F460914

General Info

Members Datasets Scaffolds Average Seq Length
537 264 1074 103

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10066024|Ga0213876_100660242
Length 112
Sequence MSAGGFVAVLVIELHFPQAGSLKGKRKELSSIKAQLHGRLGAAVAEVDHQDTWQRSTLTAALTGGSLATLSAATDKLERWLEARWPDGVRVQRVVVSLEDLRDVVPQFGREG

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
12 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
110 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
180 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
181 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
182 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
183 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
184 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
185 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
186 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
187 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
188 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
189 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
190 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
191 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
192 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
193 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
194 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
195 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
200 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
201 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
202 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
205 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
206 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
211 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
212 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
213 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
214 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
217 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
218 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
263 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
264 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.49
Nodule 0
Rhizoplane 6.89
Rhizosphere 88.83
Stem 0
Stem Tuber 0
Unclassified 12.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10066024 3300021384 Bacteria 1910
2 JGI24752J21851_1037568 3300001976 Bacteria 645
3 JGI24746J21847_1010774 3300001977 Bacteria 1349
4 JGI24739J22299_10061390 3300001989 Bacteria 1187
5 JGI24737J22298_10120038 3300001990 Bacteria 777
6 JGI24743J22301_10020827 3300001991 Bacteria 1250
7 JGI24735J21928_10175015 3300002067 Bacteria 621
8 JGI24750J21931_1068112 3300002070 Bacteria 578
9 JGI24745J21846_1014176 3300002073 Bacteria 922
10 JGI24744J21845_10018310 3300002077 Bacteria 1389
11 JGI24033J26618_1024973 3300002155 Bacteria 782
12 JGI25407J50210_10033494 3300003373 Bacteria 1326
13 JGI25407J50210_10140199 3300003373 Bacteria 595
14 Ga0070676_10092705 3300005328 Bacteria 1853
15 Ga0070683_100104413 3300005329 Bacteria 2671
16 Ga0070683_100216138 3300005329 Bacteria 1821
17 Ga0070683_100425718 3300005329 Bacteria 1266
18 Ga0070683_100577739 3300005329 Bacteria 1075
19 Ga0070683_100816728 3300005329 Bacteria 894
20 Ga0070670_100962422 3300005331 Bacteria 775
21 Ga0070677_10354526 3300005333 Bacteria 761
22 Ga0068869_100145274 3300005334 Bacteria 1835
23 Ga0068869_100680320 3300005334 Unclassified 876
24 Ga0068869_100745846 3300005334 Bacteria 838
25 Ga0070666_10512637 3300005335 Bacteria 870
26 Ga0070666_10789393 3300005335 Bacteria 699
27 Ga0070682_100006422 3300005337 Bacteria 6606
28 Ga0070682_100670561 3300005337 Bacteria 828
29 Ga0070682_100761213 3300005337 Bacteria 783
30 Ga0068868_100003558 3300005338 Bacteria 10851
31 Ga0070689_100192779 3300005340 Bacteria 1660
32 Ga0070691_10020406 3300005341 Bacteria 3062
33 Ga0070691_10382336 3300005341 Bacteria 789
34 Ga0070687_100378457 3300005343 Bacteria 922
35 Ga0070668_100037410 3300005347 Bacteria 3706
36 Ga0070668_101170571 3300005347 Unclassified 696
37 Ga0070669_100689162 3300005353 Bacteria 862
38 Ga0070669_100953009 3300005353 Bacteria 735
39 Ga0070675_100029832 3300005354 Bacteria 4400
40 Ga0070671_100241927 3300005355 Bacteria 1532
41 Ga0070674_101106676 3300005356 Bacteria 700
42 Ga0070688_100029977 3300005365 Bacteria 3262
43 Ga0070688_100997655 3300005365 Unclassified 665
44 Ga0070688_101002116 3300005365 Unclassified 664
45 Ga0070659_100283674 3300005366 Bacteria 1378
46 Ga0070659_100605742 3300005366 Bacteria 942
47 Ga0070659_100692533 3300005366 Bacteria 881
48 Ga0070659_101310362 3300005366 Unclassified 642
49 Ga0070659_101518758 3300005366 Bacteria 597
50 Ga0070703_10071983 3300005406 Bacteria 1157
51 Ga0070713_100447220 3300005436 Bacteria 1213
52 Ga0070710_10914789 3300005437 Bacteria 634
53 Ga0070701_10906110 3300005438 Bacteria 609
54 Ga0070705_100276363 3300005440 Bacteria 1192
55 Ga0070700_100002452 3300005441 Bacteria 9431
56 Ga0070700_101921626 3300005441 Unclassified 512
57 Ga0070663_100046417 3300005455 Bacteria 3073
58 Ga0070663_101070768 3300005455 Unclassified 704
59 Ga0070663_102069978 3300005455 Bacteria 513
60 Ga0070678_100147875 3300005456 Bacteria 1889
61 Ga0070678_100413115 3300005456 Bacteria 1175
62 Ga0070662_100041610 3300005457 Bacteria 3279
63 Ga0068867_100226322 3300005459 Bacteria 1510
64 Ga0068867_101129091 3300005459 Unclassified 717
65 Ga0068867_101941213 3300005459 Bacteria 556
66 Ga0070685_10380723 3300005466 Bacteria 972
67 Ga0070685_10850577 3300005466 Unclassified 676
68 Ga0070679_100584698 3300005530 Bacteria 1060
69 Ga0070679_100742161 3300005530 Bacteria 925
70 Ga0070684_100025188 3300005535 Bacteria 4999
71 Ga0070684_100112130 3300005535 Bacteria 2446
72 Ga0070684_100344661 3300005535 Bacteria 1370
73 Ga0070684_100636384 3300005535 Bacteria 992
74 Ga0070684_100642409 3300005535 Bacteria 988
75 Ga0070684_100811943 3300005535 Bacteria 875
76 Ga0070684_102347553 3300005535 Bacteria 503
77 Ga0068853_101060989 3300005539 Bacteria 781
78 Ga0070672_100330549 3300005543 Bacteria 1297
79 Ga0070695_100199113 3300005545 Bacteria 1430
80 Ga0070693_100517609 3300005547 Bacteria 849
81 Ga0070693_100682768 3300005547 Bacteria 750
82 Ga0070693_100732098 3300005547 Bacteria 727
83 Ga0070704_100086452 3300005549 Bacteria 2324
84 Ga0070664_100143985 3300005564 Bacteria 2100
85 Ga0070664_100252463 3300005564 Bacteria 1585
86 Ga0070664_100290626 3300005564 Bacteria 1476
87 Ga0070664_100386199 3300005564 Bacteria 1279
88 Ga0070664_101131264 3300005564 Bacteria 738
89 Ga0068857_100165989 3300005577 Bacteria 2005
90 Ga0068854_100145298 3300005578 Bacteria 1824
91 Ga0068854_100206658 3300005578 Bacteria 1546
92 Ga0068854_101533580 3300005578 Bacteria 606
93 Ga0068856_100058003 3300005614 Bacteria 3823
94 Ga0070702_100616384 3300005615 Bacteria 816
95 Ga0070702_101298639 3300005615 Bacteria 591
96 Ga0070702_101648659 3300005615 Unclassified 532
97 Ga0068852_100906610 3300005616 Bacteria 899
98 Ga0068852_101247783 3300005616 Bacteria 765
99 Ga0068852_102127811 3300005616 Bacteria 583
100 Ga0068852_102164688 3300005616 Bacteria 578
101 Ga0068859_100363405 3300005617 Bacteria 1543
102 Ga0068864_100698495 3300005618 Bacteria 991
103 Ga0068864_101788267 3300005618 Bacteria 620
104 Ga0068864_101834579 3300005618 Unclassified 612
105 Ga0068866_10096039 3300005718 Bacteria 1625
106 Ga0068866_11011083 3300005718 Bacteria 591
107 Ga0068861_100140715 3300005719 Bacteria 1969
108 Ga0068861_100146105 3300005719 Bacteria 1935
109 Ga0068861_100972079 3300005719 Bacteria 809
110 Ga0068851_10439194 3300005834 Bacteria 774
111 Ga0068870_10347489 3300005840 Bacteria 951
112 Ga0068863_100197517 3300005841 Bacteria 1934
113 Ga0068863_100532553 3300005841 Unclassified 1159
114 Ga0068860_101009288 3300005843 Bacteria 850
115 Ga0068862_100078916 3300005844 Bacteria 2853
116 Ga0068862_100572778 3300005844 Bacteria 1081
117 Ga0081455_10211161 3300005937 Bacteria 1446
118 Ga0081538_10007594 3300005981 Bacteria 9353
119 Ga0081540_1287572 3300005983 Unclassified 566
120 Ga0075365_10836430 3300006038 Bacteria 649
121 Ga0075365_11103344 3300006038 Unclassified 559
122 Ga0075363_100358253 3300006048 Bacteria 853
123 Ga0075363_100520152 3300006048 Archaea 708
124 Ga0070712_100000004 3300006175 Bacteria 215464
125 Ga0070712_100068248 3300006175 Bacteria 2533
126 Ga0075367_10604541 3300006178 Unclassified 697
127 Ga0097621_101063555 3300006237 Bacteria 758
128 Ga0097621_101934304 3300006237 Bacteria 563
129 Ga0068871_100870727 3300006358 Unclassified 834
130 Ga0068871_101452399 3300006358 Bacteria 647
131 Ga0075428_100087232 3300006844 Bacteria 3404
132 Ga0075428_100779496 3300006844 Bacteria 1017
133 Ga0075431_100106314 3300006847 Bacteria 2895
134 Ga0075431_101554172 3300006847 Bacteria 620
135 Ga0075433_10046545 3300006852 Bacteria 3773
136 Ga0075429_100545589 3300006880 Bacteria 1016
137 Ga0075429_100699865 3300006880 Bacteria 888
138 Ga0068865_100241291 3300006881 Bacteria 1422
139 Ga0068865_101836995 3300006881 Bacteria 548
140 Ga0075436_100039442 3300006914 Bacteria 3259
141 Ga0097620_100363432 3300006931 Bacteria 1543
142 Ga0075435_100062522 3300007076 Bacteria 3021
143 Ga0111539_10055552 3300009094 Bacteria 4707
144 Ga0111539_10152098 3300009094 Bacteria 2708
145 Ga0111539_10394283 3300009094 Bacteria 1612
146 Ga0111539_10547703 3300009094 Bacteria 1348
147 Ga0111539_10976698 3300009094 Bacteria 985
148 Ga0111539_11162716 3300009094 Bacteria 896
149 Ga0111539_12311896 3300009094 Bacteria 624
150 Ga0105245_10006719 3300009098 Bacteria 10090
151 Ga0105245_10319054 3300009098 Bacteria 1530
152 Ga0105245_10369857 3300009098 Bacteria 1425
153 Ga0105245_10515005 3300009098 Bacteria 1214
154 Ga0105245_11025494 3300009098 Bacteria 870
155 Ga0105245_11123021 3300009098 Bacteria 833
156 Ga0105245_11359109 3300009098 Bacteria 760
157 Ga0105247_10421334 3300009101 Unclassified 956
158 Ga0114129_11244107 3300009147 Bacteria 925
159 Ga0114129_11933139 3300009147 Bacteria 715
160 Ga0114129_12463469 3300009147 Bacteria 622
161 Ga0105243_10193882 3300009148 Bacteria 1777
162 Ga0105243_10277538 3300009148 Bacteria 1508
163 Ga0105243_10357992 3300009148 Bacteria 1342
164 Ga0105243_11001547 3300009148 Bacteria 838
165 Ga0105241_10398036 3300009174 Bacteria 1207
166 Ga0105242_10190001 3300009176 Bacteria 1818
167 Ga0105242_10304083 3300009176 Bacteria 1457
168 Ga0105242_10936765 3300009176 Bacteria 869
169 Ga0105242_13175578 3300009176 Unclassified 510
170 Ga0105248_10122288 3300009177 Bacteria 2936
171 Ga0105248_10427624 3300009177 Bacteria 1491
172 Ga0105248_10652624 3300009177 Bacteria 1187
173 Ga0105248_10752503 3300009177 Bacteria 1100
174 Ga0105237_10859160 3300009545 Bacteria 914
175 Ga0105238_11000214 3300009551 Bacteria 857
176 Ga0105238_13070870 3300009551 Bacteria 501
177 Ga0105249_10300402 3300009553 Bacteria 1610
178 Ga0105249_10659739 3300009553 Bacteria 1104
179 Ga0105249_10815442 3300009553 Unclassified 998
180 Ga0105249_12182868 3300009553 Bacteria 627
181 Ga0105239_10013492 3300010375 Bacteria 9072
182 Ga0105239_10260281 3300010375 Bacteria 1950
183 Ga0105239_10550609 3300010375 Bacteria 1314
184 Ga0105239_11031001 3300010375 Unclassified 946
185 Ga0105246_10026746 3300011119 Bacteria 3773
186 Ga0105246_10195753 3300011119 Bacteria 1568
187 Ga0105246_10641910 3300011119 Bacteria 923
188 Ga0105246_12279169 3300011119 Unclassified 529
189 Ga0157371_10282058 3300013102 Bacteria 1200
190 Ga0157371_10295636 3300013102 Bacteria 1172
191 Ga0157371_10749305 3300013102 Bacteria 733
192 Ga0157370_10477668 3300013104 Bacteria 1145
193 Ga0157369_10511339 3300013105 Bacteria 1242
194 Ga0157369_10534205 3300013105 Bacteria 1213
195 Ga0157374_10011836 3300013296 Bacteria 7568
196 Ga0157374_10314296 3300013296 Unclassified 1551
197 Ga0157378_11090743 3300013297 Bacteria 835
198 Ga0163162_10273245 3300013306 Bacteria 1822
199 Ga0163162_10414729 3300013306 Bacteria 1479
200 Ga0163162_11613373 3300013306 Bacteria 740
201 Ga0163162_11792038 3300013306 Bacteria 702
202 Ga0157372_10135856 3300013307 Bacteria 2832
203 Ga0157372_10476818 3300013307 Bacteria 1454
204 Ga0157372_10591349 3300013307 Bacteria 1293
205 Ga0157372_11390216 3300013307 Unclassified 809
206 Ga0157375_10027247 3300013308 Bacteria 5339
207 Ga0157375_10545800 3300013308 Bacteria 1321
208 Ga0157375_12110308 3300013308 Unclassified 671
209 Ga0157375_13491157 3300013308 Bacteria 523
210 Ga0163163_10054841 3300014325 Bacteria 3939
211 Ga0163163_10824357 3300014325 Bacteria 991
212 Ga0163163_11391275 3300014325 Bacteria 763
213 Ga0157380_10315115 3300014326 Bacteria 1448
214 Ga0157380_10331668 3300014326 Bacteria 1415
215 Ga0157380_11553441 3300014326 Unclassified 716
216 Ga0157380_12555865 3300014326 Unclassified 577
217 Ga0182008_10585749 3300014497 Unclassified 624
218 Ga0182008_10757078 3300014497 Bacteria 560
219 Ga0157377_10003239 3300014745 Bacteria 7352
220 Ga0157377_10628026 3300014745 Bacteria 770
221 Ga0157379_11008266 3300014968 Bacteria 794
222 Ga0157376_10912158 3300014969 Bacteria 897
223 Ga0163161_10752805 3300017792 Bacteria 815
224 Ga0213874_10035494 3300021377 Bacteria 1465
225 Ga0213876_10002280 3300021384 Bacteria 11315
226 Ga0207426_1012353 3300025302 Bacteria 3211
227 Ga0207426_1061033 3300025302 Bacteria 1084
228 Ga0207653_10026368 3300025885 Bacteria 1863
229 Ga0207692_10737468 3300025898 Bacteria 641
230 Ga0207710_10102365 3300025900 Bacteria 1352
231 Ga0207688_10023422 3300025901 Bacteria 3381
232 Ga0207688_10114366 3300025901 Bacteria 1569
233 Ga0207680_10940658 3300025903 Unclassified 619
234 Ga0207647_10209567 3300025904 Bacteria 1126
235 Ga0207645_10065469 3300025907 Bacteria 2323
236 Ga0207643_10471528 3300025908 Bacteria 800
237 Ga0207643_10517389 3300025908 Bacteria 764
238 Ga0207684_11610189 3300025910 Bacteria 526
239 Ga0207654_11416027 3300025911 Unclassified 507
240 Ga0207695_10451722 3300025913 Bacteria 1168
241 Ga0207693_10000017 3300025915 Bacteria 139308
242 Ga0207693_10112643 3300025915 Bacteria 2134
243 Ga0207657_10171121 3300025919 Bacteria 1759
244 Ga0207657_10607993 3300025919 Bacteria 853
245 Ga0207649_10322345 3300025920 Unclassified 1136
246 Ga0207652_11397380 3300025921 Bacteria 603
247 Ga0207681_10790571 3300025923 Bacteria 792
248 Ga0207694_10946916 3300025924 Bacteria 728
249 Ga0207650_10456641 3300025925 Bacteria 1064
250 Ga0207659_10277375 3300025926 Bacteria 1369
251 Ga0207659_11115230 3300025926 Bacteria 679
252 Ga0207687_10014336 3300025927 Bacteria 5185
253 Ga0207687_10266981 3300025927 Bacteria 1366
254 Ga0207687_11091163 3300025927 Bacteria 685
255 Ga0207644_10059088 3300025931 Bacteria 2773
256 Ga0207644_10930784 3300025931 Unclassified 729
257 Ga0207690_10054471 3300025932 Bacteria 2690
258 Ga0207690_10503360 3300025932 Unclassified 980
259 Ga0207706_10048060 3300025933 Bacteria 3774
260 Ga0207706_10213651 3300025933 Bacteria 1690
261 Ga0207686_10276760 3300025934 Bacteria 1237
262 Ga0207686_10324992 3300025934 Bacteria 1151
263 Ga0207709_10156708 3300025935 Bacteria 1583
264 Ga0207709_10160277 3300025935 Bacteria 1568
265 Ga0207709_10501981 3300025935 Unclassified 947
266 Ga0207670_10031310 3300025936 Bacteria 3407
267 Ga0207669_10112980 3300025937 Bacteria 1825
268 Ga0207669_10422904 3300025937 Bacteria 1049
269 Ga0207669_11638307 3300025937 Unclassified 549
270 Ga0207704_10409479 3300025938 Bacteria 1072
271 Ga0207691_10258043 3300025940 Bacteria 1503
272 Ga0207711_10222163 3300025941 Bacteria 1728
273 Ga0207711_10335604 3300025941 Bacteria 1398
274 Ga0207689_10101696 3300025942 Bacteria 2361
275 Ga0207689_10218828 3300025942 Bacteria 1573
276 Ga0207689_10593340 3300025942 Unclassified 932
277 Ga0207661_10025867 3300025944 Bacteria 4466
278 Ga0207661_10182427 3300025944 Bacteria 1834
279 Ga0207661_11206278 3300025944 Bacteria 696
280 Ga0207661_11679246 3300025944 Bacteria 580
281 Ga0207679_10118780 3300025945 Bacteria 2101
282 Ga0207679_10217454 3300025945 Bacteria 1606
283 Ga0207679_10266010 3300025945 Bacteria 1464
284 Ga0207679_10333961 3300025945 Bacteria 1316
285 Ga0207651_10695104 3300025960 Bacteria 896
286 Ga0207712_10124499 3300025961 Bacteria 1955
287 Ga0207712_10509597 3300025961 Bacteria 1030
288 Ga0207712_11270165 3300025961 Bacteria 658
289 Ga0207668_10028387 3300025972 Bacteria 3659
290 Ga0207668_10459871 3300025972 Bacteria 1088
291 Ga0207640_10088419 3300025981 Bacteria 2139
292 Ga0207640_10101709 3300025981 Bacteria 2017
293 Ga0207677_10034032 3300026023 Bacteria 3295
294 Ga0207639_10642658 3300026041 Bacteria 981
295 Ga0207639_11031558 3300026041 Bacteria 771
296 Ga0207678_10116075 3300026067 Bacteria 2284
297 Ga0207678_10144216 3300026067 Bacteria 2032
298 Ga0207678_10509252 3300026067 Unclassified 1050
299 Ga0207678_11146093 3300026067 Bacteria 689
300 Ga0207708_10000450 3300026075 Bacteria 31989
301 Ga0207708_10113581 3300026075 Bacteria 2105
302 Ga0207702_10135637 3300026078 Bacteria 2220
303 Ga0207641_10718493 3300026088 Bacteria 985
304 Ga0207641_11797897 3300026088 Bacteria 615
305 Ga0207648_10188359 3300026089 Bacteria 1828
306 Ga0207648_10198965 3300026089 Bacteria 1777
307 Ga0207648_10784417 3300026089 Bacteria 886
308 Ga0207648_11392552 3300026089 Bacteria 659
309 Ga0207676_10145916 3300026095 Bacteria 2032
310 Ga0207676_10814438 3300026095 Unclassified 912
311 Ga0207676_12437698 3300026095 Bacteria 520
312 Ga0207674_10104882 3300026116 Bacteria 2805
313 Ga0207674_11702818 3300026116 Unclassified 599
314 Ga0207675_100299888 3300026118 Bacteria 1565
315 Ga0207675_100926435 3300026118 Unclassified 888
316 Ga0207683_10038971 3300026121 Bacteria 4144
317 Ga0207698_10136052 3300026142 Bacteria 2108
318 Ga0207698_10285506 3300026142 Bacteria 1529
319 Ga0207698_10333398 3300026142 Bacteria 1426
320 Ga0207698_11075234 3300026142 Bacteria 817
321 Ga0207698_11378525 3300026142 Bacteria 720
322 Ga0207698_11820083 3300026142 Bacteria 624
323 Ga0207428_10046530 3300027907 Bacteria 3489
324 Ga0207428_10118396 3300027907 Bacteria 2033
325 Ga0207428_10150068 3300027907 Bacteria 1774
326 Ga0207428_10641800 3300027907 Bacteria 763
327 Ga0207428_11232310 3300027907 Unclassified 520
328 Ga0268265_10066605 3300028380 Bacteria 2785
329 Ga0268265_10138082 3300028380 Bacteria 2037
330 Ga0268264_10228542 3300028381 Bacteria 1717
331 Ga0307408_100137940 3300031548 Bacteria 1911
332 Ga0307408_102358670 3300031548 Bacteria 516
333 Ga0307405_10389962 3300031731 Unclassified 1087
334 Ga0307413_10391404 3300031824 Unclassified 1086
335 Ga0307413_11094514 3300031824 Unclassified 688
336 Ga0307413_11203299 3300031824 Bacteria 659
337 Ga0307410_10144258 3300031852 Bacteria 1765
338 Ga0307410_10764094 3300031852 Bacteria 819
339 Ga0307410_10788597 3300031852 Bacteria 807
340 Ga0307410_11340863 3300031852 Unclassified 627
341 Ga0307406_10636537 3300031901 Unclassified 884
342 Ga0307407_10099813 3300031903 Bacteria 1799
343 Ga0307407_10237419 3300031903 Bacteria 1242
344 Ga0307407_10493581 3300031903 Bacteria 896
345 Ga0307412_10161216 3300031911 Bacteria 1667
346 Ga0307412_10357600 3300031911 Bacteria 1175
347 Ga0307412_10458507 3300031911 Bacteria 1052
348 Ga0307409_100273742 3300031995 Bacteria 1556
349 Ga0307409_100493862 3300031995 Bacteria 1190
350 Ga0307409_100549990 3300031995 Bacteria 1133
351 Ga0307409_100749189 3300031995 Unclassified 980
352 Ga0307409_101158328 3300031995 Bacteria 796
353 Ga0307416_100130102 3300032002 Bacteria 2264
354 Ga0307416_100457853 3300032002 Bacteria 1330
355 Ga0307416_103832731 3300032002 Bacteria 504
356 Ga0307415_100326107 3300032126 Bacteria 1282
357 Ga0307415_100374240 3300032126 Unclassified 1207
358 Ga0307415_100857304 3300032126 Bacteria 834
359 Ga0373925_1318274 3300037068 Bacteria 592
360 Ga0395898_0810427 3300037466 Bacteria 876
361 Ga0395898_1102793 3300037466 Bacteria 727
362 Ga0436364_0885163 3300037853 Bacteria 1968
363 Ga0395901_0246800 3300038443 Bacteria 1861
364 Ga0395901_0458979 3300038443 Bacteria 1302
365 Ga0395901_0603973 3300038443 Bacteria 1106
366 Ga0395901_0658164 3300038443 Bacteria 1050
367 Ga0395901_1240165 3300038443 Bacteria 710
368 Ga0436365_0329855 3300039437 Bacteria 19574
369 Ga0436365_0779350 3300039437 Bacteria 923
370 Ga0436365_1798385 3300039437 Bacteria 7935
371 Ga0436363_1031266 3300039450 Bacteria 672
372 Ga0436362_0734840 3300039453 Bacteria 632
373 Ga0451789_0860286 3300041443 Bacteria 831
374 Ga0451791_0123574 3300041451 Bacteria 2079
375 Ga0451791_0825461 3300041451 Bacteria 644
376 Ga0451793_0135368 3300041452 Bacteria 572
377 Ga0451797_0744969 3300041453 Bacteria 2018
378 Ga0451797_1188669 3300041453 Unclassified 543
379 Ga0451800_0437735 3300041459 Bacteria 633
380 Ga0451800_1017288 3300041459 Bacteria 986
381 Ga0451802_0359313 3300041460 Bacteria 1042
382 Ga0451807_0745111 3300041486 Bacteria 2116
383 Ga0451833_0996336 3300041491 Unclassified 600
384 Ga0451835_1205094 3300041492 Bacteria 665
385 Ga0451837_1695931 3300041494 Bacteria 2469
386 Ga0451839_0934935 3300041496 Bacteria 641
387 Ga0451841_0677210 3300041498 Bacteria 850
388 Ga0451853_1779082 3300041512 Bacteria 734
389 Ga0451853_1942391 3300041512 Bacteria 762
390 Ga0466969_0034424 3300044656 Bacteria 2566
391 Ga0466972_0505648 3300044658 Unclassified 569
392 Ga0466972_0605333 3300044658 Bacteria 518
393 Ga0466965_0132966 3300044683 Unclassified 1291
394 Ga0466965_0550168 3300044683 Bacteria 652
395 Ga0466965_0801400 3300044683 Bacteria 545
396 Ga0466966_0450790 3300044684 Bacteria 773
397 Ga0466961_0042799 3300044693 Bacteria 2902
398 Ga0466961_0489437 3300044693 Unclassified 743
399 Ga0466963_0012866 3300044694 Bacteria 5126
400 Ga0466963_0033779 3300044694 Bacteria 3324
401 Ga0466963_0072156 3300044694 Bacteria 2325
402 Ga0466963_0101087 3300044694 Bacteria 1974
403 Ga0466963_0101877 3300044694 Bacteria 1966
404 Ga0466963_0115480 3300044694 Bacteria 1845
405 Ga0466963_0159345 3300044694 Bacteria 1570
406 Ga0466963_0168871 3300044694 Bacteria 1524
407 Ga0466963_0277311 3300044694 Bacteria 1178
408 Ga0466963_0279356 3300044694 Bacteria 1173
409 Ga0466963_0434771 3300044694 Bacteria 926
410 Ga0466963_0492420 3300044694 Bacteria 865
411 Ga0466963_0631144 3300044694 Bacteria 756
412 Ga0466963_0631950 3300044694 Bacteria 756
413 Ga0466964_0165916 3300044706 Bacteria 1036
414 Ga0466964_0203771 3300044706 Bacteria 951
415 Ga0466964_0364739 3300044706 Bacteria 746
416 Ga0466964_0377382 3300044706 Bacteria 735
417 Ga0466971_0119354 3300044719 Bacteria 1220
418 Ga0466968_0166918 3300044735 Bacteria 1018
419 Ga0466970_0087024 3300044765 Bacteria 1694
420 Ga0466970_0149925 3300044765 Bacteria 1287
421 Ga0466970_0445915 3300044765 Bacteria 742
422 Ga0466957_0018933 3300044842 Bacteria 4047
423 Ga0466957_0064242 3300044842 Bacteria 2258
424 Ga0466957_0086738 3300044842 Bacteria 1956
425 Ga0466957_0116223 3300044842 Bacteria 1702
426 Ga0466960_0028182 3300044901 Bacteria 2569
427 Ga0466960_0057406 3300044901 Bacteria 1898
428 Ga0466960_0277210 3300044901 Bacteria 939
429 Ga0466960_0314699 3300044901 Bacteria 885
430 Ga0466960_0338158 3300044901 Unclassified 856
431 Ga0466960_0394067 3300044901 Bacteria 797
432 Ga0466959_0023912 3300045049 Bacteria 4523
433 Ga0466959_0854368 3300045049 Bacteria 608
434 Ga0466958_0006024 3300045836 Bacteria 6572
435 Ga0466958_0040246 3300045836 Bacteria 2809
436 Ga0466958_0056460 3300045836 Bacteria 2385
437 Ga0466958_0114481 3300045836 Bacteria 1685
438 Ga0466958_0483350 3300045836 Bacteria 803
439 Ga0466967_0004855 3300045976 Bacteria 9178
440 Ga0466967_0022456 3300045976 Bacteria 5149
441 Ga0466967_0026940 3300045976 Bacteria 4772
442 Ga0466967_0100302 3300045976 Bacteria 2645
443 Ga0466967_0131050 3300045976 Bacteria 2327
444 Ga0466967_0160808 3300045976 Bacteria 2107
445 Ga0466967_0203213 3300045976 Bacteria 1877
446 Ga0466967_0273113 3300045976 Bacteria 1620
447 Ga0466967_0297385 3300045976 Bacteria 1552
448 Ga0466967_0344806 3300045976 Bacteria 1441
449 Ga0466967_0407794 3300045976 Bacteria 1323
450 Ga0466967_0469363 3300045976 Bacteria 1232
451 Ga0466967_0533659 3300045976 Unclassified 1154
452 Ga0466967_0563997 3300045976 Bacteria 1121
453 Ga0466967_0598951 3300045976 Bacteria 1087
454 Ga0466967_1368260 3300045976 Bacteria 705
455 Ga0466967_1488967 3300045976 Bacteria 674
456 Ga0466967_1871740 3300045976 Bacteria 597
457 Ga0466967_2274586 3300045976 Bacteria 538
458 Ga0495603_0155364 3300046455 Bacteria 1328
459 Ga0495582_0266651 3300046473 Bacteria 982
460 Ga0495616_0260236 3300046513 Bacteria 743
461 Ga0495620_0096356 3300046515 Bacteria 1183
462 Ga0495631_0133712 3300046518 Bacteria 1066
463 Ga0495644_0408820 3300046523 Bacteria 538
464 Ga0495609_0277042 3300046538 Bacteria 687
465 Ga0495656_0194874 3300046615 Bacteria 1003
466 Ga0495668_0494720 3300046616 Bacteria 674
467 Ga0495589_0134729 3300046794 Bacteria 1185
468 Ga0495685_191716 3300047447 Bacteria 657
469 Ga0496100_0071741 3300048903 Bacteria 2313
470 Ga0496100_1213348 3300048903 Unclassified 595
471 Ga0496101_0075541 3300048904 Bacteria 2481
472 Ga0496102_0098617 3300048905 Bacteria 2711
473 Ga0496102_1495727 3300048905 Bacteria 594
474 Ga0496102_1741564 3300048905 Bacteria 541
475 Ga0496103_0014313 3300048906 Bacteria 4711
476 Ga0496104_0079407 3300048907 Bacteria 3127
477 Ga0496105_0012943 3300048908 Bacteria 6611
478 Ga0496106_0033905 3300048909 Bacteria 3811
479 Ga0496107_0194710 3300048910 Bacteria 1506
480 Ga0496108_0053412 3300048911 Bacteria 3388
481 Ga0496108_0954375 3300048911 Bacteria 734
482 Ga0496109_0052752 3300048912 Bacteria 3707
483 Ga0496109_0514861 3300048912 Bacteria 1129
484 Ga0496110_0063213 3300048913 Bacteria 3270
485 Ga0496110_0340126 3300048913 Bacteria 1367
486 Ga0496110_0422752 3300048913 Unclassified 1215
487 Ga0496110_0877713 3300048913 Bacteria 803
488 Ga0496111_0057666 3300048914 Bacteria 2811
489 Ga0496111_1259444 3300048914 Unclassified 522
490 Ga0496112_0002780 3300048915 Bacteria 14199
491 Ga0496112_0339184 3300048915 Bacteria 1446
492 Ga0496113_0023299 3300048916 Bacteria 4390
493 Ga0496114_0041404 3300048917 Bacteria 3818
494 Ga0496114_1523182 3300048917 Bacteria 557
495 Ga0496115_0232671 3300048918 Bacteria 1519
496 Ga0501031_0103623 3300049568 Bacteria 1857
497 Ga0501034_0174378 3300049571 Bacteria 2117
498 Ga0501038_1074005 3300049574 Unclassified 589
499 Ga0501039_1359677 3300049575 Unclassified 547
500 Ga0501040_0174975 3300049576 Bacteria 1521
501 Ga0501042_0671664 3300049578 Unclassified 753
502 Ga0501046_0356777 3300049580 Bacteria 1061
503 Ga0501046_0655891 3300049580 Bacteria 742
504 Ga0501070_0744381 3300049586 Bacteria 773
505 Ga0501071_0114944 3300049587 Bacteria 1991
506 Ga0501071_1051986 3300049587 Bacteria 629
507 Ga0501072_0188433 3300049588 Bacteria 1645
508 Ga0501074_0681031 3300049590 Bacteria 726
509 Ga0501076_0097731 3300049592 Bacteria 2365
510 Ga0501077_0197782 3300049593 Unclassified 1277
511 Ga0501079_0452964 3300049741 Bacteria 1008
512 Ga0501081_1434613 3300049743 Bacteria 524
513 Ga0501035_0084148 3300049822 Bacteria 2806
514 Ga0501035_1248520 3300049822 Bacteria 575
515 Ga0501044_1023006 3300049823 Bacteria 697
516 Ga0501044_1597624 3300049823 Unclassified 517
517 nmdc:mga0yw44_786582_c1 3300050492 Bacteria 646
518 nmdc:mga05p37_1608440_c1 3300050507 Unclassified 639
519 nmdc:mga05p37_472594_c1 3300050507 Bacteria 1446
520 nmdc:mga09592_1366463_c1 3300050508 Bacteria 580
521 nmdc:mga09592_561676_c1 3300050508 Bacteria 980
522 nmdc:mga0qj67_1148986_c1 3300050509 Unclassified 605
523 nmdc:mga0qj67_710795_c1 3300050509 Unclassified 799
524 nmdc:mga06r32_161294_c1 3300050510 Bacteria 2225
525 nmdc:mga08y16_1036253_c1 3300050511 Bacteria 799
526 nmdc:mga08y16_129051_c1 3300050511 Bacteria 2630
527 nmdc:mga08y16_491749_c1 3300050511 Bacteria 1247
528 nmdc:mga08y16_53102_c1 3300050511 Bacteria 4239
529 nmdc:mga0n895_316515_c1 3300050512 Bacteria 1581
530 nmdc:mga0n895_718140_c1 3300050512 Bacteria 994
531 nmdc:mga0rr50_97544_c1 3300050513 Bacteria 2302
532 nmdc:mga08x19_314722_c1 3300050514 Bacteria 1089
533 nmdc:mga0a205_61821_c1 3300050515 Bacteria 3618
534 Ga0495655_0072989 3300053083 Bacteria 964
535 Ga0466962_0013262 3300061719 Bacteria 3963
536 Ga0466962_0084447 3300061719 Bacteria 1519
537 Ga0530510_0606042 3300061734 Unclassified 833
538 Ga0213876_10066024
539 JGI24752J21851_1037568
540 JGI24746J21847_1010774
541 JGI24739J22299_10061390
542 JGI24737J22298_10120038
543 JGI24743J22301_10020827
544 JGI24735J21928_10175015
545 JGI24750J21931_1068112
546 JGI24745J21846_1014176
547 JGI24744J21845_10018310
548 JGI24033J26618_1024973
549 JGI25407J50210_10033494
550 JGI25407J50210_10140199
551 Ga0070676_10092705
552 Ga0070683_100104413
553 Ga0070683_100216138
554 Ga0070683_100425718
555 Ga0070683_100577739
556 Ga0070683_100816728
557 Ga0070670_100962422
558 Ga0070677_10354526
559 Ga0068869_100145274
560 Ga0068869_100680320
561 Ga0068869_100745846
562 Ga0070666_10512637
563 Ga0070666_10789393
564 Ga0070682_100006422
565 Ga0070682_100670561
566 Ga0070682_100761213
567 Ga0068868_100003558
568 Ga0070689_100192779
569 Ga0070691_10020406
570 Ga0070691_10382336
571 Ga0070687_100378457
572 Ga0070668_100037410
573 Ga0070668_101170571
574 Ga0070669_100689162
575 Ga0070669_100953009
576 Ga0070675_100029832
577 Ga0070671_100241927
578 Ga0070674_101106676
579 Ga0070688_100029977
580 Ga0070688_100997655
581 Ga0070688_101002116
582 Ga0070659_100283674
583 Ga0070659_100605742
584 Ga0070659_100692533
585 Ga0070659_101310362
586 Ga0070659_101518758
587 Ga0070703_10071983
588 Ga0070713_100447220
589 Ga0070710_10914789
590 Ga0070701_10906110
591 Ga0070705_100276363
592 Ga0070700_100002452
593 Ga0070700_101921626
594 Ga0070663_100046417
595 Ga0070663_101070768
596 Ga0070663_102069978
597 Ga0070678_100147875
598 Ga0070678_100413115
599 Ga0070662_100041610
600 Ga0068867_100226322
601 Ga0068867_101129091
602 Ga0068867_101941213
603 Ga0070685_10380723
604 Ga0070685_10850577
605 Ga0070679_100584698
606 Ga0070679_100742161
607 Ga0070684_100025188
608 Ga0070684_100112130
609 Ga0070684_100344661
610 Ga0070684_100636384
611 Ga0070684_100642409
612 Ga0070684_100811943
613 Ga0070684_102347553
614 Ga0068853_101060989
615 Ga0070672_100330549
616 Ga0070695_100199113
617 Ga0070693_100517609
618 Ga0070693_100682768
619 Ga0070693_100732098
620 Ga0070704_100086452
621 Ga0070664_100143985
622 Ga0070664_100252463
623 Ga0070664_100290626
624 Ga0070664_100386199
625 Ga0070664_101131264
626 Ga0068857_100165989
627 Ga0068854_100145298
628 Ga0068854_100206658
629 Ga0068854_101533580
630 Ga0068856_100058003
631 Ga0070702_100616384
632 Ga0070702_101298639
633 Ga0070702_101648659
634 Ga0068852_100906610
635 Ga0068852_101247783
636 Ga0068852_102127811
637 Ga0068852_102164688
638 Ga0068859_100363405
639 Ga0068864_100698495
640 Ga0068864_101788267
641 Ga0068864_101834579
642 Ga0068866_10096039
643 Ga0068866_11011083
644 Ga0068861_100140715
645 Ga0068861_100146105
646 Ga0068861_100972079
647 Ga0068851_10439194
648 Ga0068870_10347489
649 Ga0068863_100197517
650 Ga0068863_100532553
651 Ga0068860_101009288
652 Ga0068862_100078916
653 Ga0068862_100572778
654 Ga0081455_10211161
655 Ga0081538_10007594
656 Ga0081540_1287572
657 Ga0075365_10836430
658 Ga0075365_11103344
659 Ga0075363_100358253
660 Ga0075363_100520152
661 Ga0070712_100000004
662 Ga0070712_100068248
663 Ga0075367_10604541
664 Ga0097621_101063555
665 Ga0097621_101934304
666 Ga0068871_100870727
667 Ga0068871_101452399
668 Ga0075428_100087232
669 Ga0075428_100779496
670 Ga0075431_100106314
671 Ga0075431_101554172
672 Ga0075433_10046545
673 Ga0075429_100545589
674 Ga0075429_100699865
675 Ga0068865_100241291
676 Ga0068865_101836995
677 Ga0075436_100039442
678 Ga0097620_100363432
679 Ga0075435_100062522
680 Ga0111539_10055552
681 Ga0111539_10152098
682 Ga0111539_10394283
683 Ga0111539_10547703
684 Ga0111539_10976698
685 Ga0111539_11162716
686 Ga0111539_12311896
687 Ga0105245_10006719
688 Ga0105245_10319054
689 Ga0105245_10369857
690 Ga0105245_10515005
691 Ga0105245_11025494
692 Ga0105245_11123021
693 Ga0105245_11359109
694 Ga0105247_10421334
695 Ga0114129_11244107
696 Ga0114129_11933139
697 Ga0114129_12463469
698 Ga0105243_10193882
699 Ga0105243_10277538
700 Ga0105243_10357992
701 Ga0105243_11001547
702 Ga0105241_10398036
703 Ga0105242_10190001
704 Ga0105242_10304083
705 Ga0105242_10936765
706 Ga0105242_13175578
707 Ga0105248_10122288
708 Ga0105248_10427624
709 Ga0105248_10652624
710 Ga0105248_10752503
711 Ga0105237_10859160
712 Ga0105238_11000214
713 Ga0105238_13070870
714 Ga0105249_10300402
715 Ga0105249_10659739
716 Ga0105249_10815442
717 Ga0105249_12182868
718 Ga0105239_10013492
719 Ga0105239_10260281
720 Ga0105239_10550609
721 Ga0105239_11031001
722 Ga0105246_10026746
723 Ga0105246_10195753
724 Ga0105246_10641910
725 Ga0105246_12279169
726 Ga0157371_10282058
727 Ga0157371_10295636
728 Ga0157371_10749305
729 Ga0157370_10477668
730 Ga0157369_10511339
731 Ga0157369_10534205
732 Ga0157374_10011836
733 Ga0157374_10314296
734 Ga0157378_11090743
735 Ga0163162_10273245
736 Ga0163162_10414729
737 Ga0163162_11613373
738 Ga0163162_11792038
739 Ga0157372_10135856
740 Ga0157372_10476818
741 Ga0157372_10591349
742 Ga0157372_11390216
743 Ga0157375_10027247
744 Ga0157375_10545800
745 Ga0157375_12110308
746 Ga0157375_13491157
747 Ga0163163_10054841
748 Ga0163163_10824357
749 Ga0163163_11391275
750 Ga0157380_10315115
751 Ga0157380_10331668
752 Ga0157380_11553441
753 Ga0157380_12555865
754 Ga0182008_10585749
755 Ga0182008_10757078
756 Ga0157377_10003239
757 Ga0157377_10628026
758 Ga0157379_11008266
759 Ga0157376_10912158
760 Ga0163161_10752805
761 Ga0213874_10035494
762 Ga0213876_10002280
763 Ga0207426_1012353
764 Ga0207426_1061033
765 Ga0207653_10026368
766 Ga0207692_10737468
767 Ga0207710_10102365
768 Ga0207688_10023422
769 Ga0207688_10114366
770 Ga0207680_10940658
771 Ga0207647_10209567
772 Ga0207645_10065469
773 Ga0207643_10471528
774 Ga0207643_10517389
775 Ga0207684_11610189
776 Ga0207654_11416027
777 Ga0207695_10451722
778 Ga0207693_10000017
779 Ga0207693_10112643
780 Ga0207657_10171121
781 Ga0207657_10607993
782 Ga0207649_10322345
783 Ga0207652_11397380
784 Ga0207681_10790571
785 Ga0207694_10946916
786 Ga0207650_10456641
787 Ga0207659_10277375
788 Ga0207659_11115230
789 Ga0207687_10014336
790 Ga0207687_10266981
791 Ga0207687_11091163
792 Ga0207644_10059088
793 Ga0207644_10930784
794 Ga0207690_10054471
795 Ga0207690_10503360
796 Ga0207706_10048060
797 Ga0207706_10213651
798 Ga0207686_10276760
799 Ga0207686_10324992
800 Ga0207709_10156708
801 Ga0207709_10160277
802 Ga0207709_10501981
803 Ga0207670_10031310
804 Ga0207669_10112980
805 Ga0207669_10422904
806 Ga0207669_11638307
807 Ga0207704_10409479
808 Ga0207691_10258043
809 Ga0207711_10222163
810 Ga0207711_10335604
811 Ga0207689_10101696
812 Ga0207689_10218828
813 Ga0207689_10593340
814 Ga0207661_10025867
815 Ga0207661_10182427
816 Ga0207661_11206278
817 Ga0207661_11679246
818 Ga0207679_10118780
819 Ga0207679_10217454
820 Ga0207679_10266010
821 Ga0207679_10333961
822 Ga0207651_10695104
823 Ga0207712_10124499
824 Ga0207712_10509597
825 Ga0207712_11270165
826 Ga0207668_10028387
827 Ga0207668_10459871
828 Ga0207640_10088419
829 Ga0207640_10101709
830 Ga0207677_10034032
831 Ga0207639_10642658
832 Ga0207639_11031558
833 Ga0207678_10116075
834 Ga0207678_10144216
835 Ga0207678_10509252
836 Ga0207678_11146093
837 Ga0207708_10000450
838 Ga0207708_10113581
839 Ga0207702_10135637
840 Ga0207641_10718493
841 Ga0207641_11797897
842 Ga0207648_10188359
843 Ga0207648_10198965
844 Ga0207648_10784417
845 Ga0207648_11392552
846 Ga0207676_10145916
847 Ga0207676_10814438
848 Ga0207676_12437698
849 Ga0207674_10104882
850 Ga0207674_11702818
851 Ga0207675_100299888
852 Ga0207675_100926435
853 Ga0207683_10038971
854 Ga0207698_10136052
855 Ga0207698_10285506
856 Ga0207698_10333398
857 Ga0207698_11075234
858 Ga0207698_11378525
859 Ga0207698_11820083
860 Ga0207428_10046530
861 Ga0207428_10118396
862 Ga0207428_10150068
863 Ga0207428_10641800
864 Ga0207428_11232310
865 Ga0268265_10066605
866 Ga0268265_10138082
867 Ga0268264_10228542
868 Ga0307408_100137940
869 Ga0307408_102358670
870 Ga0307405_10389962
871 Ga0307413_10391404
872 Ga0307413_11094514
873 Ga0307413_11203299
874 Ga0307410_10144258
875 Ga0307410_10764094
876 Ga0307410_10788597
877 Ga0307410_11340863
878 Ga0307406_10636537
879 Ga0307407_10099813
880 Ga0307407_10237419
881 Ga0307407_10493581
882 Ga0307412_10161216
883 Ga0307412_10357600
884 Ga0307412_10458507
885 Ga0307409_100273742
886 Ga0307409_100493862
887 Ga0307409_100549990
888 Ga0307409_100749189
889 Ga0307409_101158328
890 Ga0307416_100130102
891 Ga0307416_100457853
892 Ga0307416_103832731
893 Ga0307415_100326107
894 Ga0307415_100374240
895 Ga0307415_100857304
896 Ga0373925_1318274
897 Ga0395898_0810427
898 Ga0395898_1102793
899 Ga0436364_0885163
900 Ga0395901_0246800
901 Ga0395901_0458979
902 Ga0395901_0603973
903 Ga0395901_0658164
904 Ga0395901_1240165
905 Ga0436365_0329855
906 Ga0436365_0779350
907 Ga0436365_1798385
908 Ga0436363_1031266
909 Ga0436362_0734840
910 Ga0451789_0860286
911 Ga0451791_0123574
912 Ga0451791_0825461
913 Ga0451793_0135368
914 Ga0451797_0744969
915 Ga0451797_1188669
916 Ga0451800_0437735
917 Ga0451800_1017288
918 Ga0451802_0359313
919 Ga0451807_0745111
920 Ga0451833_0996336
921 Ga0451835_1205094
922 Ga0451837_1695931
923 Ga0451839_0934935
924 Ga0451841_0677210
925 Ga0451853_1779082
926 Ga0451853_1942391
927 Ga0466969_0034424
928 Ga0466972_0505648
929 Ga0466972_0605333
930 Ga0466965_0132966
931 Ga0466965_0550168
932 Ga0466965_0801400
933 Ga0466966_0450790
934 Ga0466961_0042799
935 Ga0466961_0489437
936 Ga0466963_0012866
937 Ga0466963_0033779
938 Ga0466963_0072156
939 Ga0466963_0101087
940 Ga0466963_0101877
941 Ga0466963_0115480
942 Ga0466963_0159345
943 Ga0466963_0168871
944 Ga0466963_0277311
945 Ga0466963_0279356
946 Ga0466963_0434771
947 Ga0466963_0492420
948 Ga0466963_0631144
949 Ga0466963_0631950
950 Ga0466964_0165916
951 Ga0466964_0203771
952 Ga0466964_0364739
953 Ga0466964_0377382
954 Ga0466971_0119354
955 Ga0466968_0166918
956 Ga0466970_0087024
957 Ga0466970_0149925
958 Ga0466970_0445915
959 Ga0466957_0018933
960 Ga0466957_0064242
961 Ga0466957_0086738
962 Ga0466957_0116223
963 Ga0466960_0028182
964 Ga0466960_0057406
965 Ga0466960_0277210
966 Ga0466960_0314699
967 Ga0466960_0338158
968 Ga0466960_0394067
969 Ga0466959_0023912
970 Ga0466959_0854368
971 Ga0466958_0006024
972 Ga0466958_0040246
973 Ga0466958_0056460
974 Ga0466958_0114481
975 Ga0466958_0483350
976 Ga0466967_0004855
977 Ga0466967_0022456
978 Ga0466967_0026940
979 Ga0466967_0100302
980 Ga0466967_0131050
981 Ga0466967_0160808
982 Ga0466967_0203213
983 Ga0466967_0273113
984 Ga0466967_0297385
985 Ga0466967_0344806
986 Ga0466967_0407794
987 Ga0466967_0469363
988 Ga0466967_0533659
989 Ga0466967_0563997
990 Ga0466967_0598951
991 Ga0466967_1368260
992 Ga0466967_1488967
993 Ga0466967_1871740
994 Ga0466967_2274586
995 Ga0495603_0155364
996 Ga0495582_0266651
997 Ga0495616_0260236
998 Ga0495620_0096356
999 Ga0495631_0133712
1000 Ga0495644_0408820
1001 Ga0495609_0277042
1002 Ga0495656_0194874
1003 Ga0495668_0494720
1004 Ga0495589_0134729
1005 Ga0495685_191716
1006 Ga0496100_0071741
1007 Ga0496100_1213348
1008 Ga0496101_0075541
1009 Ga0496102_0098617
1010 Ga0496102_1495727
1011 Ga0496102_1741564
1012 Ga0496103_0014313
1013 Ga0496104_0079407
1014 Ga0496105_0012943
1015 Ga0496106_0033905
1016 Ga0496107_0194710
1017 Ga0496108_0053412
1018 Ga0496108_0954375
1019 Ga0496109_0052752
1020 Ga0496109_0514861
1021 Ga0496110_0063213
1022 Ga0496110_0340126
1023 Ga0496110_0422752
1024 Ga0496110_0877713
1025 Ga0496111_0057666
1026 Ga0496111_1259444
1027 Ga0496112_0002780
1028 Ga0496112_0339184
1029 Ga0496113_0023299
1030 Ga0496114_0041404
1031 Ga0496114_1523182
1032 Ga0496115_0232671
1033 Ga0501031_0103623
1034 Ga0501034_0174378
1035 Ga0501038_1074005
1036 Ga0501039_1359677
1037 Ga0501040_0174975
1038 Ga0501042_0671664
1039 Ga0501046_0356777
1040 Ga0501046_0655891
1041 Ga0501070_0744381
1042 Ga0501071_0114944
1043 Ga0501071_1051986
1044 Ga0501072_0188433
1045 Ga0501074_0681031
1046 Ga0501076_0097731
1047 Ga0501077_0197782
1048 Ga0501079_0452964
1049 Ga0501081_1434613
1050 Ga0501035_0084148
1051 Ga0501035_1248520
1052 Ga0501044_1023006
1053 Ga0501044_1597624
1054 nmdc:mga0yw44_786582_c1
1055 nmdc:mga05p37_1608440_c1
1056 nmdc:mga05p37_472594_c1
1057 nmdc:mga09592_1366463_c1
1058 nmdc:mga09592_561676_c1
1059 nmdc:mga0qj67_1148986_c1
1060 nmdc:mga0qj67_710795_c1
1061 nmdc:mga06r32_161294_c1
1062 nmdc:mga08y16_1036253_c1
1063 nmdc:mga08y16_129051_c1
1064 nmdc:mga08y16_491749_c1
1065 nmdc:mga08y16_53102_c1
1066 nmdc:mga0n895_316515_c1
1067 nmdc:mga0n895_718140_c1
1068 nmdc:mga0rr50_97544_c1
1069 nmdc:mga08x19_314722_c1
1070 nmdc:mga0a205_61821_c1
1071 Ga0495655_0072989
1072 Ga0466962_0013262
1073 Ga0466962_0084447
1074 Ga0530510_0606042

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04456

DUF503

Protein of unknown function (DUF503)

7

96

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j27-assembly1.cif.gz_A crystal structure of a hypothetical protein, tt1725, from thermus thermophilus hb8 at 1.7a resolution 0.835 3 96
1j27-assembly1.cif.gz_A crystal structure of a hypothetical protein, tt1725, from thermus thermophilus hb8 at 1.7a resolution 0.7965 3 96
3zzp-assembly1.cif.gz_A circular permutant of ribosomal protein s6, lacking edge strand beta- 2 of wild-type s6. 0.7806 8 82
4ffm-assembly1.cif.gz_A pylc in complex with l-lysine-ne-d-ornithine (cocrystallized with l-lysine-ne-d-ornithine) 0.7696 40 85
3ofh-assembly3.cif.gz_A structured domain of mus musculus mesd 0.7281 8 91
ID Description Score Start End Superfamily
af_O33252_1_96_3.30.70.1120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.8763 5 95 3.30.70.1120
1j27A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.835 3 96 3.30.70.1120
af_O33252_1_96_3.30.70.1120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.8266 5 95 3.30.70.1120
1j27A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.7965 3 96 3.30.70.1120
3zzpA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.7806 8 82 3.30.70.60
ID Description Score Start End GO Terms
AF-A0A538KS81-F1-model_v4 DUF503 domain-containing protein 0.9722 1 101
AF-A0A7W0S0T7-F1-model_v4 DUF503 domain-containing protein 0.957 10 102
AF-A0A538KS81-F1-model_v4 DUF503 domain-containing protein 0.9537 1 101
AF-A0A7V9ATJ6-F1-model_v4 DUF503 domain-containing protein 0.9513 3 100
AF-A0A7V8ZDT7-F1-model_v4 DUF503 domain-containing protein 0.9464 4 101

Map