
39 Ga0070706_100010717 3300005467 Bacteria 8509
40 Ga0070706_100014825 3300005467 Bacteria 7204
41 Ga0070706_100125478 3300005467 Bacteria 2393
42 Ga0070706_100150439 3300005467 Bacteria 2173
43 Ga0070706_100193464 3300005467 Bacteria 1900
44 Ga0070707_100006563 3300005468 Bacteria 10794
45 Ga0070707_100021819 3300005468 Bacteria 6053
46 Ga0070707_100042199 3300005468 Bacteria 4367
47 Ga0070707_100046164 3300005468 Bacteria 4169
48 Ga0070707_100072321 3300005468 Bacteria 3323
49 Ga0070698_100008715 3300005471 Bacteria 10927
50 Ga0070698_100016014 3300005471 Bacteria 7919
51 Ga0070698_100029195 3300005471 Bacteria 5725
52 Ga0070698_100043942 3300005471 Bacteria 4578
53 Ga0070698_100111281 3300005471 Bacteria 2703
54 Ga0070698_100161852 3300005471 Bacteria 2181
55 Ga0070699_100002684 3300005518 Bacteria 15905
56 Ga0070699_100003487 3300005518 Bacteria 13905
57 Ga0070699_100054044 3300005518 Bacteria 3476
58 Ga0070699_100252748 3300005518 Bacteria 1575
59 Ga0070679_100000586 3300005530 Bacteria 30810
60 Ga0070697_100001402 3300005536 Bacteria 18271
61 Ga0070697_100059692 3300005536 Bacteria 3107
62 Ga0068853_100032808 3300005539 Bacteria 4401
63 Ga0070665_100161954 3300005548 Bacteria 2239
64 Ga0070665_100348734 3300005548 Bacteria 1485
65 Ga0070704_100072114 3300005549 Bacteria 2512
66 Ga0070664_100101981 3300005564 Bacteria 2496
67 Ga0068857_100081945 3300005577 Bacteria 2881
68 Ga0068856_100022779 3300005614 Bacteria 6091
69 Ga0068856_100061826 3300005614 Bacteria 3699
70 Ga0068861_100094608 3300005719 Bacteria 2364
71 Ga0081540_1000089 3300005983 Bacteria 97819
72 Ga0081540_1000773 3300005983 Bacteria 29354
73 Ga0081540_1036927 3300005983 Bacteria 2597
74 Ga0081539_10003765 3300005985 Bacteria 17969
75 Ga0081539_10010031 3300005985 Bacteria 7793
76 Ga0070717_10000904 3300006028 Bacteria 19711
77 Ga0070717_10005375 3300006028 Bacteria 9343
78 Ga0070717_10040622 3300006028 Bacteria 3789
79 Ga0070717_10083869 3300006028 Bacteria 2680
80 Ga0070715_10000215 3300006163 Bacteria 13666
81 Ga0070715_10038418 3300006163 Bacteria 1987
82 Ga0070715_10139578 3300006163 Bacteria 1176
83 Ga0070716_100000500 3300006173 Bacteria 16318
84 Ga0070716_100000908 3300006173 Bacteria 12800
85 Ga0070716_100064449 3300006173 Bacteria 2131
86 Ga0070716_100110358 3300006173 Bacteria 1703
87 Ga0070712_100000986 3300006175 Bacteria 17090
88 Ga0070712_100026850 3300006175 Bacteria 3840
89 Ga0070712_100134276 3300006175 Bacteria 1879
90 Ga0070712_100218684 3300006175 Bacteria 1507
91 Ga0097621_100354932 3300006237 Bacteria 1305
92 Ga0075433_10025965 3300006852 Bacteria 4955
93 Ga0075433_10086373 3300006852 Bacteria 2770
94 Ga0075434_100018227 3300006871 Bacteria 6780
95 Ga0075436_100008953 3300006914 Bacteria 6851
96 Ga0075436_100019220 3300006914 Bacteria 4681
97 Ga0075436_100107335 3300006914 Bacteria 1947
98 Ga0075435_100082945 3300007076 Bacteria 2635
99 Ga0075435_100090284 3300007076 Bacteria 2527
100 Ga0099794_10087230 3300007265 Bacteria 1546
101 Ga0105251_10055040 3300009011 Bacteria 1887
102 Ga0114129_10003360 3300009147 Bacteria 22468
103 Ga0114129_10345674 3300009147 Bacteria 1972
104 Ga0105248_10272337 3300009177 Bacteria 1906
105 Ga0105237_10139368 3300009545 Bacteria 2420
106 Ga0099796_10045820 3300010159 Bacteria 1499
107 Ga0157371_10086691 3300013102 Bacteria 2217
108 Ga0157372_10452298 3300013307 Bacteria 1497
109 Ga0157375_10655415 3300013308 Bacteria 1206
110 Ga0157376_10139853 3300014969 Bacteria 2171
111 Ga0197907_10907238 3300020069 Bacteria 1937
112 Ga0197907_11137400 3300020069 Bacteria 1234
113 Ga0206356_11567571 3300020070 Bacteria 1354
114 Ga0206356_11845457 3300020070 Bacteria 2309
115 Ga0206349_1617336 3300020075 Bacteria 2272
116 Ga0206349_1852973 3300020075 Bacteria 1348
117 Ga0206350_10429608 3300020080 Bacteria 1204
118 Ga0206354_10749716 3300020081 Bacteria 2296
119 Ga0206353_10242284 3300020082 Bacteria 1198
120 Ga0206353_11396798 3300020082 Bacteria 1359
121 Ga0213875_10000331 3300021388 Bacteria 44957
122 Ga0213875_10000678 3300021388 Bacteria 26732
123 Ga0213875_10007666 3300021388 Bacteria 5561
124 Ga0213875_10011528 3300021388 Bacteria 4397
125 Ga0213875_10022835 3300021388 Bacteria 2992
126 Ga0213875_10027362 3300021388 Bacteria 2713
127 Ga0224712_10020421 3300022467 Bacteria 2248
128 Ga0224712_10077118 3300022467 Bacteria 1367
129 Ga0207692_10000059 3300025898 Bacteria 32410
130 Ga0207692_10008753 3300025898 Bacteria 4202
131 Ga0207692_10021284 3300025898 Bacteria 2965
132 Ga0207692_10148238 3300025898 Bacteria 1341
133 Ga0207685_10012661 3300025905 Bacteria 2582
134 Ga0207699_10000156 3300025906 Bacteria 42514
135 Ga0207699_10001308 3300025906 Bacteria 11840
136 Ga0207699_10002103 3300025906 Bacteria 9413
137 Ga0207699_10006526 3300025906 Bacteria 5656
138 Ga0207699_10017465 3300025906 Bacteria 3777
139 Ga0207699_10066812 3300025906 Bacteria 2184
140 Ga0207699_10255507 3300025906 Bacteria 1209
141 Ga0207643_10029429 3300025908 Bacteria 3054
142 Ga0207684_10001248 3300025910 Bacteria 28201
143 Ga0207684_10003301 3300025910 Bacteria 15833
144 Ga0207684_10008725 3300025910 Bacteria 8999
145 Ga0207684_10015999 3300025910 Bacteria 6443
146 Ga0207684_10017192 3300025910 Bacteria 6206
147 Ga0207684_10028293 3300025910 Bacteria 4775
148 Ga0207684_10044120 3300025910 Bacteria 3780
149 Ga0207707_10020337 3300025912 Bacteria 5796
150 Ga0207707_10075530 3300025912 Bacteria 2940
151 Ga0207671_10024470 3300025914 Bacteria 4540
152 Ga0207693_10000639 3300025915 Bacteria 31340
153 Ga0207693_10003670 3300025915 Bacteria 13103
154 Ga0207693_10107992 3300025915 Bacteria 2183
155 Ga0207693_10198053 3300025915 Bacteria 1580
156 Ga0207663_10000998 3300025916 Bacteria 12932
157 Ga0207663_10017115 3300025916 Bacteria 4032
158 Ga0207663_10035033 3300025916 Bacteria 3008
159 Ga0207663_10048524 3300025916 Bacteria 2629
160 Ga0207660_10000903 3300025917 Bacteria 19526
161 Ga0207660_10113899 3300025917 Bacteria 2039
162 Ga0207662_10044099 3300025918 Bacteria 2632
163 Ga0207652_10000012 3300025921 Bacteria 235382
164 Ga0207646_10007592 3300025922 Bacteria 10987
165 Ga0207646_10007768 3300025922 Bacteria 10854
166 Ga0207646_10025529 3300025922 Bacteria 5405
167 Ga0207646_10032878 3300025922 Bacteria 4691
168 Ga0207646_10054521 3300025922 Bacteria 3575
169 Ga0207646_10054653 3300025922 Bacteria 3571
170 Ga0207646_10190034 3300025922 Bacteria 1855
171 Ga0207681_10149476 3300025923 Bacteria 1749
172 Ga0207700_10000063 3300025928 Bacteria 65696
173 Ga0207700_10006292 3300025928 Bacteria 7164
174 Ga0207700_10011012 3300025928 Bacteria 5745
175 Ga0207700_10013356 3300025928 Bacteria 5340
176 Ga0207700_10015025 3300025928 Bacteria 5091
177 Ga0207700_10097984 3300025928 Bacteria 2331
178 Ga0207700_10136680 3300025928 Bacteria 2009
179 Ga0207664_10000155 3300025929 Bacteria 55093
180 Ga0207664_10002899 3300025929 Bacteria 11403
181 Ga0207664_10009640 3300025929 Bacteria 6784
182 Ga0207664_10019902 3300025929 Bacteria 4968
183 Ga0207664_10027983 3300025929 Bacteria 4280
184 Ga0207664_10035276 3300025929 Bacteria 3858
185 Ga0207664_10084075 3300025929 Bacteria 2595
186 Ga0207664_10109482 3300025929 Bacteria 2295
187 Ga0207664_10113948 3300025929 Bacteria 2252
188 Ga0207644_10297447 3300025931 Bacteria 1300
189 Ga0207709_10000851 3300025935 Bacteria 23363
190 Ga0207665_10001091 3300025939 Bacteria 18258
191 Ga0207665_10008294 3300025939 Bacteria 6859
192 Ga0207665_10012571 3300025939 Bacteria 5563
193 Ga0207665_10014654 3300025939 Bacteria 5159
194 Ga0207665_10141766 3300025939 Bacteria 1714
195 Ga0207689_10016684 3300025942 Bacteria 6213
196 Ga0207679_10131996 3300025945 Bacteria 2005
197 Ga0207678_10010908 3300026067 Bacteria 7983
198 Ga0207702_10146599 3300026078 Bacteria 2142
199 Ga0207702_10221252 3300026078 Bacteria 1764
200 Ga0207676_10061844 3300026095 Bacteria 2966
201 Ga0207674_10012657 3300026116 Bacteria 9429
202 Ga0207683_10002072 3300026121 Bacteria 17727
203 Ga0207428_10036724 3300027907 Bacteria 3993
204 Ga0268266_10125727 3300028379 Bacteria 2288
205 Ga0265338_10015645 3300028800 Bacteria 8313
206 Ga0316576_10015911 3300031727 Bacteria 5063
207 Ga0316578_10025822 3300031728 Bacteria 3307
208 Ga0316578_10031972 3300031728 Bacteria 3003
209 Ga0316578_10043379 3300031728 Bacteria 2612
210 Ga0307507_10052156 3300033179 Bacteria 3925
211 Ga0373950_0013306 3300034818 Bacteria 1370
212 Ga0373959_0021341 3300034820 Bacteria 1243
213 Ga0373938_0006581 3300034957 Bacteria 2014
214 Ga0373926_0000435 3300035083 Bacteria 10825
215 Ga0373926_0002820 3300035083 Bacteria 5554
216 Ga0373926_0033357 3300035083 Bacteria 1819
217 Ga0373934_0004857 3300035086 Bacteria 4974
218 Ga0373934_0014833 3300035086 Bacteria 2951
219 Ga0373944_0002507 3300035089 Bacteria 4663
220 Ga0373951_0022048 3300035091 Bacteria 1465
221 Ga0373923_0000403 3300035111 Bacteria 10031
222 Ga0373923_0117501 3300035111 Bacteria 1185
223 Ga0373932_0011793 3300035112 Bacteria 2142
224 Ga0373936_0000386 3300035113 Bacteria 14966
225 Ga0373936_0004885 3300035113 Bacteria 5053
226 Ga0373936_0008173 3300035113 Bacteria 3933
227 Ga0373936_0035857 3300035113 Bacteria 1976
228 Ga0373945_0000407 3300035116 Bacteria 12347
229 Ga0373945_0001565 3300035116 Bacteria 7009
230 Ga0373953_0013418 3300035117 Bacteria 2926
231 Ga0373953_0025494 3300035117 Bacteria 2259
232 Ga0373954_0005398 3300035118 Bacteria 5525
233 Ga0373956_0001203 3300035119 Bacteria 10695
234 Ga0373956_0015733 3300035119 Bacteria 3171
235 Ga0373956_0021813 3300035119 Bacteria 2733
236 Ga0373957_0000028 3300035120 Bacteria 37815
237 Ga0373957_0010917 3300035120 Bacteria 3017
238 Ga0373943_0000309 3300035170 Bacteria 20396
239 Ga0373943_0002254 3300035170 Bacteria 8760
240 Ga0373943_0053008 3300035170 Bacteria 2001
241 Ga0373946_0000738 3300035171 Bacteria 11103
242 Ga0373946_0035611 3300035171 Bacteria 2015
243 Ga0373955_0000018 3300035172 Bacteria 68313
244 Ga0373955_0002583 3300035172 Bacteria 7916
245 Ga0373955_0013899 3300035172 Bacteria 3906
246 Ga0373955_0063786 3300035172 Bacteria 2040
247 Ga0373955_0114186 3300035172 Bacteria 1564
248 Ga0373961_0013744 3300035241 Bacteria 2045
249 Ga0316574_0025575 3300035398 Bacteria 3544
250 Ga0316574_0031875 3300035398 Bacteria 3200
251 Ga0373924_0029328 3300035410 Bacteria 2198
252 Ga0373931_0055171 3300035691 Bacteria 2125
253 Ga0373931_0097125 3300035691 Bacteria 1651
254 Ga0373935_0000157 3300035692 Bacteria 31400
255 Ga0373935_0001047 3300035692 Bacteria 15061
256 Ga0373935_0018973 3300035692 Bacteria 4192
257 Ga0373935_0059183 3300035692 Bacteria 2448
258 Ga0373935_0083824 3300035692 Bacteria 2075
259 Ga0373927_0001253 3300035695 Bacteria 19249
260 Ga0373927_0002695 3300035695 Bacteria 12937
261 Ga0373927_0057398 3300035695 Bacteria 2518
262 Ga0373927_0144190 3300035695 Bacteria 1558
263 Ga0373933_0000003 3300035724 Bacteria 150420
264 Ga0373933_0005729 3300035724 Bacteria 6757
265 Ga0373933_0017626 3300035724 Bacteria 4006
266 Ga0373933_0081665 3300035724 Bacteria 1983
267 Ga0373933_0084329 3300035724 Bacteria 1952
268 Ga0373933_0126943 3300035724 Bacteria 1601
269 Ga0373933_0149521 3300035724 Bacteria 1478
270 Ga0373933_0190915 3300035724 Bacteria 1308
271 Ga0373947_0000033 3300035725 Bacteria 71709
272 Ga0373947_0001033 3300035725 Bacteria 17022
273 Ga0373947_0005787 3300035725 Bacteria 7209
274 Ga0373937_0000016 3300036401 Bacteria 145523
275 Ga0373937_0006086 3300036401 Bacteria 10391
276 Ga0373937_0017438 3300036401 Bacteria 6397
277 Ga0373937_0025436 3300036401 Bacteria 5343
278 Ga0373937_0046789 3300036401 Bacteria 3957
279 Ga0373937_0057379 3300036401 Bacteria 3576
280 Ga0373937_0063805 3300036401 Bacteria 3388
281 Ga0373937_0098882 3300036401 Bacteria 2706
282 Ga0372808_003316 3300036459 Bacteria 1962
283 Ga0316584_0134117 3300036712 Bacteria 1849
284 Ga0373925_0002845 3300037068 Bacteria 13657
285 Ga0373925_0003789 3300037068 Bacteria 11625
286 Ga0373925_0019206 3300037068 Bacteria 4969
287 Ga0373925_0023919 3300037068 Bacteria 4456
288 Ga0395899_0126513 3300037312 Bacteria 1827
289 Ga0395900_0110387 3300037418 Bacteria 2825
290 Ga0395898_0004038 3300037466 Bacteria 16141
291 Ga0395905_0068588 3300037471 Bacteria 3321
292 Ga0436364_0287407 3300037853 Bacteria 132611
293 Ga0436364_0481924 3300037853 Bacteria 17385
294 Ga0436364_0560713 3300037853 Bacteria 5282
295 Ga0436364_0874499 3300037853 Bacteria 22688
296 Ga0436364_1138299 3300037853 Bacteria 5930
297 Ga0436364_1538196 3300037853 Bacteria 7486
298 Ga0395901_0027271 3300038443 Bacteria 5867
299 Ga0436361_0736881 3300039447 Bacteria 1418
300 Ga0466972_0090996 3300044658 Bacteria 1447
301 Ga0466965_0019937 3300044683 Bacteria 3220
302 Ga0466963_0069148 3300044694 Bacteria 2372
303 Ga0466964_0028886 3300044706 Bacteria 2187
304 Ga0466971_0081952 3300044719 Bacteria 1472
305 Ga0466971_0117778 3300044719 Bacteria 1228
306 Ga0466957_0184654 3300044842 Bacteria 1363
307 Ga0466960_0046730 3300044901 Bacteria 2074
308 Ga0466959_0042349 3300045049 Bacteria 3359
309 Ga0466959_0062918 3300045049 Bacteria 2696
310 Ga0466958_0030362 3300045836 Bacteria 3210
311 Ga0466967_0020015 3300045976 Bacteria 5397
312 Ga0466967_0110282 3300045976 Bacteria 2527
313 Ga0466967_0136010 3300045976 Bacteria 2285
314 Ga0495592_0000631 3300046454 Bacteria 24536
315 Ga0495592_0007490 3300046454 Bacteria 8174
316 Ga0495592_0009816 3300046454 Bacteria 7206
317 Ga0495592_0030841 3300046454 Bacteria 4055
318 Ga0495592_0042247 3300046454 Bacteria 3414
319 Ga0495592_0159399 3300046454 Bacteria 1554
320 Ga0495603_0002301 3300046455 Bacteria 11206
321 Ga0495629_0067121 3300046459 Bacteria 2503
322 Ga0495629_0128611 3300046459 Bacteria 1764
323 Ga0495629_0205350 3300046459 Bacteria 1361
324 Ga0495641_0005925 3300046461 Bacteria 8060
325 Ga0495641_0008128 3300046461 Bacteria 6442
326 Ga0495641_0122481 3300046461 Bacteria 1160
327 Ga0495651_0000009 3300046462 Bacteria 150455
328 Ga0495651_0003745 3300046462 Bacteria 11639
329 Ga0495651_0014845 3300046462 Bacteria 6022
330 Ga0495651_0020888 3300046462 Bacteria 5083
331 Ga0495651_0026749 3300046462 Bacteria 4492
332 Ga0495651_0064608 3300046462 Bacteria 2796
333 Ga0495651_0115084 3300046462 Bacteria 1983
334 Ga0495653_0001054 3300046463 Bacteria 21231
335 Ga0495653_0021601 3300046463 Bacteria 5213
336 Ga0495653_0034237 3300046463 Bacteria 4019
337 Ga0495653_0034486 3300046463 Bacteria 4003
338 Ga0495653_0045258 3300046463 Bacteria 3412
339 Ga0495653_0049295 3300046463 Bacteria 3245
340 Ga0495653_0059231 3300046463 Bacteria 2907
341 Ga0495653_0061781 3300046463 Bacteria 2833
342 Ga0495653_0070930 3300046463 Bacteria 2606
343 Ga0495580_0004229 3300046472 Bacteria 12074
344 Ga0495580_0045787 3300046472 Bacteria 3106
345 Ga0495582_0004360 3300046473 Bacteria 7959
346 Ga0495582_0024160 3300046473 Bacteria 3323
347 Ga0495639_0000697 3300046475 Bacteria 15362
348 Ga0495639_0040327 3300046475 Bacteria 2100
349 Ga0495662_0001140 3300046476 Bacteria 13112
350 Ga0495662_0055081 3300046476 Bacteria 1921
351 Ga0495662_0091745 3300046476 Bacteria 1481
352 Ga0495664_0000347 3300046477 Bacteria 22480
353 Ga0495664_0011819 3300046477 Bacteria 4931
354 Ga0495664_0013064 3300046477 Bacteria 4708
355 Ga0495664_0057843 3300046477 Bacteria 2306
356 Ga0495608_0000019 3300046511 Bacteria 180119
357 Ga0495608_0000654 3300046511 Bacteria 23904
358 Ga0495608_0010501 3300046511 Bacteria 6462
359 Ga0495608_0012805 3300046511 Bacteria 5820
360 Ga0495608_0016000 3300046511 Bacteria 5192
361 Ga0495608_0022579 3300046511 Bacteria 4315
362 Ga0495608_0025084 3300046511 Bacteria 4071
363 Ga0495618_0093076 3300046514 Bacteria 1927
364 Ga0495628_0002185 3300046516 Bacteria 17692
365 Ga0495628_0048355 3300046516 Bacteria 3371
366 Ga0495628_0147048 3300046516 Bacteria 1796
367 Ga0495628_0241743 3300046516 Bacteria 1350
368 Ga0495630_0003788 3300046517 Bacteria 10545
369 Ga0495666_0001505 3300046526 Bacteria 11397
370 Ga0495652_0000082 3300046529 Bacteria 102163
371 Ga0495652_0002000 3300046529 Bacteria 21728
372 Ga0495652_0048214 3300046529 Bacteria 3651
373 Ga0495652_0096328 3300046529 Bacteria 2410
374 Ga0495665_0002960 3300046531 Bacteria 9170
375 Ga0495665_0008875 3300046531 Bacteria 5454
376 Ga0495665_0036436 3300046531 Bacteria 2626
377 Ga0495665_0057079 3300046531 Bacteria 2060
378 Ga0495640_0028106 3300046533 Bacteria 4051
379 Ga0495640_0049106 3300046533 Bacteria 2911
380 Ga0495640_0066557 3300046533 Bacteria 2430
381 Ga0495586_0004919 3300046535 Bacteria 7147
382 Ga0495587_0000056 3300046536 Bacteria 96726
383 Ga0495587_0041682 3300046536 Bacteria 2738
384 Ga0495587_0116736 3300046536 Bacteria 1530
385 Ga0495587_0121492 3300046536 Bacteria 1496
386 Ga0495645_0032672 3300046543 Bacteria 3796
387 Ga0495645_0041519 3300046543 Bacteria 3354
388 Ga0495645_0069366 3300046543 Bacteria 2544
389 Ga0495645_0143499 3300046543 Bacteria 1664
390 Ga0495622_0039234 3300046557 Bacteria 2205
391 Ga0495667_0000037 3300046559 Bacteria 133780
392 Ga0495667_0000951 3300046559 Bacteria 18711
393 Ga0495667_0001344 3300046559 Bacteria 16142
394 Ga0495667_0006252 3300046559 Bacteria 8073
395 Ga0495667_0007076 3300046559 Bacteria 7613
396 Ga0495667_0007153 3300046559 Bacteria 7571
397 Ga0495667_0024312 3300046559 Bacteria 4079
398 Ga0495634_0035696 3300046642 Bacteria 3402
399 Ga0495634_0046915 3300046642 Bacteria 2913
400 Ga0495634_0061212 3300046642 Bacteria 2503
401 Ga0495634_0079732 3300046642 Bacteria 2143
402 Ga0495635_0000164 3300046663 Bacteria 41167
403 Ga0495635_0004135 3300046663 Bacteria 10060
404 Ga0495635_0004624 3300046663 Bacteria 9548
405 Ga0495635_0012633 3300046663 Bacteria 5922
406 Ga0495635_0016004 3300046663 Bacteria 5238
407 Ga0495635_0024286 3300046663 Bacteria 4225
408 Ga0495635_0036305 3300046663 Bacteria 3416
409 Ga0495657_0000043 3300046675 Bacteria 114089
410 Ga0495657_0002237 3300046675 Bacteria 16384
411 Ga0495657_0005052 3300046675 Bacteria 10480
412 Ga0495657_0009305 3300046675 Bacteria 7454
413 Ga0495657_0020132 3300046675 Bacteria 4800
414 Ga0495657_0064554 3300046675 Bacteria 2411
415 Ga0495599_0005128 3300046678 Bacteria 7804
416 Ga0495599_0032487 3300046678 Bacteria 3276
417 Ga0495599_0077295 3300046678 Bacteria 2078
418 Ga0495599_0202728 3300046678 Bacteria 1218
419 Ga0495623_0000176 3300046679 Bacteria 40029
420 Ga0495623_0009044 3300046679 Bacteria 6462
421 Ga0495623_0175814 3300046679 Bacteria 1247
422 Ga0495646_0000634 3300046680 Bacteria 19154
423 Ga0495646_0015171 3300046680 Bacteria 4893
424 Ga0495646_0024513 3300046680 Bacteria 3799
425 Ga0495646_0045474 3300046680 Bacteria 2681
426 Ga0495646_0063525 3300046680 Bacteria 2192
427 Ga0495646_0113002 3300046680 Bacteria 1544
428 Ga0495647_0017335 3300046681 Bacteria 2546
429 Ga0495647_0052010 3300046681 Bacteria 1593
430 Ga0495658_0000569 3300046683 Bacteria 20125
431 Ga0495658_0110218 3300046683 Bacteria 1654
432 Ga0495613_0006733 3300046689 Bacteria 8581
433 Ga0495613_0067734 3300046689 Bacteria 2605
434 Ga0495624_0121253 3300046690 Bacteria 1605
435 Ga0495624_0125199 3300046690 Bacteria 1577
436 Ga0495600_0002835 3300046809 Bacteria 10086
437 Ga0495600_0009435 3300046809 Bacteria 6028
438 Ga0495600_0010486 3300046809 Bacteria 5755
439 Ga0495600_0013484 3300046809 Bacteria 5137
440 Ga0495600_0024902 3300046809 Bacteria 3853
441 Ga0495600_0160451 3300046809 Bacteria 1453
442 Ga0495581_0001263 3300047315 Bacteria 13920
443 Ga0495581_0003540 3300047315 Bacteria 8966
444 Ga0495581_0016901 3300047315 Bacteria 4240
445 Ga0495581_0020048 3300047315 Bacteria 3882
446 Ga0495604_0000040 3300047317 Bacteria 120837
447 Ga0495604_0034018 3300047317 Bacteria 4032
448 Ga0495604_0038017 3300047317 Bacteria 3787
449 Ga0495604_0040194 3300047317 Bacteria 3673
450 Ga0495604_0048091 3300047317 Bacteria 3318
451 Ga0495604_0126922 3300047317 Bacteria 1838
452 Ga0495674_0002184 3300047319 Bacteria 19226
453 Ga0495674_0002249 3300047319 Bacteria 18972
454 Ga0495674_0008467 3300047319 Bacteria 9797
455 Ga0495674_0041213 3300047319 Bacteria 4126
456 Ga0495674_0041448 3300047319 Bacteria 4112
457 Ga0495674_0085738 3300047319 Bacteria 2697
458 Ga0495676_0010368 3300047321 Bacteria 8452
459 Ga0495676_0050689 3300047321 Bacteria 3327
460 Ga0495680_0000010 3300047322 Bacteria 142931
461 Ga0495680_0001221 3300047322 Bacteria 28175
462 Ga0495680_0004154 3300047322 Bacteria 13921
463 Ga0495680_0007117 3300047322 Bacteria 10303
464 Ga0495680_0062666 3300047322 Bacteria 2858
465 Ga0495675_0000385 3300047444 Bacteria 30543
466 Ga0495675_0029218 3300047444 Bacteria 3515
467 Ga0495675_0069581 3300047444 Bacteria 2222
468 Ga0495684_0002315 3300047471 Bacteria 15251
469 Ga0495684_0003268 3300047471 Bacteria 12734
470 Ga0495684_0020826 3300047471 Bacteria 5053
471 Ga0495684_0045329 3300047471 Bacteria 3365
472 Ga0495684_0134956 3300047471 Bacteria 1852
473 Ga0495684_0242538 3300047471 Bacteria 1314
474 Ga0495593_0010920 3300047673 Bacteria 5231
475 Ga0495593_0029098 3300047673 Bacteria 3031
476 Ga0495593_0075470 3300047673 Bacteria 1748
477 Ga0495602_0000109 3300048088 Bacteria 79404
478 Ga0495602_0020114 3300048088 Bacteria 6603
479 Ga0495602_0042590 3300048088 Bacteria 4135
480 Ga0495602_0062274 3300048088 Bacteria 3237
481 Ga0495602_0066924 3300048088 Bacteria 3093
482 Ga0496102_0106752 3300048905 Bacteria 2606
483 Ga0496102_0193165 3300048905 Bacteria 1918
484 Ga0496103_0053276 3300048906 Bacteria 2507
485 Ga0496104_0156403 3300048907 Bacteria 2187
486 Ga0496105_0006203 3300048908 Bacteria 9169
487 Ga0496105_0020239 3300048908 Bacteria 5376
488 Ga0496105_0180340 3300048908 Bacteria 1729
489 Ga0496106_0064859 3300048909 Bacteria 2779
490 Ga0496106_0081251 3300048909 Bacteria 2490
491 Ga0496108_0060804 3300048911 Bacteria 3178
492 Ga0496108_0080873 3300048911 Bacteria 2753
493 Ga0496110_0020930 3300048913 Bacteria 5526
494 Ga0496110_0154260 3300048913 Bacteria 2080
495 Ga0496112_0019525 3300048915 Bacteria 6398
496 Ga0496113_0056440 3300048916 Bacteria 2948
497 Ga0496113_0086902 3300048916 Bacteria 2403
498 Ga0496115_0018236 3300048918 Bacteria 5384
499 Ga0496115_0039958 3300048918 Bacteria 3727
500 Ga0496126_0123191 3300048929 Bacteria 2246
501 Ga0501034_0248913 3300049571 Bacteria 1722
502 Ga0501047_0236378 3300049581 Bacteria 1679
503 Ga0501048_0072160 3300049582 Bacteria 2437
504 Ga0501076_0055970 3300049592 Bacteria 3129
505 Ga0501079_0116448 3300049741 Bacteria 2077
506 Ga0501083_0181419 3300049744 Bacteria 1375
507 Ga0501045_0257445 3300049824 Bacteria 1299
508 nmdc:mga05p37_16304_c1 3300050507 Bacteria 8943
509 nmdc:mga0n895_23015_c1 3300050512 Bacteria 5850
510 nmdc:mga0n895_37197_c1 3300050512 Bacteria 4707
511 nmdc:mga0rr50_137050_c1 3300050513 Bacteria 1966
512 nmdc:mga08x19_111584_c1 3300050514 Bacteria 1825
513 nmdc:mga08x19_52910_c1 3300050514 Bacteria 2612
514 nmdc:mga0a205_16446_c1 3300050515 Bacteria 6927
515 Ga0495601_0019633 3300053077 Bacteria 4124
516 Ga0495601_0038350 3300053077 Bacteria 2997
517 Ga0495612_0003709 3300053078 Bacteria 6340
518 Ga0495612_0065548 3300053078 Bacteria 1508
519 Ga0495595_0002602 3300053084 Bacteria 7070
520 Ga0495595_0003389 3300053084 Bacteria 6329
521 Ga0495595_0003525 3300053084 Bacteria 6211
522 Ga0495595_0034186 3300053084 Bacteria 2298
523 Ga0495619_0000640 3300053085 Bacteria 23067
524 Ga0495619_0010961 3300053085 Bacteria 5704
525 Ga0495619_0032261 3300053085 Bacteria 3398
526 Ga0495619_0051903 3300053085 Bacteria 2710
527 Ga0530510_0129741 3300061734 Bacteria 1854
528 2585311592 2582581313 Bacteria 10042643
529 2587861569 2585428094 Bacteria 3604039
530 2644278185 2643221649 Bacteria 3867359
531 2676482278 2675903059 Bacteria 8644972
532 2812480505 2811994917 Bacteria 7761064
533 2889303884 2889300758 Bacteria 5690814
534 2939745737 2939743619 Bacteria 5762299
535 3001889843 3001889506 Bacteria 2975194
536 3003005073 3002998708 Bacteria 11715108
537 8047711860 8047710418 Bacteria 11023148
538 Ga0373954_0091988
539 Ga0070683_100039876
540 Ga0070683_100180504
541 Ga0070680_100001066
542 Ga0070680_100059901
543 Ga0070680_100129990
544 Ga0070682_100079737
545 Ga0068868_100211686
546 Ga0070660_100118362
547 Ga0070691_10034393
548 Ga0070671_100054052
549 Ga0070709_10000381
550 Ga0070709_10019463
551 Ga0070709_10181966
552 Ga0070714_100000551
553 Ga0070714_100006524
554 Ga0070714_100038741
555 Ga0070714_100311695
556 Ga0070713_100000809
557 Ga0070713_100055425
558 Ga0070713_100176395
559 Ga0070713_100420218
560 Ga0070710_10000101
561 Ga0070710_10001653
562 Ga0070710_10094595
563 Ga0070710_10129191
564 Ga0070711_100001082
565 Ga0070711_100034560
566 Ga0070711_100095042
567 Ga0070711_100272318
568 Ga0070705_100008219
569 Ga0070705_100012714
570 Ga0070694_100227598
571 Ga0070708_100007977
572 Ga0070681_10000154
573 Ga0070681_10010006
574 Ga0070706_100002164
575 Ga0070706_100009817
576 Ga0070706_100010717
577 Ga0070706_100014825
578 Ga0070706_100125478
579 Ga0070706_100150439
580 Ga0070706_100193464
581 Ga0070707_100006563
582 Ga0070707_100021819
583 Ga0070707_100042199
584 Ga0070707_100046164
585 Ga0070707_100072321
586 Ga0070698_100008715
587 Ga0070698_100016014
588 Ga0070698_100029195
589 Ga0070698_100043942
590 Ga0070698_100111281
591 Ga0070698_100161852
592 Ga0070699_100002684
593 Ga0070699_100003487
594 Ga0070699_100054044
595 Ga0070699_100252748
596 Ga0070679_100000586
597 Ga0070697_100001402
598 Ga0070697_100059692
599 Ga0068853_100032808
600 Ga0070665_100161954
601 Ga0070665_100348734
602 Ga0070704_100072114
603 Ga0070664_100101981
604 Ga0068857_100081945
605 Ga0068856_100022779
606 Ga0068856_100061826
607 Ga0068861_100094608
608 Ga0081540_1000089
609 Ga0081540_1000773
610 Ga0081540_1036927
611 Ga0081539_10003765
612 Ga0081539_10010031
613 Ga0070717_10000904
614 Ga0070717_10005375
615 Ga0070717_10040622
616 Ga0070717_10083869
617 Ga0070715_10000215
618 Ga0070715_10038418
619 Ga0070715_10139578
620 Ga0070716_100000500
621 Ga0070716_100000908
622 Ga0070716_100064449
623 Ga0070716_100110358
624 Ga0070712_100000986
625 Ga0070712_100026850
626 Ga0070712_100134276
627 Ga0070712_100218684
628 Ga0097621_100354932
629 Ga0075433_10025965
630 Ga0075433_10086373
631 Ga0075434_100018227
632 Ga0075436_100008953
633 Ga0075436_100019220
634 Ga0075436_100107335
635 Ga0075435_100082945
636 Ga0075435_100090284
637 Ga0099794_10087230
638 Ga0105251_10055040
639 Ga0114129_10003360
640 Ga0114129_10345674
641 Ga0105248_10272337
642 Ga0105237_10139368
643 Ga0099796_10045820
644 Ga0157371_10086691
645 Ga0157372_10452298
646 Ga0157375_10655415
647 Ga0157376_10139853
648 Ga0197907_10907238
649 Ga0197907_11137400
650 Ga0206356_11567571
651 Ga0206356_11845457
652 Ga0206349_1617336
653 Ga0206349_1852973
654 Ga0206350_10429608
655 Ga0206354_10749716
656 Ga0206353_10242284
657 Ga0206353_11396798
658 Ga0213875_10000331
659 Ga0213875_10000678
660 Ga0213875_10007666
661 Ga0213875_10011528
662 Ga0213875_10022835
663 Ga0213875_10027362
664 Ga0224712_10020421
665 Ga0224712_10077118
666 Ga0207692_10000059
667 Ga0207692_10008753
668 Ga0207692_10021284
669 Ga0207692_10148238
670 Ga0207685_10012661
671 Ga0207699_10000156
672 Ga0207699_10001308
673 Ga0207699_10002103
674 Ga0207699_10006526
675 Ga0207699_10017465
676 Ga0207699_10066812
677 Ga0207699_10255507
678 Ga0207643_10029429
679 Ga0207684_10001248
680 Ga0207684_10003301
681 Ga0207684_10008725
682 Ga0207684_10015999
683 Ga0207684_10017192
684 Ga0207684_10028293
685 Ga0207684_10044120
686 Ga0207707_10020337
687 Ga0207707_10075530
688 Ga0207671_10024470
689 Ga0207693_10000639
690 Ga0207693_10003670
691 Ga0207693_10107992
692 Ga0207693_10198053
693 Ga0207663_10000998
694 Ga0207663_10017115
695 Ga0207663_10035033
696 Ga0207663_10048524
697 Ga0207660_10000903
698 Ga0207660_10113899
699 Ga0207662_10044099
700 Ga0207652_10000012
701 Ga0207646_10007592
702 Ga0207646_10007768
703 Ga0207646_10025529
704 Ga0207646_10032878
705 Ga0207646_10054521
706 Ga0207646_10054653
707 Ga0207646_10190034
708 Ga0207681_10149476
709 Ga0207700_10000063
710 Ga0207700_10006292
711 Ga0207700_10011012
712 Ga0207700_10013356
713 Ga0207700_10015025
714 Ga0207700_10097984
715 Ga0207700_10136680
716 Ga0207664_10000155
717 Ga0207664_10002899
718 Ga0207664_10009640
719 Ga0207664_10019902
720 Ga0207664_10027983
721 Ga0207664_10035276
722 Ga0207664_10084075
723 Ga0207664_10109482
724 Ga0207664_10113948
725 Ga0207644_10297447
726 Ga0207709_10000851
727 Ga0207665_10001091
728 Ga0207665_10008294
729 Ga0207665_10012571
730 Ga0207665_10014654
731 Ga0207665_10141766
732 Ga0207689_10016684
733 Ga0207679_10131996
734 Ga0207678_10010908
735 Ga0207702_10146599
736 Ga0207702_10221252
737 Ga0207676_10061844
738 Ga0207674_10012657
739 Ga0207683_10002072
740 Ga0207428_10036724
741 Ga0268266_10125727
742 Ga0265338_10015645
743 Ga0316576_10015911
744 Ga0316578_10025822
745 Ga0316578_10031972
746 Ga0316578_10043379
747 Ga0307507_10052156
748 Ga0373950_0013306
749 Ga0373959_0021341
750 Ga0373938_0006581
751 Ga0373926_0000435
752 Ga0373926_0002820
753 Ga0373926_0033357
754 Ga0373934_0004857
755 Ga0373934_0014833
756 Ga0373944_0002507
757 Ga0373951_0022048
758 Ga0373923_0000403
759 Ga0373923_0117501
760 Ga0373932_0011793
761 Ga0373936_0000386
762 Ga0373936_0004885
763 Ga0373936_0008173
764 Ga0373936_0035857
765 Ga0373945_0000407
766 Ga0373945_0001565
767 Ga0373953_0013418
768 Ga0373953_0025494
769 Ga0373954_0005398
770 Ga0373956_0001203
771 Ga0373956_0015733
772 Ga0373956_0021813
773 Ga0373957_0000028
774 Ga0373957_0010917
775 Ga0373943_0000309
776 Ga0373943_0002254
777 Ga0373943_0053008
778 Ga0373946_0000738
779 Ga0373946_0035611
780 Ga0373955_0000018
781 Ga0373955_0002583
782 Ga0373955_0013899
783 Ga0373955_0063786
784 Ga0373955_0114186
785 Ga0373961_0013744
786 Ga0316574_0025575
787 Ga0316574_0031875
788 Ga0373924_0029328
789 Ga0373931_0055171
790 Ga0373931_0097125
791 Ga0373935_0000157
792 Ga0373935_0001047
793 Ga0373935_0018973
794 Ga0373935_0059183
795 Ga0373935_0083824
796 Ga0373927_0001253
797 Ga0373927_0002695
798 Ga0373927_0057398
799 Ga0373927_0144190
800 Ga0373933_0000003
801 Ga0373933_0005729
802 Ga0373933_0017626
803 Ga0373933_0081665
804 Ga0373933_0084329
805 Ga0373933_0126943
806 Ga0373933_0149521
807 Ga0373933_0190915
808 Ga0373947_0000033
809 Ga0373947_0001033
810 Ga0373947_0005787
811 Ga0373937_0000016
812 Ga0373937_0006086
813 Ga0373937_0017438
814 Ga0373937_0025436
815 Ga0373937_0046789
816 Ga0373937_0057379
817 Ga0373937_0063805
818 Ga0373937_0098882
819 Ga0372808_003316
820 Ga0316584_0134117
821 Ga0373925_0002845
822 Ga0373925_0003789
823 Ga0373925_0019206
824 Ga0373925_0023919
825 Ga0395899_0126513
826 Ga0395900_0110387
827 Ga0395898_0004038
828 Ga0395905_0068588
829 Ga0436364_0287407
830 Ga0436364_0481924
831 Ga0436364_0560713
832 Ga0436364_0874499
833 Ga0436364_1138299
834 Ga0436364_1538196
835 Ga0395901_0027271
836 Ga0436361_0736881
837 Ga0466972_0090996
838 Ga0466965_0019937
839 Ga0466963_0069148
840 Ga0466964_0028886
841 Ga0466971_0081952
842 Ga0466971_0117778
843 Ga0466957_0184654
844 Ga0466960_0046730
845 Ga0466959_0042349
846 Ga0466959_0062918
847 Ga0466958_0030362
848 Ga0466967_0020015
849 Ga0466967_0110282
850 Ga0466967_0136010
851 Ga0495592_0000631
852 Ga0495592_0007490
853 Ga0495592_0009816
854 Ga0495592_0030841
855 Ga0495592_0042247
856 Ga0495592_0159399
857 Ga0495603_0002301
858 Ga0495629_0067121
859 Ga0495629_0128611
860 Ga0495629_0205350
861 Ga0495641_0005925
862 Ga0495641_0008128
863 Ga0495641_0122481
864 Ga0495651_0000009
865 Ga0495651_0003745
866 Ga0495651_0014845
867 Ga0495651_0020888
868 Ga0495651_0026749
869 Ga0495651_0064608
870 Ga0495651_0115084
871 Ga0495653_0001054
872 Ga0495653_0021601
873 Ga0495653_0034237
874 Ga0495653_0034486
875 Ga0495653_0045258
876 Ga0495653_0049295
877 Ga0495653_0059231
878 Ga0495653_0061781
879 Ga0495653_0070930
880 Ga0495580_0004229
881 Ga0495580_0045787
882 Ga0495582_0004360
883 Ga0495582_0024160
884 Ga0495639_0000697
885 Ga0495639_0040327
886 Ga0495662_0001140
887 Ga0495662_0055081
888 Ga0495662_0091745
889 Ga0495664_0000347
890 Ga0495664_0011819
891 Ga0495664_0013064
892 Ga0495664_0057843
893 Ga0495608_0000019
894 Ga0495608_0000654
895 Ga0495608_0010501
896 Ga0495608_0012805
897 Ga0495608_0016000
898 Ga0495608_0022579
899 Ga0495608_0025084
900 Ga0495618_0093076
901 Ga0495628_0002185
902 Ga0495628_0048355
903 Ga0495628_0147048
904 Ga0495628_0241743
905 Ga0495630_0003788
906 Ga0495666_0001505
907 Ga0495652_0000082
908 Ga0495652_0002000
909 Ga0495652_0048214
910 Ga0495652_0096328
911 Ga0495665_0002960
912 Ga0495665_0008875
913 Ga0495665_0036436
914 Ga0495665_0057079
915 Ga0495640_0028106
916 Ga0495640_0049106
917 Ga0495640_0066557
918 Ga0495586_0004919
919 Ga0495587_0000056
920 Ga0495587_0041682
921 Ga0495587_0116736
922 Ga0495587_0121492
923 Ga0495645_0032672
924 Ga0495645_0041519
925 Ga0495645_0069366
926 Ga0495645_0143499
927 Ga0495622_0039234
928 Ga0495667_0000037
929 Ga0495667_0000951
930 Ga0495667_0001344
931 Ga0495667_0006252
932 Ga0495667_0007076
933 Ga0495667_0007153
934 Ga0495667_0024312
935 Ga0495634_0035696
936 Ga0495634_0046915
937 Ga0495634_0061212
938 Ga0495634_0079732
939 Ga0495635_0000164
940 Ga0495635_0004135
941 Ga0495635_0004624
942 Ga0495635_0012633
943 Ga0495635_0016004
944 Ga0495635_0024286
945 Ga0495635_0036305
946 Ga0495657_0000043
947 Ga0495657_0002237
948 Ga0495657_0005052
949 Ga0495657_0009305
950 Ga0495657_0020132
951 Ga0495657_0064554
952 Ga0495599_0005128
953 Ga0495599_0032487
954 Ga0495599_0077295
955 Ga0495599_0202728
956 Ga0495623_0000176
957 Ga0495623_0009044
958 Ga0495623_0175814
959 Ga0495646_0000634
960 Ga0495646_0015171
961 Ga0495646_0024513
962 Ga0495646_0045474
963 Ga0495646_0063525
964 Ga0495646_0113002
965 Ga0495647_0017335
966 Ga0495647_0052010
967 Ga0495658_0000569
968 Ga0495658_0110218
969 Ga0495613_0006733
970 Ga0495613_0067734
971 Ga0495624_0121253
972 Ga0495624_0125199
973 Ga0495600_0002835
974 Ga0495600_0009435
975 Ga0495600_0010486
976 Ga0495600_0013484
977 Ga0495600_0024902
978 Ga0495600_0160451
979 Ga0495581_0001263
980 Ga0495581_0003540
981 Ga0495581_0016901
982 Ga0495581_0020048
983 Ga0495604_0000040
984 Ga0495604_0034018
985 Ga0495604_0038017
986 Ga0495604_0040194
987 Ga0495604_0048091
988 Ga0495604_0126922
989 Ga0495674_0002184
990 Ga0495674_0002249
991 Ga0495674_0008467
992 Ga0495674_0041213
993 Ga0495674_0041448
994 Ga0495674_0085738
995 Ga0495676_0010368
996 Ga0495676_0050689
997 Ga0495680_0000010
998 Ga0495680_0001221
999 Ga0495680_0004154
1000 Ga0495680_0007117
1001 Ga0495680_0062666
1002 Ga0495675_0000385
1003 Ga0495675_0029218
1004 Ga0495675_0069581
1005 Ga0495684_0002315
1006 Ga0495684_0003268
1007 Ga0495684_0020826
1008 Ga0495684_0045329
1009 Ga0495684_0134956
1010 Ga0495684_0242538
1011 Ga0495593_0010920
1012 Ga0495593_0029098
1013 Ga0495593_0075470
1014 Ga0495602_0000109
1015 Ga0495602_0020114
1016 Ga0495602_0042590
1017 Ga0495602_0062274
1018 Ga0495602_0066924
1019 Ga0496102_0106752
1020 Ga0496102_0193165
1021 Ga0496103_0053276
1022 Ga0496104_0156403
1023 Ga0496105_0006203
1024 Ga0496105_0020239
1025 Ga0496105_0180340
1026 Ga0496106_0064859
1027 Ga0496106_0081251
1028 Ga0496108_0060804
1029 Ga0496108_0080873
1030 Ga0496110_0020930
1031 Ga0496110_0154260
1032 Ga0496112_0019525
1033 Ga0496113_0056440
1034 Ga0496113_0086902
1035 Ga0496115_0018236
1036 Ga0496115_0039958
1037 Ga0496126_0123191
1038 Ga0501034_0248913
1039 Ga0501047_0236378
1040 Ga0501048_0072160
1041 Ga0501076_0055970
1042 Ga0501079_0116448
1043 Ga0501083_0181419
1044 Ga0501045_0257445
1045 nmdc:mga05p37_16304_c1
1046 nmdc:mga0n895_23015_c1
1047 nmdc:mga0n895_37197_c1
1048 nmdc:mga0rr50_137050_c1
1049 nmdc:mga08x19_111584_c1
1050 nmdc:mga08x19_52910_c1
1051 nmdc:mga0a205_16446_c1
1052 Ga0495601_0019633
1053 Ga0495601_0038350
1054 Ga0495612_0003709
1055 Ga0495612_0065548
1056 Ga0495595_0002602
1057 Ga0495595_0003389
1058 Ga0495595_0003525
1059 Ga0495595_0034186
1060 Ga0495619_0000640
1061 Ga0495619_0010961
1062 Ga0495619_0032261
1063 Ga0495619_0051903
1064 Ga0530510_0129741
1065 2585311592
1066 2587861569
1067 2644278185
1068 2676482278
1069 2812480505
1070 2889303884
1071 2939745737
1072 3001889843
1073 3003005073
1074 8047711860

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

85

229

0.98

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

132

259

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9452 13 230
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.9425 11 231
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9409 11 231
7ahd-assembly1.cif.gz_D opua (e190q) occluded 0.9404 12 230
3puy-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state 0.9349 13 232
ID Description Score Start End Superfamily
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9732 9 230 3.40.50.300
af_P78363_1926_2175_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9715 10 233 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9697 12 235 3.40.50.300
af_A4HRM7_2286_2560_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9692 11 231 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9689 13 233 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2E7MAK6-F1-model_v4 3-dehydroquinate dehydratase 0.9734 13 235 GO:0005524
GO:0016887
AF-A0A1I2M2I1-F1-model_v4 ABC-2 type transport system ATP-binding protein/oleandomycin transport system ATP-binding protein 0.9713 8 230 GO:0005524
GO:0016887
AF-A0A7V0KKK6-F1-model_v4 ABC transporter ATP-binding protein 0.9689 13 234 GO:0005524
GO:0016887
AF-A0A3D2KNM8-F1-model_v4 ABC transporter 0.9678 14 235 GO:0005524
GO:0016887
AF-A0A7W7BQI4-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9677 8 232 GO:0005524
GO:0016887
GO:0046677

Map