F460884

General Info

Members Datasets Scaffolds Average Seq Length
537 254 1074 226

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100875571|Ga0070713_1008755711
Length 241
Sequence MNGISNTSAGKRTALSCAHAKRLFSPYLDGAVTGTEMLALQNHLTGCPACHREYQALRKTQQLLANMERPKVPEDLGLKLRLAISKETAQAKRGRIEGLKVRWENALEAFMVPVTAGFLSAVIIFGIAMVYFVAPSSLRADNDVPLVMVNTAPEMQPRAFGVDMDTIGDDSLVIEAYVDANGRVQDYRVLSDPEGTKTLPPQVKSMLLDFMTFTTYRPALSMGRPTPSRAVLSFSKISVKG

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
119 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
120 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
182 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
189 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
190 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
191 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
192 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
193 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
200 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
201 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
213 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.53
Metatranscriptomes 4.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.52
Rhizosphere 92.92
Stem 0
Stem Tuber 0
Unclassified 26.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100875571 3300005436 Unclassified 863
2 MRS1b_contig_2669078 2162886011 Unclassified 2215
3 LJNas_1000028 3300000546 Bacteria 19069
4 JGI24737J22298_10023401 3300001990 Bacteria 1960
5 JGI24743J22301_10001987 3300001991 Bacteria 2987
6 JGI24034J26672_10002974 3300002239 Bacteria 2348
7 JGI24751J29686_10014995 3300002459 Bacteria 1599
8 Ga0058859_11520571 3300004798 Bacteria 1493
9 Ga0058863_11681701 3300004799 Bacteria 1329
10 Ga0058860_11068249 3300004801 Bacteria 1506
11 Ga0058860_12237429 3300004801 Bacteria 1514
12 Ga0065712_10199638 3300005290 Unclassified 1114
13 Ga0065715_10093888 3300005293 Bacteria 4512
14 Ga0065715_10111624 3300005293 Unclassified 2562
15 Ga0070658_10136502 3300005327 Bacteria 2047
16 Ga0070676_10012164 3300005328 Bacteria 4693
17 Ga0070683_100011141 3300005329 Bacteria 7756
18 Ga0070683_100155227 3300005329 Bacteria 2171
19 Ga0070683_100285991 3300005329 Bacteria 1568
20 Ga0070690_100024230 3300005330 Unclassified 3730
21 Ga0070690_100031876 3300005330 Bacteria 3287
22 Ga0070670_100323973 3300005331 Bacteria 1350
23 Ga0070677_10008407 3300005333 Bacteria 3471
24 Ga0068869_100001137 3300005334 Bacteria 15535
25 Ga0068869_100121555 3300005334 Unclassified 1998
26 Ga0068869_100291702 3300005334 Unclassified 1314
27 Ga0070666_10010738 3300005335 Bacteria 5730
28 Ga0070680_100111993 3300005336 Unclassified 2272
29 Ga0070682_100044628 3300005337 Bacteria 2745
30 Ga0070682_100054146 3300005337 Bacteria 2516
31 Ga0068868_100013976 3300005338 Bacteria 5906
32 Ga0068868_100033448 3300005338 Bacteria 3963
33 Ga0070660_100010070 3300005339 Bacteria 6669
34 Ga0070689_100021484 3300005340 Bacteria 4806
35 Ga0070691_10031171 3300005341 Bacteria 2500
36 Ga0070687_100002224 3300005343 Bacteria 7192
37 Ga0070661_100001728 3300005344 Bacteria 15146
38 Ga0070661_100015582 3300005344 Bacteria 5365
39 Ga0070668_100665947 3300005347 Unclassified 915
40 Ga0070675_100012717 3300005354 Bacteria 6601
41 Ga0070675_100589875 3300005354 Unclassified 1007
42 Ga0070671_100152578 3300005355 Unclassified 1951
43 Ga0070674_100052165 3300005356 Bacteria 2820
44 Ga0070673_100020198 3300005364 Bacteria 4800
45 Ga0070688_100002034 3300005365 Bacteria 10198
46 Ga0070688_100045546 3300005365 Bacteria 2711
47 Ga0070659_100015036 3300005366 Bacteria 5790
48 Ga0070659_100068860 3300005366 Bacteria 2808
49 Ga0070667_100343407 3300005367 Bacteria 1350
50 Ga0070709_10003764 3300005434 Bacteria 8157
51 Ga0070709_10010211 3300005434 Bacteria 5192
52 Ga0070709_10186327 3300005434 Bacteria 1461
53 Ga0070709_10657103 3300005434 Bacteria 812
54 Ga0070714_100002460 3300005435 Bacteria 13671
55 Ga0070714_100207022 3300005435 Unclassified 1797
56 Ga0070714_100220310 3300005435 Bacteria 1743
57 Ga0070713_100000081 3300005436 Bacteria 59994
58 Ga0070713_100003791 3300005436 Bacteria 10001
59 Ga0070713_100013094 3300005436 Bacteria 6113
60 Ga0070713_100022940 3300005436 Unclassified 4832
61 Ga0070713_100086166 3300005436 Bacteria 2693
62 Ga0070713_100093802 3300005436 Unclassified 2587
63 Ga0070713_100242924 3300005436 Bacteria 1640
64 Ga0070713_100268627 3300005436 Bacteria 1561
65 Ga0070713_100381137 3300005436 Bacteria 1314
66 Ga0070713_100423192 3300005436 Bacteria 1247
67 Ga0070710_10119850 3300005437 Unclassified 1591
68 Ga0070710_10251515 3300005437 Bacteria 1136
69 Ga0070711_100000264 3300005439 Bacteria 26931
70 Ga0070711_100000388 3300005439 Bacteria 22701
71 Ga0070711_100002518 3300005439 Bacteria 10471
72 Ga0070711_100190643 3300005439 Unclassified 1575
73 Ga0070711_100265150 3300005439 Bacteria 1353
74 Ga0070694_100386285 3300005444 Bacteria 1093
75 Ga0070708_100000066 3300005445 Bacteria 68732
76 Ga0070708_100004898 3300005445 Bacteria 10574
77 Ga0070708_100032381 3300005445 Bacteria 4535
78 Ga0070663_100019165 3300005455 Bacteria 4503
79 Ga0070678_100030482 3300005456 Bacteria 3708
80 Ga0070678_100175461 3300005456 Bacteria 1749
81 Ga0070662_100001400 3300005457 Bacteria 14862
82 Ga0070681_10141604 3300005458 Bacteria 2334
83 Ga0070681_10709911 3300005458 Unclassified 921
84 Ga0068867_100015520 3300005459 Bacteria 5403
85 Ga0070706_100000872 3300005467 Bacteria 33128
86 Ga0070706_100004368 3300005467 Bacteria 13656
87 Ga0070706_100006218 3300005467 Bacteria 11290
88 Ga0070706_100341701 3300005467 Bacteria 1396
89 Ga0070707_100002946 3300005468 Bacteria 16161
90 Ga0070707_100074653 3300005468 Unclassified 3270
91 Ga0070707_100243285 3300005468 Unclassified 1751
92 Ga0070698_100000007 3300005471 Bacteria 123996
93 Ga0070698_100132136 3300005471 Unclassified 2451
94 Ga0070698_100434296 3300005471 Unclassified 1248
95 Ga0070699_100000107 3300005518 Bacteria 78143
96 Ga0070699_100023930 3300005518 Bacteria 5265
97 Ga0070699_100299653 3300005518 Bacteria 1442
98 Ga0070679_100072777 3300005530 Bacteria 3429
99 Ga0070679_100586647 3300005530 Unclassified 1058
100 Ga0070684_100002213 3300005535 Bacteria 14359
101 Ga0070684_100047609 3300005535 Unclassified 3715
102 Ga0070697_100000224 3300005536 Bacteria 46645
103 Ga0070697_100002677 3300005536 Bacteria 13706
104 Ga0070697_100030552 3300005536 Bacteria 4328
105 Ga0070697_100040151 3300005536 Bacteria 3785
106 Ga0070697_100054027 3300005536 Bacteria 3265
107 Ga0068853_100024279 3300005539 Bacteria 5081
108 Ga0068853_100127115 3300005539 Bacteria 2278
109 Ga0068853_100148525 3300005539 Bacteria 2108
110 Ga0068853_100394067 3300005539 Bacteria 1295
111 Ga0070672_100046577 3300005543 Bacteria 3360
112 Ga0070686_100019600 3300005544 Unclassified 3989
113 Ga0070686_100048268 3300005544 Bacteria 2696
114 Ga0070686_100084066 3300005544 Bacteria 2114
115 Ga0070696_100200889 3300005546 Bacteria 1488
116 Ga0070693_100335350 3300005547 Bacteria 1030
117 Ga0070693_100426472 3300005547 Bacteria 925
118 Ga0070665_100007604 3300005548 Bacteria 11017
119 Ga0070704_100144163 3300005549 Unclassified 1864
120 Ga0068855_100017124 3300005563 Bacteria 8718
121 Ga0068855_100173266 3300005563 Bacteria 2443
122 Ga0068855_100186534 3300005563 Bacteria 2342
123 Ga0070664_100026660 3300005564 Bacteria 4796
124 Ga0070664_100033212 3300005564 Unclassified 4320
125 Ga0068857_100001081 3300005577 Bacteria 21107
126 Ga0068857_100939239 3300005577 Unclassified 831
127 Ga0068854_100023975 3300005578 Bacteria 4172
128 Ga0068856_100010974 3300005614 Bacteria 8795
129 Ga0068856_100146192 3300005614 Bacteria 2372
130 Ga0068856_100519967 3300005614 Bacteria 1211
131 Ga0070702_100076336 3300005615 Bacteria 1994
132 Ga0068852_100004247 3300005616 Bacteria 10116
133 Ga0068852_100016262 3300005616 Bacteria 5796
134 Ga0068852_100336919 3300005616 Bacteria 1469
135 Ga0068859_100025608 3300005617 Bacteria 5917
136 Ga0068859_100300903 3300005617 Bacteria 1697
137 Ga0068859_100313130 3300005617 Bacteria 1663
138 Ga0068864_100033122 3300005618 Bacteria 4392
139 Ga0068866_10001556 3300005718 Bacteria 9750
140 Ga0068861_100022166 3300005719 Bacteria 4572
141 Ga0068851_10005264 3300005834 Bacteria 5871
142 Ga0068851_10099901 3300005834 Bacteria 1538
143 Ga0068870_10004388 3300005840 Bacteria 6079
144 Ga0068863_100085012 3300005841 Bacteria 2998
145 Ga0068863_100090331 3300005841 Bacteria 2904
146 Ga0068863_100090656 3300005841 Bacteria 2899
147 Ga0068858_100000401 3300005842 Bacteria 45107
148 Ga0068858_100045115 3300005842 Bacteria 4084
149 Ga0068858_100065667 3300005842 Bacteria 3358
150 Ga0068858_100366718 3300005842 Bacteria 1381
151 Ga0068860_100019109 3300005843 Bacteria 6653
152 Ga0068860_100037920 3300005843 Bacteria 4612
153 Ga0068860_100066740 3300005843 Bacteria 3418
154 Ga0068860_100168426 3300005843 Bacteria 2115
155 Ga0068860_100178585 3300005843 Bacteria 2052
156 Ga0068862_100049106 3300005844 Bacteria 3604
157 Ga0068862_100074880 3300005844 Bacteria 2927
158 Ga0068862_100088013 3300005844 Bacteria 2701
159 Ga0070717_10003226 3300006028 Bacteria 11647
160 Ga0070717_10026573 3300006028 Unclassified 4618
161 Ga0070717_10032098 3300006028 Unclassified 4229
162 Ga0070717_10052723 3300006028 Bacteria 3352
163 Ga0070717_10132563 3300006028 Bacteria 2144
164 Ga0070717_10408839 3300006028 Bacteria 1220
165 Ga0070717_10611897 3300006028 Bacteria 988
166 Ga0070715_10007050 3300006163 Bacteria 3851
167 Ga0070715_10009887 3300006163 Bacteria 3380
168 Ga0070715_10081172 3300006163 Bacteria 1472
169 Ga0070716_100017056 3300006173 Bacteria 3758
170 Ga0070716_100058758 3300006173 Unclassified 2214
171 Ga0070716_100061571 3300006173 Bacteria 2173
172 Ga0070716_100120724 3300006173 Unclassified 1640
173 Ga0070716_100577194 3300006173 Unclassified 842
174 Ga0070712_100000146 3300006175 Bacteria 37131
175 Ga0070712_100000715 3300006175 Bacteria 19531
176 Ga0070712_100004259 3300006175 Bacteria 8807
177 Ga0070712_100011206 3300006175 Bacteria 5678
178 Ga0070712_100404369 3300006175 Unclassified 1128
179 Ga0097621_100015765 3300006237 Bacteria 5696
180 Ga0097621_100023961 3300006237 Bacteria 4759
181 Ga0097621_100363809 3300006237 Bacteria 1289
182 Ga0097621_100973660 3300006237 Unclassified 793
183 Ga0068871_100273003 3300006358 Bacteria 1477
184 Ga0075434_100273570 3300006871 Bacteria 1708
185 Ga0075434_100648354 3300006871 Bacteria 1074
186 Ga0068865_100024767 3300006881 Bacteria 3941
187 Ga0068865_100026313 3300006881 Bacteria 3834
188 Ga0068865_100111284 3300006881 Unclassified 2021
189 Ga0097620_100025607 3300006931 Bacteria 5917
190 Ga0097620_100300884 3300006931 Bacteria 1697
191 Ga0097620_100313129 3300006931 Bacteria 1663
192 Ga0099795_10014246 3300007788 Bacteria 2460
193 Ga0105250_10007475 3300009092 Bacteria 4690
194 Ga0105250_10080014 3300009092 Unclassified 1324
195 Ga0105240_10042810 3300009093 Bacteria 5768
196 Ga0105240_10069754 3300009093 Bacteria 4350
197 Ga0105245_10001231 3300009098 Bacteria 23089
198 Ga0105245_10008216 3300009098 Bacteria 9125
199 Ga0105245_10034362 3300009098 Bacteria 4497
200 Ga0105245_10118893 3300009098 Bacteria 2466
201 Ga0105245_10384391 3300009098 Bacteria 1399
202 Ga0105245_10606819 3300009098 Unclassified 1121
203 Ga0105247_10001952 3300009101 Bacteria 14337
204 Ga0105247_10014383 3300009101 Bacteria 4748
205 Ga0105247_10017412 3300009101 Unclassified 4314
206 Ga0105247_10414534 3300009101 Unclassified 963
207 Ga0105243_10012089 3300009148 Bacteria 6525
208 Ga0105243_10324594 3300009148 Bacteria 1404
209 Ga0105241_10003970 3300009174 Bacteria 10939
210 Ga0105241_10025345 3300009174 Unclassified 4406
211 Ga0105241_10508858 3300009174 Bacteria 1075
212 Ga0105248_10006594 3300009177 Bacteria 12724
213 Ga0105248_10067418 3300009177 Bacteria 4018
214 Ga0105237_10045171 3300009545 Unclassified 4434
215 Ga0105237_10048098 3300009545 Unclassified 4287
216 Ga0105237_10115385 3300009545 Bacteria 2679
217 Ga0105238_10046339 3300009551 Unclassified 4388
218 Ga0105238_10881061 3300009551 Unclassified 913
219 Ga0105249_10045278 3300009553 Bacteria 4002
220 Ga0099796_10014512 3300010159 Bacteria 2278
221 Ga0099796_10067317 3300010159 Bacteria 1284
222 Ga0099796_10229962 3300010159 Bacteria 763
223 Ga0105239_10052031 3300010375 Bacteria 4490
224 Ga0105239_10074846 3300010375 Bacteria 3723
225 Ga0105239_10847578 3300010375 Unclassified 1048
226 Ga0105246_10000186 3300011119 Bacteria 30726
227 Ga0157373_10002646 3300013100 Bacteria 13585
228 Ga0157371_10019046 3300013102 Bacteria 5067
229 Ga0157370_10160919 3300013104 Bacteria 2089
230 Ga0157369_10088517 3300013105 Bacteria 3305
231 Ga0157369_10130591 3300013105 Bacteria 2662
232 Ga0157374_10003942 3300013296 Bacteria 12472
233 Ga0157374_10005839 3300013296 Bacteria 10398
234 Ga0157374_10072041 3300013296 Bacteria 3259
235 Ga0157374_10250960 3300013296 Bacteria 1741
236 Ga0157374_10289467 3300013296 Bacteria 1618
237 Ga0157374_10498410 3300013296 Bacteria 1222
238 Ga0157374_10598775 3300013296 Bacteria 1112
239 Ga0157374_10669482 3300013296 Unclassified 1050
240 Ga0157378_10011294 3300013297 Bacteria 7817
241 Ga0157378_10150774 3300013297 Bacteria 2166
242 Ga0163162_10002057 3300013306 Bacteria 18904
243 Ga0163162_10010985 3300013306 Bacteria 8819
244 Ga0163162_10011372 3300013306 Bacteria 8678
245 Ga0163162_10056021 3300013306 Bacteria 3971
246 Ga0157372_10017827 3300013307 Bacteria 7625
247 Ga0157372_10068454 3300013307 Bacteria 3991
248 Ga0157372_10470865 3300013307 Bacteria 1464
249 Ga0157372_10520630 3300013307 Bacteria 1386
250 Ga0157375_10058154 3300013308 Bacteria 3824
251 Ga0157375_10126557 3300013308 Unclassified 2670
252 Ga0157375_10434750 3300013308 Bacteria 1478
253 Ga0163163_10030874 3300014325 Bacteria 5166
254 Ga0163163_10037447 3300014325 Unclassified 4719
255 Ga0163163_10090346 3300014325 Unclassified 3075
256 Ga0157380_10379194 3300014326 Unclassified 1334
257 Ga0182008_10003445 3300014497 Bacteria 9548
258 Ga0157379_10000116 3300014968 Bacteria 55439
259 Ga0157379_10032197 3300014968 Unclassified 4673
260 Ga0157379_10052951 3300014968 Bacteria 3625
261 Ga0157379_10061763 3300014968 Bacteria 3351
262 Ga0157379_10138647 3300014968 Bacteria 2192
263 Ga0157376_10010652 3300014969 Bacteria 6737
264 Ga0157376_10021466 3300014969 Bacteria 5015
265 Ga0163161_10002321 3300017792 Bacteria 13637
266 Ga0224712_10043699 3300022467 Unclassified 1705
267 Ga0224569_101277 3300022732 Bacteria 2126
268 Ga0224569_102548 3300022732 Unclassified 1472
269 Ga0224572_1005060 3300024225 Bacteria 2335
270 Ga0228598_1005344 3300024227 Bacteria 2685
271 Ga0228598_1007605 3300024227 Unclassified 2202
272 Ga0228598_1013016 3300024227 Bacteria 1648
273 Ga0207697_10016490 3300025315 Bacteria 3043
274 Ga0207682_10002656 3300025893 Bacteria 7962
275 Ga0207692_10000164 3300025898 Bacteria 21214
276 Ga0207692_10017384 3300025898 Bacteria 3207
277 Ga0207642_10013026 3300025899 Bacteria 3021
278 Ga0207710_10023657 3300025900 Bacteria 2641
279 Ga0207688_10002744 3300025901 Bacteria 9533
280 Ga0207680_10134927 3300025903 Bacteria 1630
281 Ga0207647_10005997 3300025904 Bacteria 8853
282 Ga0207647_10112942 3300025904 Unclassified 1605
283 Ga0207685_10026587 3300025905 Bacteria 2015
284 Ga0207685_10047060 3300025905 Bacteria 1644
285 Ga0207699_10029046 3300025906 Bacteria 3080
286 Ga0207699_10047349 3300025906 Bacteria 2521
287 Ga0207699_10134185 3300025906 Bacteria 1619
288 Ga0207699_10485925 3300025906 Unclassified 890
289 Ga0207645_10000104 3300025907 Bacteria 62309
290 Ga0207645_10019986 3300025907 Bacteria 4384
291 Ga0207643_10000528 3300025908 Bacteria 24521
292 Ga0207643_10219315 3300025908 Bacteria 1163
293 Ga0207684_10000301 3300025910 Bacteria 70279
294 Ga0207684_10001972 3300025910 Bacteria 21201
295 Ga0207684_10006240 3300025910 Bacteria 10884
296 Ga0207684_10229723 3300025910 Bacteria 1601
297 Ga0207654_10013523 3300025911 Bacteria 4200
298 Ga0207654_10037163 3300025911 Bacteria 2724
299 Ga0207707_10297920 3300025912 Unclassified 1395
300 Ga0207695_10039032 3300025913 Bacteria 5106
301 Ga0207671_10048089 3300025914 Unclassified 3157
302 Ga0207671_10241511 3300025914 Bacteria 1419
303 Ga0207693_10000006 3300025915 Bacteria 185928
304 Ga0207693_10000410 3300025915 Bacteria 38960
305 Ga0207693_10000708 3300025915 Bacteria 29996
306 Ga0207693_10009836 3300025915 Bacteria 7779
307 Ga0207693_10182773 3300025915 Unclassified 1650
308 Ga0207663_10000200 3300025916 Bacteria 26716
309 Ga0207663_10001066 3300025916 Bacteria 12569
310 Ga0207663_10005030 3300025916 Bacteria 6637
311 Ga0207660_10124823 3300025917 Unclassified 1954
312 Ga0207657_10002497 3300025919 Bacteria 19885
313 Ga0207657_10003637 3300025919 Bacteria 16413
314 Ga0207649_10000149 3300025920 Bacteria 57837
315 Ga0207649_10012822 3300025920 Bacteria 4664
316 Ga0207652_10113597 3300025921 Bacteria 2404
317 Ga0207646_10000433 3300025922 Bacteria 55881
318 Ga0207646_10022089 3300025922 Bacteria 5869
319 Ga0207646_10064494 3300025922 Unclassified 3270
320 Ga0207646_10273929 3300025922 Unclassified 1525
321 Ga0207681_10008490 3300025923 Bacteria 6277
322 Ga0207681_10197098 3300025923 Bacteria 1544
323 Ga0207650_10000170 3300025925 Bacteria 77357
324 Ga0207687_10047046 3300025927 Unclassified 2989
325 Ga0207687_10048221 3300025927 Bacteria 2956
326 Ga0207687_10278326 3300025927 Bacteria 1340
327 Ga0207687_10329823 3300025927 Unclassified 1238
328 Ga0207700_10000204 3300025928 Bacteria 35649
329 Ga0207700_10005400 3300025928 Bacteria 7637
330 Ga0207700_10114967 3300025928 Bacteria 2172
331 Ga0207700_10193169 3300025928 Unclassified 1712
332 Ga0207700_10200083 3300025928 Bacteria 1683
333 Ga0207700_10234747 3300025928 Unclassified 1561
334 Ga0207700_10425350 3300025928 Bacteria 1167
335 Ga0207664_10000520 3300025929 Bacteria 27368
336 Ga0207664_10283132 3300025929 Unclassified 1455
337 Ga0207644_10036267 3300025931 Bacteria 3460
338 Ga0207690_10056758 3300025932 Bacteria 2643
339 Ga0207690_10436434 3300025932 Unclassified 1050
340 Ga0207706_10002556 3300025933 Bacteria 17739
341 Ga0207686_10010863 3300025934 Unclassified 4966
342 Ga0207686_10081539 3300025934 Unclassified 2112
343 Ga0207670_10437617 3300025936 Unclassified 1052
344 Ga0207704_10015740 3300025938 Bacteria 3864
345 Ga0207665_10004043 3300025939 Bacteria 9787
346 Ga0207665_10009824 3300025939 Bacteria 6283
347 Ga0207665_10015344 3300025939 Bacteria 5030
348 Ga0207665_10015556 3300025939 Bacteria 4991
349 Ga0207665_10148869 3300025939 Unclassified 1675
350 Ga0207691_10000417 3300025940 Bacteria 42618
351 Ga0207711_10001310 3300025941 Bacteria 23544
352 Ga0207711_10013355 3300025941 Bacteria 6822
353 Ga0207689_10001387 3300025942 Bacteria 23193
354 Ga0207689_10001631 3300025942 Bacteria 21254
355 Ga0207689_10010347 3300025942 Bacteria 8038
356 Ga0207689_10174409 3300025942 Bacteria 1773
357 Ga0207661_10001132 3300025944 Bacteria 17770
358 Ga0207661_10280329 3300025944 Unclassified 1489
359 Ga0207679_10000080 3300025945 Bacteria 84997
360 Ga0207679_10140538 3300025945 Unclassified 1951
361 Ga0207679_10743190 3300025945 Unclassified 892
362 Ga0207667_10011210 3300025949 Bacteria 10431
363 Ga0207667_10185280 3300025949 Bacteria 2137
364 Ga0207667_10780322 3300025949 Bacteria 953
365 Ga0207651_10015654 3300025960 Bacteria 4415
366 Ga0207668_10068055 3300025972 Unclassified 2530
367 Ga0207668_10224175 3300025972 Bacteria 1511
368 Ga0207640_10422602 3300025981 Unclassified 1091
369 Ga0207658_10006996 3300025986 Bacteria 7679
370 Ga0207658_10335233 3300025986 Unclassified 1313
371 Ga0207677_10009845 3300026023 Bacteria 5388
372 Ga0207677_10067414 3300026023 Bacteria 2507
373 Ga0207703_10007000 3300026035 Bacteria 8974
374 Ga0207703_10027983 3300026035 Bacteria 4439
375 Ga0207639_10072320 3300026041 Unclassified 2700
376 Ga0207639_10130634 3300026041 Bacteria 2078
377 Ga0207639_10215957 3300026041 Bacteria 1654
378 Ga0207678_10000165 3300026067 Bacteria 55812
379 Ga0207678_10000912 3300026067 Bacteria 27031
380 Ga0207678_10327813 3300026067 Bacteria 1318
381 Ga0207702_10007464 3300026078 Bacteria 9326
382 Ga0207702_10078846 3300026078 Bacteria 2853
383 Ga0207702_10086480 3300026078 Unclassified 2734
384 Ga0207702_10180530 3300026078 Bacteria 1943
385 Ga0207641_10001162 3300026088 Bacteria 26474
386 Ga0207641_10012624 3300026088 Bacteria 6928
387 Ga0207641_10063533 3300026088 Bacteria 3154
388 Ga0207641_10691008 3300026088 Bacteria 1004
389 Ga0207648_10001369 3300026089 Bacteria 26899
390 Ga0207648_10027616 3300026089 Bacteria 5038
391 Ga0207648_10033000 3300026089 Unclassified 4568
392 Ga0207676_10000478 3300026095 Bacteria 33685
393 Ga0207676_10073975 3300026095 Unclassified 2744
394 Ga0207674_10001664 3300026116 Bacteria 28591
395 Ga0207674_10010928 3300026116 Bacteria 10217
396 Ga0207674_10314804 3300026116 Unclassified 1514
397 Ga0207683_10001974 3300026121 Bacteria 18146
398 Ga0207683_10022356 3300026121 Bacteria 5428
399 Ga0265356_1000037 3300028017 Bacteria 21386
400 Ga0268266_10005015 3300028379 Bacteria 12502
401 Ga0268266_10460363 3300028379 Bacteria 1210
402 Ga0268266_10729112 3300028379 Unclassified 956
403 Ga0268265_10010526 3300028380 Bacteria 6244
404 Ga0268265_10206491 3300028380 Bacteria 1708
405 Ga0268265_10281004 3300028380 Unclassified 1489
406 Ga0268264_10020356 3300028381 Bacteria 5422
407 Ga0268264_10127717 3300028381 Unclassified 2249
408 Ga0268264_10330331 3300028381 Unclassified 1445
409 Ga0265338_10029186 3300028800 Bacteria 5476
410 Ga0265338_10121834 3300028800 Unclassified 2077
411 Ga0265338_10126489 3300028800 Bacteria 2026
412 Ga0265762_1000244 3300030760 Bacteria 8876
413 Ga0265762_1004381 3300030760 Bacteria 2529
414 Ga0265762_1006039 3300030760 Bacteria 2171
415 Ga0265762_1007229 3300030760 Bacteria 1978
416 Ga0265762_1017043 3300030760 Bacteria 1320
417 Ga0265761_100347 3300030889 Unclassified 1720
418 Ga0265760_10000254 3300031090 Bacteria 14718
419 Ga0265760_10003409 3300031090 Unclassified 4621
420 Ga0265760_10010559 3300031090 Bacteria 2638
421 Ga0265760_10012338 3300031090 Unclassified 2442
422 Ga0265325_10019651 3300031241 Unclassified 3731
423 Ga0265339_10098410 3300031249 Unclassified 1526
424 Ga0265316_10155358 3300031344 Bacteria 1712
425 Ga0265314_10067264 3300031711 Bacteria 2414
426 Ga0373926_0009110 3300035083 Unclassified 3313
427 Ga0373929_0035852 3300035085 Bacteria 1082
428 Ga0373934_0025394 3300035086 Unclassified 2294
429 Ga0373951_0097414 3300035091 Unclassified 778
430 Ga0373923_0012991 3300035111 Unclassified 3093
431 Ga0373936_0019409 3300035113 Unclassified 2634
432 Ga0373936_0040209 3300035113 Unclassified 1873
433 Ga0373936_0237674 3300035113 Unclassified 811
434 Ga0373954_0034885 3300035118 Unclassified 2331
435 Ga0373943_0000776 3300035170 Bacteria 13955
436 Ga0373943_0132604 3300035170 Bacteria 1334
437 Ga0373946_0002707 3300035171 Bacteria 6269
438 Ga0373946_0023403 3300035171 Bacteria 2413
439 Ga0373955_0017068 3300035172 Unclassified 3584
440 Ga0373955_0191563 3300035172 Bacteria 1216
441 Ga0373961_0073801 3300035241 Bacteria 1060
442 Ga0373962_0019241 3300035242 Bacteria 1785
443 Ga0373924_0036147 3300035410 Bacteria 2006
444 Ga0373935_0030607 3300035692 Unclassified 3336
445 Ga0373935_0079681 3300035692 Unclassified 2126
446 Ga0373935_0358785 3300035692 Unclassified 1040
447 Ga0373927_0001505 3300035695 Bacteria 17538
448 Ga0373933_0046783 3300035724 Unclassified 2570
449 Ga0373933_0223860 3300035724 Unclassified 1207
450 Ga0373947_0000069 3300035725 Bacteria 51990
451 Ga0373947_0015734 3300035725 Bacteria 4346
452 Ga0373947_0257943 3300035725 Bacteria 1155
453 Ga0373937_0056540 3300036401 Bacteria 3603
454 Ga0373937_0119761 3300036401 Unclassified 2453
455 Ga0373937_0138501 3300036401 Unclassified 2276
456 Ga0373937_0294977 3300036401 Bacteria 1532
457 Ga0265778_017376 3300036457 Unclassified 868
458 Ga0373925_0007295 3300037068 Bacteria 8077
459 Ga0373925_0029120 3300037068 Bacteria 4051
460 Ga0373925_0449077 3300037068 Bacteria 1055
461 Ga0373925_0664884 3300037068 Unclassified 859
462 Ga0436360_0703705 3300039438 Bacteria 4232
463 Ga0466967_0010653 3300045976 Bacteria 6912
464 Ga0495629_0043947 3300046459 Bacteria 3137
465 Ga0495580_0000521 3300046472 Bacteria 32419
466 Ga0495580_0005133 3300046472 Bacteria 10893
467 Ga0495580_0058213 3300046472 Bacteria 2718
468 Ga0495580_0089439 3300046472 Unclassified 2144
469 Ga0495580_0151090 3300046472 Bacteria 1609
470 Ga0495582_0004106 3300046473 Bacteria 8183
471 Ga0495594_0330659 3300046499 Bacteria 868
472 Ga0495630_0033835 3300046517 Bacteria 3812
473 Ga0495630_0062724 3300046517 Unclassified 2792
474 Ga0495630_0488766 3300046517 Unclassified 944
475 Ga0495640_0403770 3300046533 Unclassified 839
476 Ga0495599_0143771 3300046678 Unclassified 1479
477 Ga0495623_0121420 3300046679 Unclassified 1573
478 Ga0495658_0082296 3300046683 Bacteria 1891
479 Ga0495669_0035810 3300046684 Bacteria 2192
480 Ga0495669_0046419 3300046684 Unclassified 1939
481 Ga0495674_0022561 3300047319 Bacteria 5804
482 Ga0495674_0416778 3300047319 Bacteria 1082
483 Ga0495676_0432194 3300047321 Unclassified 870
484 Ga0495675_0336813 3300047444 Unclassified 890
485 Ga0495684_0074702 3300047471 Unclassified 2576
486 Ga0495593_0274515 3300047673 Bacteria 843
487 Ga0495602_0157751 3300048088 Unclassified 1775
488 Ga0496101_0000982 3300048904 Bacteria 16857
489 Ga0496101_0021688 3300048904 Unclassified 4415
490 Ga0496101_0375442 3300048904 Bacteria 1118
491 Ga0496102_0000464 3300048905 Bacteria 45016
492 Ga0496102_0263687 3300048905 Unclassified 1624
493 Ga0496102_0295219 3300048905 Bacteria 1527
494 Ga0496102_0500912 3300048905 Unclassified 1137
495 Ga0496103_0024668 3300048906 Bacteria 3629
496 Ga0496103_0546948 3300048906 Unclassified 739
497 Ga0496104_0044910 3300048907 Bacteria 4153
498 Ga0496104_0080388 3300048907 Bacteria 3108
499 Ga0496104_0233270 3300048907 Bacteria 1752
500 Ga0496104_0473928 3300048907 Unclassified 1163
501 Ga0496105_0118085 3300048908 Bacteria 2188
502 Ga0496105_0300309 3300048908 Unclassified 1291
503 Ga0496105_0313684 3300048908 Unclassified 1258
504 Ga0496106_0439411 3300048909 Unclassified 1048
505 Ga0496107_0080189 3300048910 Bacteria 2380
506 Ga0496107_0119340 3300048910 Bacteria 1942
507 Ga0496108_0000228 3300048911 Bacteria 50279
508 Ga0496109_0000184 3300048912 Bacteria 62326
509 Ga0496109_0044617 3300048912 Unclassified 4022
510 Ga0496109_0133009 3300048912 Bacteria 2323
511 Ga0496110_0004060 3300048913 Bacteria 11297
512 Ga0496110_0145290 3300048913 Unclassified 2145
513 Ga0496111_0013182 3300048914 Bacteria 5621
514 Ga0496111_0103584 3300048914 Bacteria 2093
515 Ga0496112_0000034 3300048915 Bacteria 107237
516 Ga0496112_0051198 3300048915 Unclassified 4050
517 Ga0496112_0087348 3300048915 Bacteria 3085
518 Ga0496113_0000789 3300048916 Bacteria 16423
519 Ga0496113_0697901 3300048916 Unclassified 810
520 Ga0496115_0031525 3300048918 Bacteria 4178
521 Ga0496115_0035504 3300048918 Bacteria 3944
522 Ga0496115_0149105 3300048918 Bacteria 1931
523 Ga0501067_0121944 3300049583 Unclassified 1451
524 nmdc:mga0n895_268729_c1 3300050512 Bacteria 1730
525 nmdc:mga0rr50_474533_c1 3300050513 Unclassified 1062
526 nmdc:mga0a205_946493_c1 3300050515 Bacteria 708
527 Ga0495601_0116134 3300053077 Unclassified 1736
528 Ga0495601_0179349 3300053077 Unclassified 1385
529 Ga0495619_0085630 3300053085 Unclassified 2129
530 Ga0587070_035747 3300059491 Unclassified 926
531 Ga0587073_0004191 3300059492 Bacteria 2049
532 Ga0587086_018925 3300059507 Unclassified 922
533 Ga0587091_006490 3300059511 Unclassified 1645
534 Ga0587067_027651 3300059640 Bacteria 1024
535 Ga0587075_007683 3300059644 Bacteria 1359
536 Ga0587078_016021 3300059646 Bacteria 909
537 Ga0587071_040711 3300060344 Bacteria 930
538 Ga0070713_100875571
539 MRS1b_contig_2669078
540 LJNas_1000028
541 JGI24737J22298_10023401
542 JGI24743J22301_10001987
543 JGI24034J26672_10002974
544 JGI24751J29686_10014995
545 Ga0058859_11520571
546 Ga0058863_11681701
547 Ga0058860_11068249
548 Ga0058860_12237429
549 Ga0065712_10199638
550 Ga0065715_10093888
551 Ga0065715_10111624
552 Ga0070658_10136502
553 Ga0070676_10012164
554 Ga0070683_100011141
555 Ga0070683_100155227
556 Ga0070683_100285991
557 Ga0070690_100024230
558 Ga0070690_100031876
559 Ga0070670_100323973
560 Ga0070677_10008407
561 Ga0068869_100001137
562 Ga0068869_100121555
563 Ga0068869_100291702
564 Ga0070666_10010738
565 Ga0070680_100111993
566 Ga0070682_100044628
567 Ga0070682_100054146
568 Ga0068868_100013976
569 Ga0068868_100033448
570 Ga0070660_100010070
571 Ga0070689_100021484
572 Ga0070691_10031171
573 Ga0070687_100002224
574 Ga0070661_100001728
575 Ga0070661_100015582
576 Ga0070668_100665947
577 Ga0070675_100012717
578 Ga0070675_100589875
579 Ga0070671_100152578
580 Ga0070674_100052165
581 Ga0070673_100020198
582 Ga0070688_100002034
583 Ga0070688_100045546
584 Ga0070659_100015036
585 Ga0070659_100068860
586 Ga0070667_100343407
587 Ga0070709_10003764
588 Ga0070709_10010211
589 Ga0070709_10186327
590 Ga0070709_10657103
591 Ga0070714_100002460
592 Ga0070714_100207022
593 Ga0070714_100220310
594 Ga0070713_100000081
595 Ga0070713_100003791
596 Ga0070713_100013094
597 Ga0070713_100022940
598 Ga0070713_100086166
599 Ga0070713_100093802
600 Ga0070713_100242924
601 Ga0070713_100268627
602 Ga0070713_100381137
603 Ga0070713_100423192
604 Ga0070710_10119850
605 Ga0070710_10251515
606 Ga0070711_100000264
607 Ga0070711_100000388
608 Ga0070711_100002518
609 Ga0070711_100190643
610 Ga0070711_100265150
611 Ga0070694_100386285
612 Ga0070708_100000066
613 Ga0070708_100004898
614 Ga0070708_100032381
615 Ga0070663_100019165
616 Ga0070678_100030482
617 Ga0070678_100175461
618 Ga0070662_100001400
619 Ga0070681_10141604
620 Ga0070681_10709911
621 Ga0068867_100015520
622 Ga0070706_100000872
623 Ga0070706_100004368
624 Ga0070706_100006218
625 Ga0070706_100341701
626 Ga0070707_100002946
627 Ga0070707_100074653
628 Ga0070707_100243285
629 Ga0070698_100000007
630 Ga0070698_100132136
631 Ga0070698_100434296
632 Ga0070699_100000107
633 Ga0070699_100023930
634 Ga0070699_100299653
635 Ga0070679_100072777
636 Ga0070679_100586647
637 Ga0070684_100002213
638 Ga0070684_100047609
639 Ga0070697_100000224
640 Ga0070697_100002677
641 Ga0070697_100030552
642 Ga0070697_100040151
643 Ga0070697_100054027
644 Ga0068853_100024279
645 Ga0068853_100127115
646 Ga0068853_100148525
647 Ga0068853_100394067
648 Ga0070672_100046577
649 Ga0070686_100019600
650 Ga0070686_100048268
651 Ga0070686_100084066
652 Ga0070696_100200889
653 Ga0070693_100335350
654 Ga0070693_100426472
655 Ga0070665_100007604
656 Ga0070704_100144163
657 Ga0068855_100017124
658 Ga0068855_100173266
659 Ga0068855_100186534
660 Ga0070664_100026660
661 Ga0070664_100033212
662 Ga0068857_100001081
663 Ga0068857_100939239
664 Ga0068854_100023975
665 Ga0068856_100010974
666 Ga0068856_100146192
667 Ga0068856_100519967
668 Ga0070702_100076336
669 Ga0068852_100004247
670 Ga0068852_100016262
671 Ga0068852_100336919
672 Ga0068859_100025608
673 Ga0068859_100300903
674 Ga0068859_100313130
675 Ga0068864_100033122
676 Ga0068866_10001556
677 Ga0068861_100022166
678 Ga0068851_10005264
679 Ga0068851_10099901
680 Ga0068870_10004388
681 Ga0068863_100085012
682 Ga0068863_100090331
683 Ga0068863_100090656
684 Ga0068858_100000401
685 Ga0068858_100045115
686 Ga0068858_100065667
687 Ga0068858_100366718
688 Ga0068860_100019109
689 Ga0068860_100037920
690 Ga0068860_100066740
691 Ga0068860_100168426
692 Ga0068860_100178585
693 Ga0068862_100049106
694 Ga0068862_100074880
695 Ga0068862_100088013
696 Ga0070717_10003226
697 Ga0070717_10026573
698 Ga0070717_10032098
699 Ga0070717_10052723
700 Ga0070717_10132563
701 Ga0070717_10408839
702 Ga0070717_10611897
703 Ga0070715_10007050
704 Ga0070715_10009887
705 Ga0070715_10081172
706 Ga0070716_100017056
707 Ga0070716_100058758
708 Ga0070716_100061571
709 Ga0070716_100120724
710 Ga0070716_100577194
711 Ga0070712_100000146
712 Ga0070712_100000715
713 Ga0070712_100004259
714 Ga0070712_100011206
715 Ga0070712_100404369
716 Ga0097621_100015765
717 Ga0097621_100023961
718 Ga0097621_100363809
719 Ga0097621_100973660
720 Ga0068871_100273003
721 Ga0075434_100273570
722 Ga0075434_100648354
723 Ga0068865_100024767
724 Ga0068865_100026313
725 Ga0068865_100111284
726 Ga0097620_100025607
727 Ga0097620_100300884
728 Ga0097620_100313129
729 Ga0099795_10014246
730 Ga0105250_10007475
731 Ga0105250_10080014
732 Ga0105240_10042810
733 Ga0105240_10069754
734 Ga0105245_10001231
735 Ga0105245_10008216
736 Ga0105245_10034362
737 Ga0105245_10118893
738 Ga0105245_10384391
739 Ga0105245_10606819
740 Ga0105247_10001952
741 Ga0105247_10014383
742 Ga0105247_10017412
743 Ga0105247_10414534
744 Ga0105243_10012089
745 Ga0105243_10324594
746 Ga0105241_10003970
747 Ga0105241_10025345
748 Ga0105241_10508858
749 Ga0105248_10006594
750 Ga0105248_10067418
751 Ga0105237_10045171
752 Ga0105237_10048098
753 Ga0105237_10115385
754 Ga0105238_10046339
755 Ga0105238_10881061
756 Ga0105249_10045278
757 Ga0099796_10014512
758 Ga0099796_10067317
759 Ga0099796_10229962
760 Ga0105239_10052031
761 Ga0105239_10074846
762 Ga0105239_10847578
763 Ga0105246_10000186
764 Ga0157373_10002646
765 Ga0157371_10019046
766 Ga0157370_10160919
767 Ga0157369_10088517
768 Ga0157369_10130591
769 Ga0157374_10003942
770 Ga0157374_10005839
771 Ga0157374_10072041
772 Ga0157374_10250960
773 Ga0157374_10289467
774 Ga0157374_10498410
775 Ga0157374_10598775
776 Ga0157374_10669482
777 Ga0157378_10011294
778 Ga0157378_10150774
779 Ga0163162_10002057
780 Ga0163162_10010985
781 Ga0163162_10011372
782 Ga0163162_10056021
783 Ga0157372_10017827
784 Ga0157372_10068454
785 Ga0157372_10470865
786 Ga0157372_10520630
787 Ga0157375_10058154
788 Ga0157375_10126557
789 Ga0157375_10434750
790 Ga0163163_10030874
791 Ga0163163_10037447
792 Ga0163163_10090346
793 Ga0157380_10379194
794 Ga0182008_10003445
795 Ga0157379_10000116
796 Ga0157379_10032197
797 Ga0157379_10052951
798 Ga0157379_10061763
799 Ga0157379_10138647
800 Ga0157376_10010652
801 Ga0157376_10021466
802 Ga0163161_10002321
803 Ga0224712_10043699
804 Ga0224569_101277
805 Ga0224569_102548
806 Ga0224572_1005060
807 Ga0228598_1005344
808 Ga0228598_1007605
809 Ga0228598_1013016
810 Ga0207697_10016490
811 Ga0207682_10002656
812 Ga0207692_10000164
813 Ga0207692_10017384
814 Ga0207642_10013026
815 Ga0207710_10023657
816 Ga0207688_10002744
817 Ga0207680_10134927
818 Ga0207647_10005997
819 Ga0207647_10112942
820 Ga0207685_10026587
821 Ga0207685_10047060
822 Ga0207699_10029046
823 Ga0207699_10047349
824 Ga0207699_10134185
825 Ga0207699_10485925
826 Ga0207645_10000104
827 Ga0207645_10019986
828 Ga0207643_10000528
829 Ga0207643_10219315
830 Ga0207684_10000301
831 Ga0207684_10001972
832 Ga0207684_10006240
833 Ga0207684_10229723
834 Ga0207654_10013523
835 Ga0207654_10037163
836 Ga0207707_10297920
837 Ga0207695_10039032
838 Ga0207671_10048089
839 Ga0207671_10241511
840 Ga0207693_10000006
841 Ga0207693_10000410
842 Ga0207693_10000708
843 Ga0207693_10009836
844 Ga0207693_10182773
845 Ga0207663_10000200
846 Ga0207663_10001066
847 Ga0207663_10005030
848 Ga0207660_10124823
849 Ga0207657_10002497
850 Ga0207657_10003637
851 Ga0207649_10000149
852 Ga0207649_10012822
853 Ga0207652_10113597
854 Ga0207646_10000433
855 Ga0207646_10022089
856 Ga0207646_10064494
857 Ga0207646_10273929
858 Ga0207681_10008490
859 Ga0207681_10197098
860 Ga0207650_10000170
861 Ga0207687_10047046
862 Ga0207687_10048221
863 Ga0207687_10278326
864 Ga0207687_10329823
865 Ga0207700_10000204
866 Ga0207700_10005400
867 Ga0207700_10114967
868 Ga0207700_10193169
869 Ga0207700_10200083
870 Ga0207700_10234747
871 Ga0207700_10425350
872 Ga0207664_10000520
873 Ga0207664_10283132
874 Ga0207644_10036267
875 Ga0207690_10056758
876 Ga0207690_10436434
877 Ga0207706_10002556
878 Ga0207686_10010863
879 Ga0207686_10081539
880 Ga0207670_10437617
881 Ga0207704_10015740
882 Ga0207665_10004043
883 Ga0207665_10009824
884 Ga0207665_10015344
885 Ga0207665_10015556
886 Ga0207665_10148869
887 Ga0207691_10000417
888 Ga0207711_10001310
889 Ga0207711_10013355
890 Ga0207689_10001387
891 Ga0207689_10001631
892 Ga0207689_10010347
893 Ga0207689_10174409
894 Ga0207661_10001132
895 Ga0207661_10280329
896 Ga0207679_10000080
897 Ga0207679_10140538
898 Ga0207679_10743190
899 Ga0207667_10011210
900 Ga0207667_10185280
901 Ga0207667_10780322
902 Ga0207651_10015654
903 Ga0207668_10068055
904 Ga0207668_10224175
905 Ga0207640_10422602
906 Ga0207658_10006996
907 Ga0207658_10335233
908 Ga0207677_10009845
909 Ga0207677_10067414
910 Ga0207703_10007000
911 Ga0207703_10027983
912 Ga0207639_10072320
913 Ga0207639_10130634
914 Ga0207639_10215957
915 Ga0207678_10000165
916 Ga0207678_10000912
917 Ga0207678_10327813
918 Ga0207702_10007464
919 Ga0207702_10078846
920 Ga0207702_10086480
921 Ga0207702_10180530
922 Ga0207641_10001162
923 Ga0207641_10012624
924 Ga0207641_10063533
925 Ga0207641_10691008
926 Ga0207648_10001369
927 Ga0207648_10027616
928 Ga0207648_10033000
929 Ga0207676_10000478
930 Ga0207676_10073975
931 Ga0207674_10001664
932 Ga0207674_10010928
933 Ga0207674_10314804
934 Ga0207683_10001974
935 Ga0207683_10022356
936 Ga0265356_1000037
937 Ga0268266_10005015
938 Ga0268266_10460363
939 Ga0268266_10729112
940 Ga0268265_10010526
941 Ga0268265_10206491
942 Ga0268265_10281004
943 Ga0268264_10020356
944 Ga0268264_10127717
945 Ga0268264_10330331
946 Ga0265338_10029186
947 Ga0265338_10121834
948 Ga0265338_10126489
949 Ga0265762_1000244
950 Ga0265762_1004381
951 Ga0265762_1006039
952 Ga0265762_1007229
953 Ga0265762_1017043
954 Ga0265761_100347
955 Ga0265760_10000254
956 Ga0265760_10003409
957 Ga0265760_10010559
958 Ga0265760_10012338
959 Ga0265325_10019651
960 Ga0265339_10098410
961 Ga0265316_10155358
962 Ga0265314_10067264
963 Ga0373926_0009110
964 Ga0373929_0035852
965 Ga0373934_0025394
966 Ga0373951_0097414
967 Ga0373923_0012991
968 Ga0373936_0019409
969 Ga0373936_0040209
970 Ga0373936_0237674
971 Ga0373954_0034885
972 Ga0373943_0000776
973 Ga0373943_0132604
974 Ga0373946_0002707
975 Ga0373946_0023403
976 Ga0373955_0017068
977 Ga0373955_0191563
978 Ga0373961_0073801
979 Ga0373962_0019241
980 Ga0373924_0036147
981 Ga0373935_0030607
982 Ga0373935_0079681
983 Ga0373935_0358785
984 Ga0373927_0001505
985 Ga0373933_0046783
986 Ga0373933_0223860
987 Ga0373947_0000069
988 Ga0373947_0015734
989 Ga0373947_0257943
990 Ga0373937_0056540
991 Ga0373937_0119761
992 Ga0373937_0138501
993 Ga0373937_0294977
994 Ga0265778_017376
995 Ga0373925_0007295
996 Ga0373925_0029120
997 Ga0373925_0449077
998 Ga0373925_0664884
999 Ga0436360_0703705
1000 Ga0466967_0010653
1001 Ga0495629_0043947
1002 Ga0495580_0000521
1003 Ga0495580_0005133
1004 Ga0495580_0058213
1005 Ga0495580_0089439
1006 Ga0495580_0151090
1007 Ga0495582_0004106
1008 Ga0495594_0330659
1009 Ga0495630_0033835
1010 Ga0495630_0062724
1011 Ga0495630_0488766
1012 Ga0495640_0403770
1013 Ga0495599_0143771
1014 Ga0495623_0121420
1015 Ga0495658_0082296
1016 Ga0495669_0035810
1017 Ga0495669_0046419
1018 Ga0495674_0022561
1019 Ga0495674_0416778
1020 Ga0495676_0432194
1021 Ga0495675_0336813
1022 Ga0495684_0074702
1023 Ga0495593_0274515
1024 Ga0495602_0157751
1025 Ga0496101_0000982
1026 Ga0496101_0021688
1027 Ga0496101_0375442
1028 Ga0496102_0000464
1029 Ga0496102_0263687
1030 Ga0496102_0295219
1031 Ga0496102_0500912
1032 Ga0496103_0024668
1033 Ga0496103_0546948
1034 Ga0496104_0044910
1035 Ga0496104_0080388
1036 Ga0496104_0233270
1037 Ga0496104_0473928
1038 Ga0496105_0118085
1039 Ga0496105_0300309
1040 Ga0496105_0313684
1041 Ga0496106_0439411
1042 Ga0496107_0080189
1043 Ga0496107_0119340
1044 Ga0496108_0000228
1045 Ga0496109_0000184
1046 Ga0496109_0044617
1047 Ga0496109_0133009
1048 Ga0496110_0004060
1049 Ga0496110_0145290
1050 Ga0496111_0013182
1051 Ga0496111_0103584
1052 Ga0496112_0000034
1053 Ga0496112_0051198
1054 Ga0496112_0087348
1055 Ga0496113_0000789
1056 Ga0496113_0697901
1057 Ga0496115_0031525
1058 Ga0496115_0035504
1059 Ga0496115_0149105
1060 Ga0501067_0121944
1061 nmdc:mga0n895_268729_c1
1062 nmdc:mga0rr50_474533_c1
1063 nmdc:mga0a205_946493_c1
1064 Ga0495601_0116134
1065 Ga0495601_0179349
1066 Ga0495619_0085630
1067 Ga0587070_035747
1068 Ga0587073_0004191
1069 Ga0587086_018925
1070 Ga0587091_006490
1071 Ga0587067_027651
1072 Ga0587075_007683
1073 Ga0587078_016021
1074 Ga0587071_040711

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13490

zf-HC2

Putative zinc-finger

17

51

0.98

Map