F460837
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 536 | 275 | 1072 | 67 |
Family's Representative Sequence
| Representative Sequence | 3300048912|Ga0496109_0552607|Ga0496109_0552607_102_344 |
| Length | 80 |
| Sequence | VLSPDLFVQQAKEETMYRIEIDRTLCSGFGACAELAPELFELDGGGTASVRIGETDDERALAAASACPMGAISVIETRAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 82 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 83 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 150 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 151 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 152 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 153 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 154 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 155 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 156 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 157 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 158 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 159 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 160 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 161 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 162 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 163 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 164 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 165 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 168 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 169 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 170 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 171 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 173 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 176 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 177 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 178 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 179 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 180 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 181 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 182 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 183 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 227 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 228 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 229 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 230 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 231 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 233 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 234 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 235 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 236 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 237 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 238 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 267 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 275 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.37 |
| Nodule | 0 |
| Rhizoplane | 11.38 |
| Rhizosphere | 88.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496109_0552607 | 3300048912 | Bacteria | 1086 |
| 2 | Ga0070676_10191071 | 3300005328 | Bacteria | 1337 |
| 3 | Ga0068869_100027660 | 3300005334 | Bacteria | 3956 |
| 4 | Ga0070666_10179138 | 3300005335 | Bacteria | 1486 |
| 5 | Ga0070680_100060601 | 3300005336 | Bacteria | 3096 |
| 6 | Ga0070682_100248642 | 3300005337 | Unclassified | 1281 |
| 7 | Ga0070682_100262497 | 3300005337 | Bacteria | 1250 |
| 8 | Ga0070682_100436350 | 3300005337 | Unclassified | 999 |
| 9 | Ga0068868_100197007 | 3300005338 | Bacteria | 1677 |
| 10 | Ga0068868_101973233 | 3300005338 | Bacteria | 554 |
| 11 | Ga0070660_100247896 | 3300005339 | Bacteria | 1452 |
| 12 | Ga0070689_100002798 | 3300005340 | Bacteria | 11461 |
| 13 | Ga0070691_10263844 | 3300005341 | Bacteria | 928 |
| 14 | Ga0070661_100093291 | 3300005344 | Bacteria | 2231 |
| 15 | Ga0070692_10122293 | 3300005345 | Bacteria | 1453 |
| 16 | Ga0070668_100028062 | 3300005347 | Bacteria | 4273 |
| 17 | Ga0070669_100352020 | 3300005353 | Bacteria | 1196 |
| 18 | Ga0070675_100137109 | 3300005354 | Bacteria | 2088 |
| 19 | Ga0070671_100007107 | 3300005355 | Bacteria | 8952 |
| 20 | Ga0070671_100599029 | 3300005355 | Unclassified | 952 |
| 21 | Ga0070671_101437381 | 3300005355 | Bacteria | 609 |
| 22 | Ga0070674_100083389 | 3300005356 | Bacteria | 2289 |
| 23 | Ga0070673_100063979 | 3300005364 | Bacteria | 2929 |
| 24 | Ga0070673_101161008 | 3300005364 | Unclassified | 723 |
| 25 | Ga0070688_100000664 | 3300005365 | Bacteria | 17077 |
| 26 | Ga0070667_100729484 | 3300005367 | Bacteria | 918 |
| 27 | Ga0070703_10171717 | 3300005406 | Bacteria | 831 |
| 28 | Ga0070714_100184379 | 3300005435 | Bacteria | 1901 |
| 29 | Ga0070714_100707059 | 3300005435 | Bacteria | 972 |
| 30 | Ga0070713_100002923 | 3300005436 | Bacteria | 11196 |
| 31 | Ga0070710_10766766 | 3300005437 | Bacteria | 686 |
| 32 | Ga0070701_10003643 | 3300005438 | Bacteria | 6129 |
| 33 | Ga0070711_100003985 | 3300005439 | Bacteria | 8681 |
| 34 | Ga0070705_100056946 | 3300005440 | Bacteria | 2304 |
| 35 | Ga0070700_100012505 | 3300005441 | Bacteria | 4741 |
| 36 | Ga0070694_100389757 | 3300005444 | Bacteria | 1088 |
| 37 | Ga0070663_100018558 | 3300005455 | Bacteria | 4565 |
| 38 | Ga0070663_100174270 | 3300005455 | Bacteria | 1664 |
| 39 | Ga0070678_100046741 | 3300005456 | Unclassified | 3106 |
| 40 | Ga0070678_100051695 | 3300005456 | Bacteria | 2980 |
| 41 | Ga0070678_102226926 | 3300005456 | Bacteria | 520 |
| 42 | Ga0070662_100085243 | 3300005457 | Bacteria | 2361 |
| 43 | Ga0070662_101750793 | 3300005457 | Unclassified | 537 |
| 44 | Ga0070681_10699692 | 3300005458 | Bacteria | 929 |
| 45 | Ga0068867_100002910 | 3300005459 | Bacteria | 12064 |
| 46 | Ga0068867_101619595 | 3300005459 | Bacteria | 605 |
| 47 | Ga0070685_10003539 | 3300005466 | Bacteria | 7931 |
| 48 | Ga0070685_10649084 | 3300005466 | Unclassified | 764 |
| 49 | Ga0070698_101171171 | 3300005471 | Bacteria | 718 |
| 50 | Ga0070699_101491396 | 3300005518 | Bacteria | 620 |
| 51 | Ga0070684_100001563 | 3300005535 | Bacteria | 16524 |
| 52 | Ga0070684_100078259 | 3300005535 | Bacteria | 2921 |
| 53 | Ga0070684_100109987 | 3300005535 | Bacteria | 2470 |
| 54 | Ga0070684_100394571 | 3300005535 | Unclassified | 1275 |
| 55 | Ga0070684_100741239 | 3300005535 | Unclassified | 917 |
| 56 | Ga0068853_100070675 | 3300005539 | Bacteria | 3039 |
| 57 | Ga0070672_100013015 | 3300005543 | Bacteria | 5865 |
| 58 | Ga0070686_100020878 | 3300005544 | Bacteria | 3882 |
| 59 | Ga0070686_101158818 | 3300005544 | Bacteria | 640 |
| 60 | Ga0070686_101499182 | 3300005544 | Unclassified | 568 |
| 61 | Ga0070695_100845503 | 3300005545 | Unclassified | 736 |
| 62 | Ga0070695_101604527 | 3300005545 | Bacteria | 543 |
| 63 | Ga0070696_100034792 | 3300005546 | Bacteria | 3467 |
| 64 | Ga0070696_101192182 | 3300005546 | Bacteria | 643 |
| 65 | Ga0070693_100003870 | 3300005547 | Bacteria | 7019 |
| 66 | Ga0070693_100978368 | 3300005547 | Unclassified | 639 |
| 67 | Ga0070704_100048401 | 3300005549 | Bacteria | 2976 |
| 68 | Ga0070704_100216652 | 3300005549 | Bacteria | 1554 |
| 69 | Ga0068855_100258557 | 3300005563 | Bacteria | 1940 |
| 70 | Ga0070664_100253502 | 3300005564 | Bacteria | 1582 |
| 71 | Ga0070664_100293531 | 3300005564 | Unclassified | 1468 |
| 72 | Ga0068857_100114888 | 3300005577 | Bacteria | 2421 |
| 73 | Ga0068857_100401347 | 3300005577 | Bacteria | 1276 |
| 74 | Ga0068857_102028221 | 3300005577 | Unclassified | 564 |
| 75 | Ga0068854_100311449 | 3300005578 | Bacteria | 1277 |
| 76 | Ga0068856_100052093 | 3300005614 | Bacteria | 4035 |
| 77 | Ga0068856_101102724 | 3300005614 | Bacteria | 811 |
| 78 | Ga0070702_100007720 | 3300005615 | Bacteria | 5165 |
| 79 | Ga0070702_101447407 | 3300005615 | Unclassified | 563 |
| 80 | Ga0068852_100019358 | 3300005616 | Bacteria | 5385 |
| 81 | Ga0068864_100016687 | 3300005618 | Bacteria | 6119 |
| 82 | Ga0068866_10060100 | 3300005718 | Bacteria | 1969 |
| 83 | Ga0068866_10563020 | 3300005718 | Bacteria | 764 |
| 84 | Ga0068861_100106945 | 3300005719 | Bacteria | 2236 |
| 85 | Ga0068851_10494579 | 3300005834 | Bacteria | 732 |
| 86 | Ga0068870_10031644 | 3300005840 | Bacteria | 2682 |
| 87 | Ga0068870_10034211 | 3300005840 | Bacteria | 2599 |
| 88 | Ga0068870_10802984 | 3300005840 | Unclassified | 658 |
| 89 | Ga0068870_11464997 | 3300005840 | Bacteria | 502 |
| 90 | Ga0068863_100100178 | 3300005841 | Bacteria | 2754 |
| 91 | Ga0068858_100011595 | 3300005842 | Bacteria | 8313 |
| 92 | Ga0068860_100004450 | 3300005843 | Bacteria | 14298 |
| 93 | Ga0068860_100773991 | 3300005843 | Unclassified | 972 |
| 94 | Ga0068862_100027874 | 3300005844 | Bacteria | 4758 |
| 95 | Ga0081455_10041893 | 3300005937 | Bacteria | 4022 |
| 96 | Ga0081538_10000603 | 3300005981 | Bacteria | 39795 |
| 97 | Ga0081538_10013993 | 3300005981 | Bacteria | 6314 |
| 98 | Ga0081538_10082202 | 3300005981 | Bacteria | 1709 |
| 99 | Ga0081538_10306524 | 3300005981 | Unclassified | 582 |
| 100 | Ga0070717_11425564 | 3300006028 | Bacteria | 629 |
| 101 | Ga0075365_10175498 | 3300006038 | Unclassified | 1497 |
| 102 | Ga0075432_10010682 | 3300006058 | Bacteria | 3120 |
| 103 | Ga0070716_100374563 | 3300006173 | Bacteria | 1016 |
| 104 | Ga0070712_100035783 | 3300006175 | Bacteria | 3372 |
| 105 | Ga0070712_100579904 | 3300006175 | Bacteria | 947 |
| 106 | Ga0097621_100154828 | 3300006237 | Bacteria | 1967 |
| 107 | Ga0068871_100059577 | 3300006358 | Bacteria | 3111 |
| 108 | Ga0068871_100469709 | 3300006358 | Unclassified | 1130 |
| 109 | Ga0068871_102098670 | 3300006358 | Bacteria | 538 |
| 110 | Ga0068865_100003218 | 3300006881 | Bacteria | 9784 |
| 111 | Ga0111539_10001881 | 3300009094 | Bacteria | 27871 |
| 112 | Ga0111539_10139860 | 3300009094 | Bacteria | 2835 |
| 113 | Ga0105245_10060832 | 3300009098 | Bacteria | 3402 |
| 114 | Ga0105245_10159045 | 3300009098 | Bacteria | 2142 |
| 115 | Ga0105243_12042540 | 3300009148 | Unclassified | 608 |
| 116 | Ga0105241_10373859 | 3300009174 | Bacteria | 1243 |
| 117 | Ga0105241_11572411 | 3300009174 | Unclassified | 635 |
| 118 | Ga0105242_10006708 | 3300009176 | Bacteria | 8881 |
| 119 | Ga0105242_10384904 | 3300009176 | Unclassified | 1305 |
| 120 | Ga0105248_10152567 | 3300009177 | Unclassified | 2607 |
| 121 | Ga0105238_12353553 | 3300009551 | Bacteria | 568 |
| 122 | Ga0105239_10652025 | 3300010375 | Bacteria | 1202 |
| 123 | Ga0105246_10048905 | 3300011119 | Bacteria | 2893 |
| 124 | Ga0105246_10203361 | 3300011119 | Unclassified | 1541 |
| 125 | Ga0105246_10231067 | 3300011119 | Bacteria | 1456 |
| 126 | Ga0105246_12310318 | 3300011119 | Bacteria | 526 |
| 127 | Ga0157343_1009382 | 3300012488 | Bacteria | 722 |
| 128 | Ga0157342_1018919 | 3300012507 | Unclassified | 784 |
| 129 | Ga0157338_1003251 | 3300012515 | Bacteria | 1335 |
| 130 | Ga0157371_10158635 | 3300013102 | Bacteria | 1615 |
| 131 | Ga0157374_10119550 | 3300013296 | Bacteria | 2541 |
| 132 | Ga0157375_10043381 | 3300013308 | Bacteria | 4362 |
| 133 | Ga0157375_12510601 | 3300013308 | Unclassified | 615 |
| 134 | Ga0163163_10834380 | 3300014325 | Unclassified | 985 |
| 135 | Ga0163163_13197210 | 3300014325 | Unclassified | 511 |
| 136 | Ga0157380_11198089 | 3300014326 | Unclassified | 803 |
| 137 | Ga0157377_10173219 | 3300014745 | Bacteria | 1351 |
| 138 | Ga0157377_10258122 | 3300014745 | Unclassified | 1133 |
| 139 | Ga0157377_11184758 | 3300014745 | Unclassified | 590 |
| 140 | Ga0157379_10027441 | 3300014968 | Bacteria | 5070 |
| 141 | Ga0157376_10251801 | 3300014969 | Bacteria | 1650 |
| 142 | Ga0163161_10011581 | 3300017792 | Bacteria | 6121 |
| 143 | Ga0207656_10045235 | 3300025321 | Bacteria | 1883 |
| 144 | Ga0207642_10007229 | 3300025899 | Bacteria | 3739 |
| 145 | Ga0207642_10225254 | 3300025899 | Bacteria | 1050 |
| 146 | Ga0207710_10123713 | 3300025900 | Bacteria | 1237 |
| 147 | Ga0207688_10007469 | 3300025901 | Bacteria | 5943 |
| 148 | Ga0207647_10033219 | 3300025904 | Bacteria | 3305 |
| 149 | Ga0207645_10073082 | 3300025907 | Bacteria | 2195 |
| 150 | Ga0207643_10052923 | 3300025908 | Bacteria | 2306 |
| 151 | Ga0207643_10053020 | 3300025908 | Bacteria | 2304 |
| 152 | Ga0207707_10065149 | 3300025912 | Bacteria | 3174 |
| 153 | Ga0207707_10542167 | 3300025912 | Unclassified | 989 |
| 154 | Ga0207693_10044336 | 3300025915 | Bacteria | 3496 |
| 155 | Ga0207693_10359232 | 3300025915 | Bacteria | 1140 |
| 156 | Ga0207663_10022166 | 3300025916 | Bacteria | 3628 |
| 157 | Ga0207660_10131098 | 3300025917 | Bacteria | 1908 |
| 158 | Ga0207660_11192276 | 3300025917 | Bacteria | 620 |
| 159 | Ga0207662_10204746 | 3300025918 | Bacteria | 1279 |
| 160 | Ga0207657_10181918 | 3300025919 | Bacteria | 1699 |
| 161 | Ga0207649_10268658 | 3300025920 | Bacteria | 1235 |
| 162 | Ga0207649_10849992 | 3300025920 | Bacteria | 714 |
| 163 | Ga0207652_10263187 | 3300025921 | Bacteria | 1556 |
| 164 | Ga0207681_10451474 | 3300025923 | Bacteria | 1046 |
| 165 | Ga0207694_10143862 | 3300025924 | Bacteria | 1918 |
| 166 | Ga0207650_10138259 | 3300025925 | Bacteria | 1913 |
| 167 | Ga0207687_10097809 | 3300025927 | Bacteria | 2154 |
| 168 | Ga0207687_10112246 | 3300025927 | Bacteria | 2025 |
| 169 | Ga0207687_10574899 | 3300025927 | Unclassified | 947 |
| 170 | Ga0207700_10000001 | 3300025928 | Bacteria | 1122509 |
| 171 | Ga0207664_10105947 | 3300025929 | Bacteria | 2331 |
| 172 | Ga0207664_10221096 | 3300025929 | Bacteria | 1642 |
| 173 | Ga0207664_10433603 | 3300025929 | Bacteria | 1172 |
| 174 | Ga0207644_10026276 | 3300025931 | Bacteria | 4010 |
| 175 | Ga0207644_10582612 | 3300025931 | Unclassified | 928 |
| 176 | Ga0207644_10896167 | 3300025931 | Unclassified | 743 |
| 177 | Ga0207690_10029224 | 3300025932 | Bacteria | 3502 |
| 178 | Ga0207706_10085389 | 3300025933 | Bacteria | 2775 |
| 179 | Ga0207686_10014208 | 3300025934 | Bacteria | 4428 |
| 180 | Ga0207686_10098769 | 3300025934 | Bacteria | 1945 |
| 181 | Ga0207709_10012819 | 3300025935 | Bacteria | 4623 |
| 182 | Ga0207670_10029667 | 3300025936 | Bacteria | 3486 |
| 183 | Ga0207670_11443266 | 3300025936 | Bacteria | 585 |
| 184 | Ga0207669_10075476 | 3300025937 | Bacteria | 2136 |
| 185 | Ga0207669_11799082 | 3300025937 | Bacteria | 523 |
| 186 | Ga0207704_10021838 | 3300025938 | Bacteria | 3417 |
| 187 | Ga0207665_10006920 | 3300025939 | Bacteria | 7502 |
| 188 | Ga0207665_11452039 | 3300025939 | Unclassified | 546 |
| 189 | Ga0207691_10001783 | 3300025940 | Bacteria | 21170 |
| 190 | Ga0207711_10130407 | 3300025941 | Bacteria | 2253 |
| 191 | Ga0207711_10188886 | 3300025941 | Unclassified | 1877 |
| 192 | Ga0207711_10308691 | 3300025941 | Bacteria | 1460 |
| 193 | Ga0207689_10017645 | 3300025942 | Bacteria | 6033 |
| 194 | Ga0207661_10027825 | 3300025944 | Bacteria | 4323 |
| 195 | Ga0207661_10040689 | 3300025944 | Bacteria | 3655 |
| 196 | Ga0207661_10481869 | 3300025944 | Bacteria | 1132 |
| 197 | Ga0207679_10240746 | 3300025945 | Unclassified | 1533 |
| 198 | Ga0207679_10399804 | 3300025945 | Bacteria | 1208 |
| 199 | Ga0207667_10904519 | 3300025949 | Bacteria | 874 |
| 200 | Ga0207651_10335719 | 3300025960 | Bacteria | 1268 |
| 201 | Ga0207651_10425935 | 3300025960 | Bacteria | 1134 |
| 202 | Ga0207712_10086153 | 3300025961 | Bacteria | 2301 |
| 203 | Ga0207712_10539687 | 3300025961 | Unclassified | 1002 |
| 204 | Ga0207668_10117272 | 3300025972 | Bacteria | 2009 |
| 205 | Ga0207640_10305591 | 3300025981 | Bacteria | 1260 |
| 206 | Ga0207658_10063491 | 3300025986 | Bacteria | 2768 |
| 207 | Ga0207677_10180219 | 3300026023 | Bacteria | 1661 |
| 208 | Ga0207703_10770771 | 3300026035 | Bacteria | 917 |
| 209 | Ga0207703_12079963 | 3300026035 | Bacteria | 544 |
| 210 | Ga0207639_10048155 | 3300026041 | Bacteria | 3225 |
| 211 | Ga0207678_10001841 | 3300026067 | Bacteria | 19446 |
| 212 | Ga0207678_11718103 | 3300026067 | Unclassified | 551 |
| 213 | Ga0207708_10000979 | 3300026075 | Bacteria | 21417 |
| 214 | Ga0207708_10589032 | 3300026075 | Unclassified | 941 |
| 215 | Ga0207702_10001437 | 3300026078 | Bacteria | 23675 |
| 216 | Ga0207702_10605362 | 3300026078 | Bacteria | 1075 |
| 217 | Ga0207702_11405912 | 3300026078 | Bacteria | 691 |
| 218 | Ga0207641_10390669 | 3300026088 | Bacteria | 1334 |
| 219 | Ga0207648_10005480 | 3300026089 | Bacteria | 12788 |
| 220 | Ga0207676_10094251 | 3300026095 | Bacteria | 2466 |
| 221 | Ga0207674_10043553 | 3300026116 | Bacteria | 4628 |
| 222 | Ga0207674_10089988 | 3300026116 | Bacteria | 3061 |
| 223 | Ga0207674_10117642 | 3300026116 | Bacteria | 2628 |
| 224 | Ga0207675_100003947 | 3300026118 | Bacteria | 14395 |
| 225 | Ga0207683_10004915 | 3300026121 | Bacteria | 11496 |
| 226 | Ga0207683_10041233 | 3300026121 | Bacteria | 4030 |
| 227 | Ga0207683_11480127 | 3300026121 | Unclassified | 627 |
| 228 | Ga0207698_10157033 | 3300026142 | Bacteria | 1983 |
| 229 | Ga0207428_10067174 | 3300027907 | Bacteria | 2823 |
| 230 | Ga0207428_10528414 | 3300027907 | Unclassified | 855 |
| 231 | Ga0268264_10185960 | 3300028381 | Unclassified | 1890 |
| 232 | Ga0268264_10298699 | 3300028381 | Bacteria | 1515 |
| 233 | Ga0265319_1025185 | 3300028563 | Bacteria | 2133 |
| 234 | Ga0265319_1088161 | 3300028563 | Bacteria | 981 |
| 235 | Ga0265318_10059685 | 3300028577 | Unclassified | 1422 |
| 236 | Ga0265318_10130838 | 3300028577 | Bacteria | 923 |
| 237 | Ga0265320_10562781 | 3300031240 | Bacteria | 504 |
| 238 | Ga0316583_10024989 | 3300032133 | Bacteria | 2134 |
| 239 | Ga0373948_0116833 | 3300034817 | Bacteria | 641 |
| 240 | Ga0373950_0123875 | 3300034818 | Bacteria | 574 |
| 241 | Ga0373958_0139515 | 3300034819 | Bacteria | 599 |
| 242 | Ga0373944_0150595 | 3300035089 | Bacteria | 820 |
| 243 | Ga0373944_0257920 | 3300035089 | Bacteria | 645 |
| 244 | Ga0373952_0015399 | 3300035092 | Bacteria | 1544 |
| 245 | Ga0373936_0037083 | 3300035113 | Bacteria | 1946 |
| 246 | Ga0373941_0360570 | 3300035115 | Bacteria | 593 |
| 247 | Ga0373945_0298380 | 3300035116 | Bacteria | 690 |
| 248 | Ga0373956_0111881 | 3300035119 | Bacteria | 1271 |
| 249 | Ga0373960_0148712 | 3300035121 | Bacteria | 798 |
| 250 | Ga0373943_0528726 | 3300035170 | Bacteria | 691 |
| 251 | Ga0373943_0664165 | 3300035170 | Bacteria | 616 |
| 252 | Ga0373943_0806198 | 3300035170 | Unclassified | 559 |
| 253 | Ga0373946_0159595 | 3300035171 | Bacteria | 1058 |
| 254 | Ga0373946_0385790 | 3300035171 | Bacteria | 705 |
| 255 | Ga0373946_0548829 | 3300035171 | Bacteria | 596 |
| 256 | Ga0373955_0522200 | 3300035172 | Bacteria | 726 |
| 257 | Ga0373942_0009330 | 3300035207 | Bacteria | 2295 |
| 258 | Ga0373961_0014657 | 3300035241 | Bacteria | 1994 |
| 259 | Ga0373962_0129832 | 3300035242 | Unclassified | 810 |
| 260 | Ga0373962_0315762 | 3300035242 | Bacteria | 557 |
| 261 | Ga0373924_0563161 | 3300035410 | Unclassified | 513 |
| 262 | Ga0373931_0329683 | 3300035691 | Bacteria | 950 |
| 263 | Ga0373931_0365237 | 3300035691 | Unclassified | 906 |
| 264 | Ga0373935_0071076 | 3300035692 | Bacteria | 2245 |
| 265 | Ga0373947_0079842 | 3300035725 | Bacteria | 2023 |
| 266 | Ga0373947_0121901 | 3300035725 | Bacteria | 1657 |
| 267 | Ga0373947_0940980 | 3300035725 | Bacteria | 590 |
| 268 | Ga0373937_0435158 | 3300036401 | Bacteria | 1245 |
| 269 | Ga0373937_0956197 | 3300036401 | Bacteria | 805 |
| 270 | Ga0373925_0133755 | 3300037068 | Bacteria | 1936 |
| 271 | Ga0373925_0398514 | 3300037068 | Unclassified | 1122 |
| 272 | Ga0373925_0656047 | 3300037068 | Bacteria | 865 |
| 273 | Ga0373925_0793778 | 3300037068 | Bacteria | 781 |
| 274 | Ga0242420_012326 | 3300038996 | Bacteria | 1446 |
| 275 | Ga0451807_0433098 | 3300041486 | Bacteria | 926 |
| 276 | Ga0451847_0874677 | 3300041503 | Bacteria | 648 |
| 277 | Ga0466963_0959867 | 3300044694 | Bacteria | 602 |
| 278 | Ga0466971_0032692 | 3300044719 | Bacteria | 2331 |
| 279 | Ga0466957_0070285 | 3300044842 | Bacteria | 2163 |
| 280 | Ga0466958_0588614 | 3300045836 | Bacteria | 723 |
| 281 | Ga0466967_0345180 | 3300045976 | Bacteria | 1440 |
| 282 | Ga0466967_0554833 | 3300045976 | Bacteria | 1131 |
| 283 | Ga0495592_0555164 | 3300046454 | Bacteria | 706 |
| 284 | Ga0495603_0010811 | 3300046455 | Bacteria | 5538 |
| 285 | Ga0495603_0050959 | 3300046455 | Bacteria | 2460 |
| 286 | Ga0495603_0165417 | 3300046455 | Bacteria | 1282 |
| 287 | Ga0495603_0196970 | 3300046455 | Bacteria | 1164 |
| 288 | Ga0495603_0382353 | 3300046455 | Bacteria | 807 |
| 289 | Ga0495603_0507485 | 3300046455 | Bacteria | 691 |
| 290 | Ga0495629_0104298 | 3300046459 | Bacteria | 1977 |
| 291 | Ga0495629_0134851 | 3300046459 | Unclassified | 1719 |
| 292 | Ga0495629_0173591 | 3300046459 | Bacteria | 1495 |
| 293 | Ga0495629_0211953 | 3300046459 | Bacteria | 1338 |
| 294 | Ga0495629_0311709 | 3300046459 | Archaea | 1076 |
| 295 | Ga0495629_0338206 | 3300046459 | Unclassified | 1028 |
| 296 | Ga0495641_0049373 | 3300046461 | Bacteria | 1926 |
| 297 | Ga0495641_0053615 | 3300046461 | Unclassified | 1834 |
| 298 | Ga0495641_0068359 | 3300046461 | Bacteria | 1597 |
| 299 | Ga0495641_0109481 | 3300046461 | Bacteria | 1233 |
| 300 | Ga0495641_0161852 | 3300046461 | Bacteria | 1001 |
| 301 | Ga0495641_0227110 | 3300046461 | Bacteria | 838 |
| 302 | Ga0495651_0523183 | 3300046462 | Bacteria | 757 |
| 303 | Ga0495653_0278003 | 3300046463 | Bacteria | 1100 |
| 304 | Ga0495653_0290516 | 3300046463 | Bacteria | 1069 |
| 305 | Ga0495653_0357142 | 3300046463 | Archaea | 938 |
| 306 | Ga0495653_0566188 | 3300046463 | Bacteria | 702 |
| 307 | Ga0495580_0356143 | 3300046472 | Bacteria | 991 |
| 308 | Ga0495580_0622483 | 3300046472 | Bacteria | 712 |
| 309 | Ga0495580_0749382 | 3300046472 | Bacteria | 636 |
| 310 | Ga0495582_0017893 | 3300046473 | Bacteria | 3874 |
| 311 | Ga0495582_0078762 | 3300046473 | Bacteria | 1828 |
| 312 | Ga0495582_0342301 | 3300046473 | Archaea | 861 |
| 313 | Ga0495582_0476075 | 3300046473 | Unclassified | 722 |
| 314 | Ga0495582_0562625 | 3300046473 | Bacteria | 660 |
| 315 | Ga0495639_0015474 | 3300046475 | Bacteria | 3308 |
| 316 | Ga0495639_0274248 | 3300046475 | Unclassified | 837 |
| 317 | Ga0495639_0576854 | 3300046475 | Bacteria | 577 |
| 318 | Ga0495662_0505128 | 3300046476 | Unclassified | 593 |
| 319 | Ga0495664_0077319 | 3300046477 | Bacteria | 1993 |
| 320 | Ga0495664_0266848 | 3300046477 | Unclassified | 1035 |
| 321 | Ga0495664_0442440 | 3300046477 | Bacteria | 779 |
| 322 | Ga0495585_0204474 | 3300046492 | Unclassified | 1004 |
| 323 | Ga0495594_0179975 | 3300046499 | Unclassified | 1203 |
| 324 | Ga0495594_0232821 | 3300046499 | Unclassified | 1050 |
| 325 | Ga0495594_0743762 | 3300046499 | Bacteria | 554 |
| 326 | Ga0495594_0830504 | 3300046499 | Unclassified | 520 |
| 327 | Ga0495594_0876150 | 3300046499 | Unclassified | 505 |
| 328 | Ga0495608_0254443 | 3300046511 | Archaea | 1094 |
| 329 | Ga0495618_0047528 | 3300046514 | Bacteria | 2709 |
| 330 | Ga0495630_0044293 | 3300046517 | Bacteria | 3325 |
| 331 | Ga0495630_0057359 | 3300046517 | Bacteria | 2918 |
| 332 | Ga0495630_0075483 | 3300046517 | Bacteria | 2540 |
| 333 | Ga0495630_0197225 | 3300046517 | Unclassified | 1536 |
| 334 | Ga0495630_0237023 | 3300046517 | Bacteria | 1394 |
| 335 | Ga0495630_0369730 | 3300046517 | Bacteria | 1098 |
| 336 | Ga0495630_0859668 | 3300046517 | Bacteria | 691 |
| 337 | Ga0495666_0444736 | 3300046526 | Bacteria | 581 |
| 338 | Ga0495666_0546216 | 3300046526 | Bacteria | 517 |
| 339 | Ga0495652_0719370 | 3300046529 | Bacteria | 670 |
| 340 | Ga0495665_0011256 | 3300046531 | Bacteria | 4844 |
| 341 | Ga0495665_0189218 | 3300046531 | Bacteria | 1068 |
| 342 | Ga0495640_0313914 | 3300046533 | Bacteria | 972 |
| 343 | Ga0495640_0564609 | 3300046533 | Bacteria | 689 |
| 344 | Ga0495586_0116649 | 3300046535 | Bacteria | 1489 |
| 345 | Ga0495586_0329928 | 3300046535 | Unclassified | 875 |
| 346 | Ga0495587_0139542 | 3300046536 | Bacteria | 1384 |
| 347 | Ga0495645_0086157 | 3300046543 | Bacteria | 2248 |
| 348 | Ga0495645_0284168 | 3300046543 | Bacteria | 1087 |
| 349 | Ga0495622_0198906 | 3300046557 | Bacteria | 894 |
| 350 | Ga0495667_0036745 | 3300046559 | Unclassified | 3267 |
| 351 | Ga0495667_0561519 | 3300046559 | Bacteria | 713 |
| 352 | Ga0495635_0063374 | 3300046663 | Unclassified | 2539 |
| 353 | Ga0495635_0841597 | 3300046663 | Bacteria | 590 |
| 354 | Ga0495588_0019794 | 3300046674 | Bacteria | 3302 |
| 355 | Ga0495588_0041731 | 3300046674 | Unclassified | 2344 |
| 356 | Ga0495588_0553736 | 3300046674 | Bacteria | 603 |
| 357 | Ga0495588_0731525 | 3300046674 | Bacteria | 517 |
| 358 | Ga0495646_0279782 | 3300046680 | Unclassified | 887 |
| 359 | Ga0495646_0551114 | 3300046680 | Bacteria | 589 |
| 360 | Ga0495647_0037903 | 3300046681 | Bacteria | 1821 |
| 361 | Ga0495647_0081460 | 3300046681 | Unclassified | 1313 |
| 362 | Ga0495647_0106492 | 3300046681 | Unclassified | 1166 |
| 363 | Ga0495658_0014445 | 3300046683 | Bacteria | 4037 |
| 364 | Ga0495658_0048913 | 3300046683 | Bacteria | 2386 |
| 365 | Ga0495658_0051135 | 3300046683 | Bacteria | 2340 |
| 366 | Ga0495658_0086260 | 3300046683 | Bacteria | 1852 |
| 367 | Ga0495658_0629085 | 3300046683 | Bacteria | 687 |
| 368 | Ga0495658_1053327 | 3300046683 | Archaea | 519 |
| 369 | Ga0495613_0086747 | 3300046689 | Bacteria | 2269 |
| 370 | Ga0495613_0097481 | 3300046689 | Bacteria | 2125 |
| 371 | Ga0495613_0137083 | 3300046689 | Bacteria | 1750 |
| 372 | Ga0495613_0258903 | 3300046689 | Bacteria | 1213 |
| 373 | Ga0495613_0835603 | 3300046689 | Bacteria | 599 |
| 374 | Ga0495624_0008041 | 3300046690 | Bacteria | 7387 |
| 375 | Ga0495624_0083901 | 3300046690 | Bacteria | 1970 |
| 376 | Ga0495624_0310616 | 3300046690 | Archaea | 950 |
| 377 | Ga0495624_0330365 | 3300046690 | Bacteria | 918 |
| 378 | Ga0495624_0394087 | 3300046690 | Bacteria | 831 |
| 379 | Ga0495600_0344365 | 3300046809 | Bacteria | 934 |
| 380 | Ga0495581_0001948 | 3300047315 | Bacteria | 11567 |
| 381 | Ga0495581_0004797 | 3300047315 | Bacteria | 7817 |
| 382 | Ga0495581_0118714 | 3300047315 | Unclassified | 1539 |
| 383 | Ga0495581_0267694 | 3300047315 | Bacteria | 999 |
| 384 | Ga0495581_0363323 | 3300047315 | Bacteria | 845 |
| 385 | Ga0495581_0403069 | 3300047315 | Unclassified | 798 |
| 386 | Ga0495581_0637109 | 3300047315 | Bacteria | 616 |
| 387 | Ga0495581_0699114 | 3300047315 | Bacteria | 585 |
| 388 | Ga0495604_0191400 | 3300047317 | Bacteria | 1425 |
| 389 | Ga0495604_0360800 | 3300047317 | Bacteria | 964 |
| 390 | Ga0495674_0021835 | 3300047319 | Bacteria | 5914 |
| 391 | Ga0495676_0006497 | 3300047321 | Bacteria | 10775 |
| 392 | Ga0495676_0021962 | 3300047321 | Bacteria | 5562 |
| 393 | Ga0495676_0076755 | 3300047321 | Unclassified | 2550 |
| 394 | Ga0495676_0366465 | 3300047321 | Bacteria | 961 |
| 395 | Ga0495676_0370441 | 3300047321 | Bacteria | 954 |
| 396 | Ga0495676_0689171 | 3300047321 | Bacteria | 661 |
| 397 | Ga0495676_0993908 | 3300047321 | Bacteria | 535 |
| 398 | Ga0495676_1122276 | 3300047321 | Bacteria | 500 |
| 399 | Ga0495680_0017526 | 3300047322 | Bacteria | 6111 |
| 400 | Ga0495680_0302578 | 3300047322 | Bacteria | 1122 |
| 401 | Ga0495680_0930949 | 3300047322 | Bacteria | 559 |
| 402 | Ga0495684_0358656 | 3300047471 | Unclassified | 1033 |
| 403 | Ga0495602_0569454 | 3300048088 | Bacteria | 783 |
| 404 | Ga0495614_0164498 | 3300048089 | Archaea | 994 |
| 405 | Ga0495614_0433149 | 3300048089 | Bacteria | 621 |
| 406 | Ga0496100_0697100 | 3300048903 | Unclassified | 792 |
| 407 | Ga0496100_1147987 | 3300048903 | Bacteria | 612 |
| 408 | Ga0496101_0195698 | 3300048904 | Bacteria | 1562 |
| 409 | Ga0496101_0260278 | 3300048904 | Bacteria | 1353 |
| 410 | Ga0496101_0291308 | 3300048904 | Unclassified | 1277 |
| 411 | Ga0496101_0551577 | 3300048904 | Bacteria | 911 |
| 412 | Ga0496101_0782473 | 3300048904 | Bacteria | 753 |
| 413 | Ga0496102_0163058 | 3300048905 | Unclassified | 2097 |
| 414 | Ga0496102_0213227 | 3300048905 | Bacteria | 1820 |
| 415 | Ga0496104_0027946 | 3300048907 | Bacteria | 5224 |
| 416 | Ga0496104_0048992 | 3300048907 | Bacteria | 3984 |
| 417 | Ga0496104_0181785 | 3300048907 | Bacteria | 2013 |
| 418 | Ga0496104_1510459 | 3300048907 | Unclassified | 575 |
| 419 | Ga0496104_1829612 | 3300048907 | Unclassified | 509 |
| 420 | Ga0496105_0077555 | 3300048908 | Unclassified | 2744 |
| 421 | Ga0496105_0337626 | 3300048908 | Unclassified | 1205 |
| 422 | Ga0496105_0603046 | 3300048908 | Bacteria | 852 |
| 423 | Ga0496106_0010504 | 3300048909 | Bacteria | 6839 |
| 424 | Ga0496106_0037967 | 3300048909 | Bacteria | 3604 |
| 425 | Ga0496107_0055375 | 3300048910 | Bacteria | 2864 |
| 426 | Ga0496108_0013554 | 3300048911 | Bacteria | 6653 |
| 427 | Ga0496108_0028817 | 3300048911 | Bacteria | 4595 |
| 428 | Ga0496108_0338881 | 3300048911 | Bacteria | 1312 |
| 429 | Ga0496108_0346139 | 3300048911 | Bacteria | 1297 |
| 430 | Ga0496108_0494598 | 3300048911 | Bacteria | 1068 |
| 431 | Ga0496108_1024312 | 3300048911 | Unclassified | 704 |
| 432 | Ga0496109_0004482 | 3300048912 | Bacteria | 11668 |
| 433 | Ga0496109_0163540 | 3300048912 | Bacteria | 2085 |
| 434 | Ga0496109_1493315 | 3300048912 | Bacteria | 611 |
| 435 | Ga0496110_0002631 | 3300048913 | Bacteria | 13521 |
| 436 | Ga0496110_0005778 | 3300048913 | Bacteria | 9723 |
| 437 | Ga0496110_0006178 | 3300048913 | Bacteria | 9452 |
| 438 | Ga0496110_0053090 | 3300048913 | Bacteria | 3562 |
| 439 | Ga0496110_0503495 | 3300048913 | Bacteria | 1103 |
| 440 | Ga0496110_0503831 | 3300048913 | Unclassified | 1102 |
| 441 | Ga0496110_0727655 | 3300048913 | Unclassified | 895 |
| 442 | Ga0496110_1454471 | 3300048913 | Bacteria | 595 |
| 443 | Ga0496110_1862689 | 3300048913 | Bacteria | 512 |
| 444 | Ga0496111_0003989 | 3300048914 | Bacteria | 9266 |
| 445 | Ga0496111_0010217 | 3300048914 | Bacteria | 6290 |
| 446 | Ga0496111_0020524 | 3300048914 | Bacteria | 4601 |
| 447 | Ga0496111_0030875 | 3300048914 | Bacteria | 3812 |
| 448 | Ga0496111_0110568 | 3300048914 | Bacteria | 2024 |
| 449 | Ga0496111_0398294 | 3300048914 | Bacteria | 1017 |
| 450 | Ga0496111_1063719 | 3300048914 | Bacteria | 578 |
| 451 | Ga0496112_0044818 | 3300048915 | Bacteria | 4335 |
| 452 | Ga0496112_0178769 | 3300048915 | Bacteria | 2085 |
| 453 | Ga0496112_0411095 | 3300048915 | Bacteria | 1292 |
| 454 | Ga0496112_0617008 | 3300048915 | Bacteria | 1016 |
| 455 | Ga0496113_0023950 | 3300048916 | Bacteria | 4334 |
| 456 | Ga0496113_0337935 | 3300048916 | Unclassified | 1208 |
| 457 | Ga0496113_0499165 | 3300048916 | Bacteria | 977 |
| 458 | Ga0496114_0003844 | 3300048917 | Bacteria | 11582 |
| 459 | Ga0496114_0051716 | 3300048917 | Bacteria | 3421 |
| 460 | Ga0496114_0113856 | 3300048917 | Unclassified | 2319 |
| 461 | Ga0496114_1471476 | 3300048917 | Bacteria | 569 |
| 462 | Ga0496114_1670829 | 3300048917 | Bacteria | 525 |
| 463 | Ga0496115_0775223 | 3300048918 | Unclassified | 748 |
| 464 | Ga0496115_0916854 | 3300048918 | Bacteria | 675 |
| 465 | Ga0501031_0007702 | 3300049568 | Bacteria | 7011 |
| 466 | Ga0501031_0041570 | 3300049568 | Bacteria | 3001 |
| 467 | Ga0501032_0998574 | 3300049569 | Archaea | 526 |
| 468 | Ga0501033_0186088 | 3300049570 | Unclassified | 1488 |
| 469 | Ga0501036_0014861 | 3300049572 | Bacteria | 6495 |
| 470 | Ga0501036_0090315 | 3300049572 | Bacteria | 2588 |
| 471 | Ga0501037_0075085 | 3300049573 | Bacteria | 2456 |
| 472 | Ga0501037_0229174 | 3300049573 | Unclassified | 1305 |
| 473 | Ga0501038_0033318 | 3300049574 | Bacteria | 4539 |
| 474 | Ga0501038_1156170 | 3300049574 | Archaea | 563 |
| 475 | Ga0501039_0023902 | 3300049575 | Bacteria | 4691 |
| 476 | Ga0501039_0106501 | 3300049575 | Bacteria | 2190 |
| 477 | Ga0501040_0024155 | 3300049576 | Bacteria | 4078 |
| 478 | Ga0501040_0059323 | 3300049576 | Unclassified | 2629 |
| 479 | Ga0501041_0004768 | 3300049577 | Bacteria | 7873 |
| 480 | Ga0501041_0030840 | 3300049577 | Bacteria | 3236 |
| 481 | Ga0501042_0003158 | 3300049578 | Bacteria | 10271 |
| 482 | Ga0501042_0006842 | 3300049578 | Bacteria | 7440 |
| 483 | Ga0501046_0115734 | 3300049580 | Bacteria | 2045 |
| 484 | Ga0501046_0171455 | 3300049580 | Bacteria | 1628 |
| 485 | Ga0501048_0001343 | 3300049582 | Bacteria | 18645 |
| 486 | Ga0501048_0057763 | 3300049582 | Bacteria | 2751 |
| 487 | Ga0501068_0054145 | 3300049584 | Bacteria | 2431 |
| 488 | Ga0501068_0593971 | 3300049584 | Unclassified | 721 |
| 489 | Ga0501069_0173002 | 3300049585 | Unclassified | 1246 |
| 490 | Ga0501069_0467825 | 3300049585 | Archaea | 750 |
| 491 | Ga0501070_0169306 | 3300049586 | Bacteria | 1800 |
| 492 | Ga0501071_0015026 | 3300049587 | Bacteria | 5307 |
| 493 | Ga0501071_0019507 | 3300049587 | Bacteria | 4705 |
| 494 | Ga0501072_0007598 | 3300049588 | Bacteria | 8225 |
| 495 | Ga0501072_0051042 | 3300049588 | Bacteria | 3257 |
| 496 | Ga0501074_0038840 | 3300049590 | Bacteria | 3448 |
| 497 | Ga0501074_0216164 | 3300049590 | Unclassified | 1365 |
| 498 | Ga0501075_0030435 | 3300049591 | Bacteria | 3998 |
| 499 | Ga0501075_0126961 | 3300049591 | Bacteria | 1942 |
| 500 | Ga0501076_0004547 | 3300049592 | Bacteria | 9881 |
| 501 | Ga0501076_0023440 | 3300049592 | Bacteria | 4758 |
| 502 | Ga0501076_1316234 | 3300049592 | Bacteria | 594 |
| 503 | Ga0501077_0001510 | 3300049593 | Bacteria | 14036 |
| 504 | Ga0501077_0010631 | 3300049593 | Bacteria | 5731 |
| 505 | Ga0501077_0065189 | 3300049593 | Bacteria | 2310 |
| 506 | Ga0501079_0000542 | 3300049741 | Bacteria | 24598 |
| 507 | Ga0501079_0021110 | 3300049741 | Bacteria | 4978 |
| 508 | Ga0501080_0197359 | 3300049742 | Bacteria | 1848 |
| 509 | Ga0501081_0002743 | 3300049743 | Bacteria | 11160 |
| 510 | Ga0501081_1327706 | 3300049743 | Unclassified | 545 |
| 511 | Ga0501083_0093944 | 3300049744 | Bacteria | 1980 |
| 512 | Ga0501083_0222229 | 3300049744 | Unclassified | 1230 |
| 513 | Ga0501035_0024886 | 3300049822 | Bacteria | 5490 |
| 514 | Ga0501035_0329241 | 3300049822 | Unclassified | 1282 |
| 515 | Ga0501044_0483449 | 3300049823 | Bacteria | 1141 |
| 516 | Ga0501044_0860346 | 3300049823 | Unclassified | 783 |
| 517 | Ga0501045_0003033 | 3300049824 | Bacteria | 11481 |
| 518 | Ga0501045_0003453 | 3300049824 | Bacteria | 10816 |
| 519 | nmdc:mga0yw44_260256_c1 | 3300050492 | Unclassified | 1156 |
| 520 | nmdc:mga08y16_152971_c1 | 3300050511 | Bacteria | 2398 |
| 521 | nmdc:mga08y16_31214_c1 | 3300050511 | Bacteria | 5606 |
| 522 | Ga0495601_0218381 | 3300053077 | Unclassified | 1245 |
| 523 | Ga0495612_0337453 | 3300053078 | Bacteria | 679 |
| 524 | Ga0495595_0053771 | 3300053084 | Bacteria | 1871 |
| 525 | Ga0495595_0230101 | 3300053084 | Bacteria | 926 |
| 526 | Ga0495619_0014718 | 3300053085 | Bacteria | 4941 |
| 527 | Ga0495619_0187341 | 3300053085 | Archaea | 1432 |
| 528 | Ga0495619_0284154 | 3300053085 | Bacteria | 1146 |
| 529 | Ga0495619_0679562 | 3300053085 | Bacteria | 701 |
| 530 | Ga0501084_0014222 | 3300054114 | Bacteria | 6590 |
| 531 | Ga0501084_0025799 | 3300054114 | Bacteria | 4901 |
| 532 | Ga0501082_0002796 | 3300060353 | Bacteria | 15224 |
| 533 | Ga0501082_0138619 | 3300060353 | Bacteria | 2111 |
| 534 | Ga0466962_0446046 | 3300061719 | Bacteria | 651 |
| 535 | Ga0530510_0024826 | 3300061734 | Bacteria | 4282 |
| 536 | Ga0530510_0064352 | 3300061734 | Bacteria | 2656 |
| 537 | Ga0496109_0552607 | |||
| 538 | Ga0070676_10191071 | |||
| 539 | Ga0068869_100027660 | |||
| 540 | Ga0070666_10179138 | |||
| 541 | Ga0070680_100060601 | |||
| 542 | Ga0070682_100248642 | |||
| 543 | Ga0070682_100262497 | |||
| 544 | Ga0070682_100436350 | |||
| 545 | Ga0068868_100197007 | |||
| 546 | Ga0068868_101973233 | |||
| 547 | Ga0070660_100247896 | |||
| 548 | Ga0070689_100002798 | |||
| 549 | Ga0070691_10263844 | |||
| 550 | Ga0070661_100093291 | |||
| 551 | Ga0070692_10122293 | |||
| 552 | Ga0070668_100028062 | |||
| 553 | Ga0070669_100352020 | |||
| 554 | Ga0070675_100137109 | |||
| 555 | Ga0070671_100007107 | |||
| 556 | Ga0070671_100599029 | |||
| 557 | Ga0070671_101437381 | |||
| 558 | Ga0070674_100083389 | |||
| 559 | Ga0070673_100063979 | |||
| 560 | Ga0070673_101161008 | |||
| 561 | Ga0070688_100000664 | |||
| 562 | Ga0070667_100729484 | |||
| 563 | Ga0070703_10171717 | |||
| 564 | Ga0070714_100184379 | |||
| 565 | Ga0070714_100707059 | |||
| 566 | Ga0070713_100002923 | |||
| 567 | Ga0070710_10766766 | |||
| 568 | Ga0070701_10003643 | |||
| 569 | Ga0070711_100003985 | |||
| 570 | Ga0070705_100056946 | |||
| 571 | Ga0070700_100012505 | |||
| 572 | Ga0070694_100389757 | |||
| 573 | Ga0070663_100018558 | |||
| 574 | Ga0070663_100174270 | |||
| 575 | Ga0070678_100046741 | |||
| 576 | Ga0070678_100051695 | |||
| 577 | Ga0070678_102226926 | |||
| 578 | Ga0070662_100085243 | |||
| 579 | Ga0070662_101750793 | |||
| 580 | Ga0070681_10699692 | |||
| 581 | Ga0068867_100002910 | |||
| 582 | Ga0068867_101619595 | |||
| 583 | Ga0070685_10003539 | |||
| 584 | Ga0070685_10649084 | |||
| 585 | Ga0070698_101171171 | |||
| 586 | Ga0070699_101491396 | |||
| 587 | Ga0070684_100001563 | |||
| 588 | Ga0070684_100078259 | |||
| 589 | Ga0070684_100109987 | |||
| 590 | Ga0070684_100394571 | |||
| 591 | Ga0070684_100741239 | |||
| 592 | Ga0068853_100070675 | |||
| 593 | Ga0070672_100013015 | |||
| 594 | Ga0070686_100020878 | |||
| 595 | Ga0070686_101158818 | |||
| 596 | Ga0070686_101499182 | |||
| 597 | Ga0070695_100845503 | |||
| 598 | Ga0070695_101604527 | |||
| 599 | Ga0070696_100034792 | |||
| 600 | Ga0070696_101192182 | |||
| 601 | Ga0070693_100003870 | |||
| 602 | Ga0070693_100978368 | |||
| 603 | Ga0070704_100048401 | |||
| 604 | Ga0070704_100216652 | |||
| 605 | Ga0068855_100258557 | |||
| 606 | Ga0070664_100253502 | |||
| 607 | Ga0070664_100293531 | |||
| 608 | Ga0068857_100114888 | |||
| 609 | Ga0068857_100401347 | |||
| 610 | Ga0068857_102028221 | |||
| 611 | Ga0068854_100311449 | |||
| 612 | Ga0068856_100052093 | |||
| 613 | Ga0068856_101102724 | |||
| 614 | Ga0070702_100007720 | |||
| 615 | Ga0070702_101447407 | |||
| 616 | Ga0068852_100019358 | |||
| 617 | Ga0068864_100016687 | |||
| 618 | Ga0068866_10060100 | |||
| 619 | Ga0068866_10563020 | |||
| 620 | Ga0068861_100106945 | |||
| 621 | Ga0068851_10494579 | |||
| 622 | Ga0068870_10031644 | |||
| 623 | Ga0068870_10034211 | |||
| 624 | Ga0068870_10802984 | |||
| 625 | Ga0068870_11464997 | |||
| 626 | Ga0068863_100100178 | |||
| 627 | Ga0068858_100011595 | |||
| 628 | Ga0068860_100004450 | |||
| 629 | Ga0068860_100773991 | |||
| 630 | Ga0068862_100027874 | |||
| 631 | Ga0081455_10041893 | |||
| 632 | Ga0081538_10000603 | |||
| 633 | Ga0081538_10013993 | |||
| 634 | Ga0081538_10082202 | |||
| 635 | Ga0081538_10306524 | |||
| 636 | Ga0070717_11425564 | |||
| 637 | Ga0075365_10175498 | |||
| 638 | Ga0075432_10010682 | |||
| 639 | Ga0070716_100374563 | |||
| 640 | Ga0070712_100035783 | |||
| 641 | Ga0070712_100579904 | |||
| 642 | Ga0097621_100154828 | |||
| 643 | Ga0068871_100059577 | |||
| 644 | Ga0068871_100469709 | |||
| 645 | Ga0068871_102098670 | |||
| 646 | Ga0068865_100003218 | |||
| 647 | Ga0111539_10001881 | |||
| 648 | Ga0111539_10139860 | |||
| 649 | Ga0105245_10060832 | |||
| 650 | Ga0105245_10159045 | |||
| 651 | Ga0105243_12042540 | |||
| 652 | Ga0105241_10373859 | |||
| 653 | Ga0105241_11572411 | |||
| 654 | Ga0105242_10006708 | |||
| 655 | Ga0105242_10384904 | |||
| 656 | Ga0105248_10152567 | |||
| 657 | Ga0105238_12353553 | |||
| 658 | Ga0105239_10652025 | |||
| 659 | Ga0105246_10048905 | |||
| 660 | Ga0105246_10203361 | |||
| 661 | Ga0105246_10231067 | |||
| 662 | Ga0105246_12310318 | |||
| 663 | Ga0157343_1009382 | |||
| 664 | Ga0157342_1018919 | |||
| 665 | Ga0157338_1003251 | |||
| 666 | Ga0157371_10158635 | |||
| 667 | Ga0157374_10119550 | |||
| 668 | Ga0157375_10043381 | |||
| 669 | Ga0157375_12510601 | |||
| 670 | Ga0163163_10834380 | |||
| 671 | Ga0163163_13197210 | |||
| 672 | Ga0157380_11198089 | |||
| 673 | Ga0157377_10173219 | |||
| 674 | Ga0157377_10258122 | |||
| 675 | Ga0157377_11184758 | |||
| 676 | Ga0157379_10027441 | |||
| 677 | Ga0157376_10251801 | |||
| 678 | Ga0163161_10011581 | |||
| 679 | Ga0207656_10045235 | |||
| 680 | Ga0207642_10007229 | |||
| 681 | Ga0207642_10225254 | |||
| 682 | Ga0207710_10123713 | |||
| 683 | Ga0207688_10007469 | |||
| 684 | Ga0207647_10033219 | |||
| 685 | Ga0207645_10073082 | |||
| 686 | Ga0207643_10052923 | |||
| 687 | Ga0207643_10053020 | |||
| 688 | Ga0207707_10065149 | |||
| 689 | Ga0207707_10542167 | |||
| 690 | Ga0207693_10044336 | |||
| 691 | Ga0207693_10359232 | |||
| 692 | Ga0207663_10022166 | |||
| 693 | Ga0207660_10131098 | |||
| 694 | Ga0207660_11192276 | |||
| 695 | Ga0207662_10204746 | |||
| 696 | Ga0207657_10181918 | |||
| 697 | Ga0207649_10268658 | |||
| 698 | Ga0207649_10849992 | |||
| 699 | Ga0207652_10263187 | |||
| 700 | Ga0207681_10451474 | |||
| 701 | Ga0207694_10143862 | |||
| 702 | Ga0207650_10138259 | |||
| 703 | Ga0207687_10097809 | |||
| 704 | Ga0207687_10112246 | |||
| 705 | Ga0207687_10574899 | |||
| 706 | Ga0207700_10000001 | |||
| 707 | Ga0207664_10105947 | |||
| 708 | Ga0207664_10221096 | |||
| 709 | Ga0207664_10433603 | |||
| 710 | Ga0207644_10026276 | |||
| 711 | Ga0207644_10582612 | |||
| 712 | Ga0207644_10896167 | |||
| 713 | Ga0207690_10029224 | |||
| 714 | Ga0207706_10085389 | |||
| 715 | Ga0207686_10014208 | |||
| 716 | Ga0207686_10098769 | |||
| 717 | Ga0207709_10012819 | |||
| 718 | Ga0207670_10029667 | |||
| 719 | Ga0207670_11443266 | |||
| 720 | Ga0207669_10075476 | |||
| 721 | Ga0207669_11799082 | |||
| 722 | Ga0207704_10021838 | |||
| 723 | Ga0207665_10006920 | |||
| 724 | Ga0207665_11452039 | |||
| 725 | Ga0207691_10001783 | |||
| 726 | Ga0207711_10130407 | |||
| 727 | Ga0207711_10188886 | |||
| 728 | Ga0207711_10308691 | |||
| 729 | Ga0207689_10017645 | |||
| 730 | Ga0207661_10027825 | |||
| 731 | Ga0207661_10040689 | |||
| 732 | Ga0207661_10481869 | |||
| 733 | Ga0207679_10240746 | |||
| 734 | Ga0207679_10399804 | |||
| 735 | Ga0207667_10904519 | |||
| 736 | Ga0207651_10335719 | |||
| 737 | Ga0207651_10425935 | |||
| 738 | Ga0207712_10086153 | |||
| 739 | Ga0207712_10539687 | |||
| 740 | Ga0207668_10117272 | |||
| 741 | Ga0207640_10305591 | |||
| 742 | Ga0207658_10063491 | |||
| 743 | Ga0207677_10180219 | |||
| 744 | Ga0207703_10770771 | |||
| 745 | Ga0207703_12079963 | |||
| 746 | Ga0207639_10048155 | |||
| 747 | Ga0207678_10001841 | |||
| 748 | Ga0207678_11718103 | |||
| 749 | Ga0207708_10000979 | |||
| 750 | Ga0207708_10589032 | |||
| 751 | Ga0207702_10001437 | |||
| 752 | Ga0207702_10605362 | |||
| 753 | Ga0207702_11405912 | |||
| 754 | Ga0207641_10390669 | |||
| 755 | Ga0207648_10005480 | |||
| 756 | Ga0207676_10094251 | |||
| 757 | Ga0207674_10043553 | |||
| 758 | Ga0207674_10089988 | |||
| 759 | Ga0207674_10117642 | |||
| 760 | Ga0207675_100003947 | |||
| 761 | Ga0207683_10004915 | |||
| 762 | Ga0207683_10041233 | |||
| 763 | Ga0207683_11480127 | |||
| 764 | Ga0207698_10157033 | |||
| 765 | Ga0207428_10067174 | |||
| 766 | Ga0207428_10528414 | |||
| 767 | Ga0268264_10185960 | |||
| 768 | Ga0268264_10298699 | |||
| 769 | Ga0265319_1025185 | |||
| 770 | Ga0265319_1088161 | |||
| 771 | Ga0265318_10059685 | |||
| 772 | Ga0265318_10130838 | |||
| 773 | Ga0265320_10562781 | |||
| 774 | Ga0316583_10024989 | |||
| 775 | Ga0373948_0116833 | |||
| 776 | Ga0373950_0123875 | |||
| 777 | Ga0373958_0139515 | |||
| 778 | Ga0373944_0150595 | |||
| 779 | Ga0373944_0257920 | |||
| 780 | Ga0373952_0015399 | |||
| 781 | Ga0373936_0037083 | |||
| 782 | Ga0373941_0360570 | |||
| 783 | Ga0373945_0298380 | |||
| 784 | Ga0373956_0111881 | |||
| 785 | Ga0373960_0148712 | |||
| 786 | Ga0373943_0528726 | |||
| 787 | Ga0373943_0664165 | |||
| 788 | Ga0373943_0806198 | |||
| 789 | Ga0373946_0159595 | |||
| 790 | Ga0373946_0385790 | |||
| 791 | Ga0373946_0548829 | |||
| 792 | Ga0373955_0522200 | |||
| 793 | Ga0373942_0009330 | |||
| 794 | Ga0373961_0014657 | |||
| 795 | Ga0373962_0129832 | |||
| 796 | Ga0373962_0315762 | |||
| 797 | Ga0373924_0563161 | |||
| 798 | Ga0373931_0329683 | |||
| 799 | Ga0373931_0365237 | |||
| 800 | Ga0373935_0071076 | |||
| 801 | Ga0373947_0079842 | |||
| 802 | Ga0373947_0121901 | |||
| 803 | Ga0373947_0940980 | |||
| 804 | Ga0373937_0435158 | |||
| 805 | Ga0373937_0956197 | |||
| 806 | Ga0373925_0133755 | |||
| 807 | Ga0373925_0398514 | |||
| 808 | Ga0373925_0656047 | |||
| 809 | Ga0373925_0793778 | |||
| 810 | Ga0242420_012326 | |||
| 811 | Ga0451807_0433098 | |||
| 812 | Ga0451847_0874677 | |||
| 813 | Ga0466963_0959867 | |||
| 814 | Ga0466971_0032692 | |||
| 815 | Ga0466957_0070285 | |||
| 816 | Ga0466958_0588614 | |||
| 817 | Ga0466967_0345180 | |||
| 818 | Ga0466967_0554833 | |||
| 819 | Ga0495592_0555164 | |||
| 820 | Ga0495603_0010811 | |||
| 821 | Ga0495603_0050959 | |||
| 822 | Ga0495603_0165417 | |||
| 823 | Ga0495603_0196970 | |||
| 824 | Ga0495603_0382353 | |||
| 825 | Ga0495603_0507485 | |||
| 826 | Ga0495629_0104298 | |||
| 827 | Ga0495629_0134851 | |||
| 828 | Ga0495629_0173591 | |||
| 829 | Ga0495629_0211953 | |||
| 830 | Ga0495629_0311709 | |||
| 831 | Ga0495629_0338206 | |||
| 832 | Ga0495641_0049373 | |||
| 833 | Ga0495641_0053615 | |||
| 834 | Ga0495641_0068359 | |||
| 835 | Ga0495641_0109481 | |||
| 836 | Ga0495641_0161852 | |||
| 837 | Ga0495641_0227110 | |||
| 838 | Ga0495651_0523183 | |||
| 839 | Ga0495653_0278003 | |||
| 840 | Ga0495653_0290516 | |||
| 841 | Ga0495653_0357142 | |||
| 842 | Ga0495653_0566188 | |||
| 843 | Ga0495580_0356143 | |||
| 844 | Ga0495580_0622483 | |||
| 845 | Ga0495580_0749382 | |||
| 846 | Ga0495582_0017893 | |||
| 847 | Ga0495582_0078762 | |||
| 848 | Ga0495582_0342301 | |||
| 849 | Ga0495582_0476075 | |||
| 850 | Ga0495582_0562625 | |||
| 851 | Ga0495639_0015474 | |||
| 852 | Ga0495639_0274248 | |||
| 853 | Ga0495639_0576854 | |||
| 854 | Ga0495662_0505128 | |||
| 855 | Ga0495664_0077319 | |||
| 856 | Ga0495664_0266848 | |||
| 857 | Ga0495664_0442440 | |||
| 858 | Ga0495585_0204474 | |||
| 859 | Ga0495594_0179975 | |||
| 860 | Ga0495594_0232821 | |||
| 861 | Ga0495594_0743762 | |||
| 862 | Ga0495594_0830504 | |||
| 863 | Ga0495594_0876150 | |||
| 864 | Ga0495608_0254443 | |||
| 865 | Ga0495618_0047528 | |||
| 866 | Ga0495630_0044293 | |||
| 867 | Ga0495630_0057359 | |||
| 868 | Ga0495630_0075483 | |||
| 869 | Ga0495630_0197225 | |||
| 870 | Ga0495630_0237023 | |||
| 871 | Ga0495630_0369730 | |||
| 872 | Ga0495630_0859668 | |||
| 873 | Ga0495666_0444736 | |||
| 874 | Ga0495666_0546216 | |||
| 875 | Ga0495652_0719370 | |||
| 876 | Ga0495665_0011256 | |||
| 877 | Ga0495665_0189218 | |||
| 878 | Ga0495640_0313914 | |||
| 879 | Ga0495640_0564609 | |||
| 880 | Ga0495586_0116649 | |||
| 881 | Ga0495586_0329928 | |||
| 882 | Ga0495587_0139542 | |||
| 883 | Ga0495645_0086157 | |||
| 884 | Ga0495645_0284168 | |||
| 885 | Ga0495622_0198906 | |||
| 886 | Ga0495667_0036745 | |||
| 887 | Ga0495667_0561519 | |||
| 888 | Ga0495635_0063374 | |||
| 889 | Ga0495635_0841597 | |||
| 890 | Ga0495588_0019794 | |||
| 891 | Ga0495588_0041731 | |||
| 892 | Ga0495588_0553736 | |||
| 893 | Ga0495588_0731525 | |||
| 894 | Ga0495646_0279782 | |||
| 895 | Ga0495646_0551114 | |||
| 896 | Ga0495647_0037903 | |||
| 897 | Ga0495647_0081460 | |||
| 898 | Ga0495647_0106492 | |||
| 899 | Ga0495658_0014445 | |||
| 900 | Ga0495658_0048913 | |||
| 901 | Ga0495658_0051135 | |||
| 902 | Ga0495658_0086260 | |||
| 903 | Ga0495658_0629085 | |||
| 904 | Ga0495658_1053327 | |||
| 905 | Ga0495613_0086747 | |||
| 906 | Ga0495613_0097481 | |||
| 907 | Ga0495613_0137083 | |||
| 908 | Ga0495613_0258903 | |||
| 909 | Ga0495613_0835603 | |||
| 910 | Ga0495624_0008041 | |||
| 911 | Ga0495624_0083901 | |||
| 912 | Ga0495624_0310616 | |||
| 913 | Ga0495624_0330365 | |||
| 914 | Ga0495624_0394087 | |||
| 915 | Ga0495600_0344365 | |||
| 916 | Ga0495581_0001948 | |||
| 917 | Ga0495581_0004797 | |||
| 918 | Ga0495581_0118714 | |||
| 919 | Ga0495581_0267694 | |||
| 920 | Ga0495581_0363323 | |||
| 921 | Ga0495581_0403069 | |||
| 922 | Ga0495581_0637109 | |||
| 923 | Ga0495581_0699114 | |||
| 924 | Ga0495604_0191400 | |||
| 925 | Ga0495604_0360800 | |||
| 926 | Ga0495674_0021835 | |||
| 927 | Ga0495676_0006497 | |||
| 928 | Ga0495676_0021962 | |||
| 929 | Ga0495676_0076755 | |||
| 930 | Ga0495676_0366465 | |||
| 931 | Ga0495676_0370441 | |||
| 932 | Ga0495676_0689171 | |||
| 933 | Ga0495676_0993908 | |||
| 934 | Ga0495676_1122276 | |||
| 935 | Ga0495680_0017526 | |||
| 936 | Ga0495680_0302578 | |||
| 937 | Ga0495680_0930949 | |||
| 938 | Ga0495684_0358656 | |||
| 939 | Ga0495602_0569454 | |||
| 940 | Ga0495614_0164498 | |||
| 941 | Ga0495614_0433149 | |||
| 942 | Ga0496100_0697100 | |||
| 943 | Ga0496100_1147987 | |||
| 944 | Ga0496101_0195698 | |||
| 945 | Ga0496101_0260278 | |||
| 946 | Ga0496101_0291308 | |||
| 947 | Ga0496101_0551577 | |||
| 948 | Ga0496101_0782473 | |||
| 949 | Ga0496102_0163058 | |||
| 950 | Ga0496102_0213227 | |||
| 951 | Ga0496104_0027946 | |||
| 952 | Ga0496104_0048992 | |||
| 953 | Ga0496104_0181785 | |||
| 954 | Ga0496104_1510459 | |||
| 955 | Ga0496104_1829612 | |||
| 956 | Ga0496105_0077555 | |||
| 957 | Ga0496105_0337626 | |||
| 958 | Ga0496105_0603046 | |||
| 959 | Ga0496106_0010504 | |||
| 960 | Ga0496106_0037967 | |||
| 961 | Ga0496107_0055375 | |||
| 962 | Ga0496108_0013554 | |||
| 963 | Ga0496108_0028817 | |||
| 964 | Ga0496108_0338881 | |||
| 965 | Ga0496108_0346139 | |||
| 966 | Ga0496108_0494598 | |||
| 967 | Ga0496108_1024312 | |||
| 968 | Ga0496109_0004482 | |||
| 969 | Ga0496109_0163540 | |||
| 970 | Ga0496109_1493315 | |||
| 971 | Ga0496110_0002631 | |||
| 972 | Ga0496110_0005778 | |||
| 973 | Ga0496110_0006178 | |||
| 974 | Ga0496110_0053090 | |||
| 975 | Ga0496110_0503495 | |||
| 976 | Ga0496110_0503831 | |||
| 977 | Ga0496110_0727655 | |||
| 978 | Ga0496110_1454471 | |||
| 979 | Ga0496110_1862689 | |||
| 980 | Ga0496111_0003989 | |||
| 981 | Ga0496111_0010217 | |||
| 982 | Ga0496111_0020524 | |||
| 983 | Ga0496111_0030875 | |||
| 984 | Ga0496111_0110568 | |||
| 985 | Ga0496111_0398294 | |||
| 986 | Ga0496111_1063719 | |||
| 987 | Ga0496112_0044818 | |||
| 988 | Ga0496112_0178769 | |||
| 989 | Ga0496112_0411095 | |||
| 990 | Ga0496112_0617008 | |||
| 991 | Ga0496113_0023950 | |||
| 992 | Ga0496113_0337935 | |||
| 993 | Ga0496113_0499165 | |||
| 994 | Ga0496114_0003844 | |||
| 995 | Ga0496114_0051716 | |||
| 996 | Ga0496114_0113856 | |||
| 997 | Ga0496114_1471476 | |||
| 998 | Ga0496114_1670829 | |||
| 999 | Ga0496115_0775223 | |||
| 1000 | Ga0496115_0916854 | |||
| 1001 | Ga0501031_0007702 | |||
| 1002 | Ga0501031_0041570 | |||
| 1003 | Ga0501032_0998574 | |||
| 1004 | Ga0501033_0186088 | |||
| 1005 | Ga0501036_0014861 | |||
| 1006 | Ga0501036_0090315 | |||
| 1007 | Ga0501037_0075085 | |||
| 1008 | Ga0501037_0229174 | |||
| 1009 | Ga0501038_0033318 | |||
| 1010 | Ga0501038_1156170 | |||
| 1011 | Ga0501039_0023902 | |||
| 1012 | Ga0501039_0106501 | |||
| 1013 | Ga0501040_0024155 | |||
| 1014 | Ga0501040_0059323 | |||
| 1015 | Ga0501041_0004768 | |||
| 1016 | Ga0501041_0030840 | |||
| 1017 | Ga0501042_0003158 | |||
| 1018 | Ga0501042_0006842 | |||
| 1019 | Ga0501046_0115734 | |||
| 1020 | Ga0501046_0171455 | |||
| 1021 | Ga0501048_0001343 | |||
| 1022 | Ga0501048_0057763 | |||
| 1023 | Ga0501068_0054145 | |||
| 1024 | Ga0501068_0593971 | |||
| 1025 | Ga0501069_0173002 | |||
| 1026 | Ga0501069_0467825 | |||
| 1027 | Ga0501070_0169306 | |||
| 1028 | Ga0501071_0015026 | |||
| 1029 | Ga0501071_0019507 | |||
| 1030 | Ga0501072_0007598 | |||
| 1031 | Ga0501072_0051042 | |||
| 1032 | Ga0501074_0038840 | |||
| 1033 | Ga0501074_0216164 | |||
| 1034 | Ga0501075_0030435 | |||
| 1035 | Ga0501075_0126961 | |||
| 1036 | Ga0501076_0004547 | |||
| 1037 | Ga0501076_0023440 | |||
| 1038 | Ga0501076_1316234 | |||
| 1039 | Ga0501077_0001510 | |||
| 1040 | Ga0501077_0010631 | |||
| 1041 | Ga0501077_0065189 | |||
| 1042 | Ga0501079_0000542 | |||
| 1043 | Ga0501079_0021110 | |||
| 1044 | Ga0501080_0197359 | |||
| 1045 | Ga0501081_0002743 | |||
| 1046 | Ga0501081_1327706 | |||
| 1047 | Ga0501083_0093944 | |||
| 1048 | Ga0501083_0222229 | |||
| 1049 | Ga0501035_0024886 | |||
| 1050 | Ga0501035_0329241 | |||
| 1051 | Ga0501044_0483449 | |||
| 1052 | Ga0501044_0860346 | |||
| 1053 | Ga0501045_0003033 | |||
| 1054 | Ga0501045_0003453 | |||
| 1055 | nmdc:mga0yw44_260256_c1 | |||
| 1056 | nmdc:mga08y16_152971_c1 | |||
| 1057 | nmdc:mga08y16_31214_c1 | |||
| 1058 | Ga0495601_0218381 | |||
| 1059 | Ga0495612_0337453 | |||
| 1060 | Ga0495595_0053771 | |||
| 1061 | Ga0495595_0230101 | |||
| 1062 | Ga0495619_0014718 | |||
| 1063 | Ga0495619_0187341 | |||
| 1064 | Ga0495619_0284154 | |||
| 1065 | Ga0495619_0679562 | |||
| 1066 | Ga0501084_0014222 | |||
| 1067 | Ga0501084_0025799 | |||
| 1068 | Ga0501082_0002796 | |||
| 1069 | Ga0501082_0138619 | |||
| 1070 | Ga0466962_0446046 | |||
| 1071 | Ga0530510_0024826 | |||
| 1072 | Ga0530510_0064352 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vjw-assembly1.cif.gz_A | structure of oxidoreductase (nadp+(a),ferredoxin(a)) | 0.9835 | 3 | 57 |
| 1siz-assembly1.cif.gz_C | crystal structure of the [fe3s4]-ferredoxin from the hyperthermophilic archaeon pyrococcus furiosus | 0.9274 | 1 | 61 |
| 4dhv-assembly1.cif.gz_A | crystal structure of the pyrococcus furiosus ferredoxin d14c variant containing the heterometallic [agfe3s4] cluster | 0.9145 | 1 | 61 |
| 1vjw-assembly1.cif.gz_A | structure of oxidoreductase (nadp+(a),ferredoxin(a)) | 0.9031 | 3 | 57 |
| 4id8-assembly1.cif.gz_A | the crystal structure of a [3fe-4s] ferredoxin associated with cyp194a4 from r. palustris haa2 | 0.9016 | 3 | 57 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vjwA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9835 | 3 | 57 | 3.30.70.20 |
| 2xc1B01 | Mainly Beta;Beta Complex;Tailspike Protein; Chain;Phage P22 tailspike-like, N-terminal domain | 0.9526 | 57 | 68 | 2.170.14.10 |
| 1sizA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9189 | 1 | 61 | 3.30.70.20 |
| 1vjwA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9031 | 3 | 57 | 3.30.70.20 |
| af_Q5JNF3_161_221_3.30.70.20 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9025 | 3 | 57 | 3.30.70.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A5IIK8-F1-model_v4 | tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) | 0.9844 | 2 | 61 |
GO:0005506
GO:0008176 GO:0009055 GO:0043527 GO:0051536 |
| AF-P29604-F1-model_v4 | Ferredoxin | 0.9801 | 3 | 57 |
GO:0005506
GO:0009055 GO:0051538 GO:0051539 |
| AF-P46797-F1-model_v4 | Ferredoxin | 0.9776 | 3 | 61 |
GO:0005506
GO:0009055 GO:0051539 |
| AF-A0A662NM13-F1-model_v4 | deleted | 0.9775 | 3 | 53 |
|
| AF-A0A1E3G0V0-F1-model_v4 | Ferredoxin | 0.9733 | 3 | 57 |
GO:0005506
GO:0009055 GO:0051536 |