F460837

General Info

Members Datasets Scaffolds Average Seq Length
536 275 1072 67

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0552607|Ga0496109_0552607_102_344
Length 80
Sequence VLSPDLFVQQAKEETMYRIEIDRTLCSGFGACAELAPELFELDGGGTASVRIGETDDERALAAASACPMGAISVIETRAA

Samples

Sample ID Description Type Environment
1 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
82 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
83 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
150 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
151 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
152 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
153 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
154 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
155 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
156 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
157 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
160 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
161 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
162 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
167 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
168 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
169 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
176 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
177 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
191 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
192 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
193 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
194 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
210 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
211 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
224 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
251 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
254 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
257 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
258 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
262 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
266 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
274 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 11.38
Rhizosphere 88.06
Stem 0
Stem Tuber 0
Unclassified 18.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496109_0552607 3300048912 Bacteria 1086
2 Ga0070676_10191071 3300005328 Bacteria 1337
3 Ga0068869_100027660 3300005334 Bacteria 3956
4 Ga0070666_10179138 3300005335 Bacteria 1486
5 Ga0070680_100060601 3300005336 Bacteria 3096
6 Ga0070682_100248642 3300005337 Unclassified 1281
7 Ga0070682_100262497 3300005337 Bacteria 1250
8 Ga0070682_100436350 3300005337 Unclassified 999
9 Ga0068868_100197007 3300005338 Bacteria 1677
10 Ga0068868_101973233 3300005338 Bacteria 554
11 Ga0070660_100247896 3300005339 Bacteria 1452
12 Ga0070689_100002798 3300005340 Bacteria 11461
13 Ga0070691_10263844 3300005341 Bacteria 928
14 Ga0070661_100093291 3300005344 Bacteria 2231
15 Ga0070692_10122293 3300005345 Bacteria 1453
16 Ga0070668_100028062 3300005347 Bacteria 4273
17 Ga0070669_100352020 3300005353 Bacteria 1196
18 Ga0070675_100137109 3300005354 Bacteria 2088
19 Ga0070671_100007107 3300005355 Bacteria 8952
20 Ga0070671_100599029 3300005355 Unclassified 952
21 Ga0070671_101437381 3300005355 Bacteria 609
22 Ga0070674_100083389 3300005356 Bacteria 2289
23 Ga0070673_100063979 3300005364 Bacteria 2929
24 Ga0070673_101161008 3300005364 Unclassified 723
25 Ga0070688_100000664 3300005365 Bacteria 17077
26 Ga0070667_100729484 3300005367 Bacteria 918
27 Ga0070703_10171717 3300005406 Bacteria 831
28 Ga0070714_100184379 3300005435 Bacteria 1901
29 Ga0070714_100707059 3300005435 Bacteria 972
30 Ga0070713_100002923 3300005436 Bacteria 11196
31 Ga0070710_10766766 3300005437 Bacteria 686
32 Ga0070701_10003643 3300005438 Bacteria 6129
33 Ga0070711_100003985 3300005439 Bacteria 8681
34 Ga0070705_100056946 3300005440 Bacteria 2304
35 Ga0070700_100012505 3300005441 Bacteria 4741
36 Ga0070694_100389757 3300005444 Bacteria 1088
37 Ga0070663_100018558 3300005455 Bacteria 4565
38 Ga0070663_100174270 3300005455 Bacteria 1664
39 Ga0070678_100046741 3300005456 Unclassified 3106
40 Ga0070678_100051695 3300005456 Bacteria 2980
41 Ga0070678_102226926 3300005456 Bacteria 520
42 Ga0070662_100085243 3300005457 Bacteria 2361
43 Ga0070662_101750793 3300005457 Unclassified 537
44 Ga0070681_10699692 3300005458 Bacteria 929
45 Ga0068867_100002910 3300005459 Bacteria 12064
46 Ga0068867_101619595 3300005459 Bacteria 605
47 Ga0070685_10003539 3300005466 Bacteria 7931
48 Ga0070685_10649084 3300005466 Unclassified 764
49 Ga0070698_101171171 3300005471 Bacteria 718
50 Ga0070699_101491396 3300005518 Bacteria 620
51 Ga0070684_100001563 3300005535 Bacteria 16524
52 Ga0070684_100078259 3300005535 Bacteria 2921
53 Ga0070684_100109987 3300005535 Bacteria 2470
54 Ga0070684_100394571 3300005535 Unclassified 1275
55 Ga0070684_100741239 3300005535 Unclassified 917
56 Ga0068853_100070675 3300005539 Bacteria 3039
57 Ga0070672_100013015 3300005543 Bacteria 5865
58 Ga0070686_100020878 3300005544 Bacteria 3882
59 Ga0070686_101158818 3300005544 Bacteria 640
60 Ga0070686_101499182 3300005544 Unclassified 568
61 Ga0070695_100845503 3300005545 Unclassified 736
62 Ga0070695_101604527 3300005545 Bacteria 543
63 Ga0070696_100034792 3300005546 Bacteria 3467
64 Ga0070696_101192182 3300005546 Bacteria 643
65 Ga0070693_100003870 3300005547 Bacteria 7019
66 Ga0070693_100978368 3300005547 Unclassified 639
67 Ga0070704_100048401 3300005549 Bacteria 2976
68 Ga0070704_100216652 3300005549 Bacteria 1554
69 Ga0068855_100258557 3300005563 Bacteria 1940
70 Ga0070664_100253502 3300005564 Bacteria 1582
71 Ga0070664_100293531 3300005564 Unclassified 1468
72 Ga0068857_100114888 3300005577 Bacteria 2421
73 Ga0068857_100401347 3300005577 Bacteria 1276
74 Ga0068857_102028221 3300005577 Unclassified 564
75 Ga0068854_100311449 3300005578 Bacteria 1277
76 Ga0068856_100052093 3300005614 Bacteria 4035
77 Ga0068856_101102724 3300005614 Bacteria 811
78 Ga0070702_100007720 3300005615 Bacteria 5165
79 Ga0070702_101447407 3300005615 Unclassified 563
80 Ga0068852_100019358 3300005616 Bacteria 5385
81 Ga0068864_100016687 3300005618 Bacteria 6119
82 Ga0068866_10060100 3300005718 Bacteria 1969
83 Ga0068866_10563020 3300005718 Bacteria 764
84 Ga0068861_100106945 3300005719 Bacteria 2236
85 Ga0068851_10494579 3300005834 Bacteria 732
86 Ga0068870_10031644 3300005840 Bacteria 2682
87 Ga0068870_10034211 3300005840 Bacteria 2599
88 Ga0068870_10802984 3300005840 Unclassified 658
89 Ga0068870_11464997 3300005840 Bacteria 502
90 Ga0068863_100100178 3300005841 Bacteria 2754
91 Ga0068858_100011595 3300005842 Bacteria 8313
92 Ga0068860_100004450 3300005843 Bacteria 14298
93 Ga0068860_100773991 3300005843 Unclassified 972
94 Ga0068862_100027874 3300005844 Bacteria 4758
95 Ga0081455_10041893 3300005937 Bacteria 4022
96 Ga0081538_10000603 3300005981 Bacteria 39795
97 Ga0081538_10013993 3300005981 Bacteria 6314
98 Ga0081538_10082202 3300005981 Bacteria 1709
99 Ga0081538_10306524 3300005981 Unclassified 582
100 Ga0070717_11425564 3300006028 Bacteria 629
101 Ga0075365_10175498 3300006038 Unclassified 1497
102 Ga0075432_10010682 3300006058 Bacteria 3120
103 Ga0070716_100374563 3300006173 Bacteria 1016
104 Ga0070712_100035783 3300006175 Bacteria 3372
105 Ga0070712_100579904 3300006175 Bacteria 947
106 Ga0097621_100154828 3300006237 Bacteria 1967
107 Ga0068871_100059577 3300006358 Bacteria 3111
108 Ga0068871_100469709 3300006358 Unclassified 1130
109 Ga0068871_102098670 3300006358 Bacteria 538
110 Ga0068865_100003218 3300006881 Bacteria 9784
111 Ga0111539_10001881 3300009094 Bacteria 27871
112 Ga0111539_10139860 3300009094 Bacteria 2835
113 Ga0105245_10060832 3300009098 Bacteria 3402
114 Ga0105245_10159045 3300009098 Bacteria 2142
115 Ga0105243_12042540 3300009148 Unclassified 608
116 Ga0105241_10373859 3300009174 Bacteria 1243
117 Ga0105241_11572411 3300009174 Unclassified 635
118 Ga0105242_10006708 3300009176 Bacteria 8881
119 Ga0105242_10384904 3300009176 Unclassified 1305
120 Ga0105248_10152567 3300009177 Unclassified 2607
121 Ga0105238_12353553 3300009551 Bacteria 568
122 Ga0105239_10652025 3300010375 Bacteria 1202
123 Ga0105246_10048905 3300011119 Bacteria 2893
124 Ga0105246_10203361 3300011119 Unclassified 1541
125 Ga0105246_10231067 3300011119 Bacteria 1456
126 Ga0105246_12310318 3300011119 Bacteria 526
127 Ga0157343_1009382 3300012488 Bacteria 722
128 Ga0157342_1018919 3300012507 Unclassified 784
129 Ga0157338_1003251 3300012515 Bacteria 1335
130 Ga0157371_10158635 3300013102 Bacteria 1615
131 Ga0157374_10119550 3300013296 Bacteria 2541
132 Ga0157375_10043381 3300013308 Bacteria 4362
133 Ga0157375_12510601 3300013308 Unclassified 615
134 Ga0163163_10834380 3300014325 Unclassified 985
135 Ga0163163_13197210 3300014325 Unclassified 511
136 Ga0157380_11198089 3300014326 Unclassified 803
137 Ga0157377_10173219 3300014745 Bacteria 1351
138 Ga0157377_10258122 3300014745 Unclassified 1133
139 Ga0157377_11184758 3300014745 Unclassified 590
140 Ga0157379_10027441 3300014968 Bacteria 5070
141 Ga0157376_10251801 3300014969 Bacteria 1650
142 Ga0163161_10011581 3300017792 Bacteria 6121
143 Ga0207656_10045235 3300025321 Bacteria 1883
144 Ga0207642_10007229 3300025899 Bacteria 3739
145 Ga0207642_10225254 3300025899 Bacteria 1050
146 Ga0207710_10123713 3300025900 Bacteria 1237
147 Ga0207688_10007469 3300025901 Bacteria 5943
148 Ga0207647_10033219 3300025904 Bacteria 3305
149 Ga0207645_10073082 3300025907 Bacteria 2195
150 Ga0207643_10052923 3300025908 Bacteria 2306
151 Ga0207643_10053020 3300025908 Bacteria 2304
152 Ga0207707_10065149 3300025912 Bacteria 3174
153 Ga0207707_10542167 3300025912 Unclassified 989
154 Ga0207693_10044336 3300025915 Bacteria 3496
155 Ga0207693_10359232 3300025915 Bacteria 1140
156 Ga0207663_10022166 3300025916 Bacteria 3628
157 Ga0207660_10131098 3300025917 Bacteria 1908
158 Ga0207660_11192276 3300025917 Bacteria 620
159 Ga0207662_10204746 3300025918 Bacteria 1279
160 Ga0207657_10181918 3300025919 Bacteria 1699
161 Ga0207649_10268658 3300025920 Bacteria 1235
162 Ga0207649_10849992 3300025920 Bacteria 714
163 Ga0207652_10263187 3300025921 Bacteria 1556
164 Ga0207681_10451474 3300025923 Bacteria 1046
165 Ga0207694_10143862 3300025924 Bacteria 1918
166 Ga0207650_10138259 3300025925 Bacteria 1913
167 Ga0207687_10097809 3300025927 Bacteria 2154
168 Ga0207687_10112246 3300025927 Bacteria 2025
169 Ga0207687_10574899 3300025927 Unclassified 947
170 Ga0207700_10000001 3300025928 Bacteria 1122509
171 Ga0207664_10105947 3300025929 Bacteria 2331
172 Ga0207664_10221096 3300025929 Bacteria 1642
173 Ga0207664_10433603 3300025929 Bacteria 1172
174 Ga0207644_10026276 3300025931 Bacteria 4010
175 Ga0207644_10582612 3300025931 Unclassified 928
176 Ga0207644_10896167 3300025931 Unclassified 743
177 Ga0207690_10029224 3300025932 Bacteria 3502
178 Ga0207706_10085389 3300025933 Bacteria 2775
179 Ga0207686_10014208 3300025934 Bacteria 4428
180 Ga0207686_10098769 3300025934 Bacteria 1945
181 Ga0207709_10012819 3300025935 Bacteria 4623
182 Ga0207670_10029667 3300025936 Bacteria 3486
183 Ga0207670_11443266 3300025936 Bacteria 585
184 Ga0207669_10075476 3300025937 Bacteria 2136
185 Ga0207669_11799082 3300025937 Bacteria 523
186 Ga0207704_10021838 3300025938 Bacteria 3417
187 Ga0207665_10006920 3300025939 Bacteria 7502
188 Ga0207665_11452039 3300025939 Unclassified 546
189 Ga0207691_10001783 3300025940 Bacteria 21170
190 Ga0207711_10130407 3300025941 Bacteria 2253
191 Ga0207711_10188886 3300025941 Unclassified 1877
192 Ga0207711_10308691 3300025941 Bacteria 1460
193 Ga0207689_10017645 3300025942 Bacteria 6033
194 Ga0207661_10027825 3300025944 Bacteria 4323
195 Ga0207661_10040689 3300025944 Bacteria 3655
196 Ga0207661_10481869 3300025944 Bacteria 1132
197 Ga0207679_10240746 3300025945 Unclassified 1533
198 Ga0207679_10399804 3300025945 Bacteria 1208
199 Ga0207667_10904519 3300025949 Bacteria 874
200 Ga0207651_10335719 3300025960 Bacteria 1268
201 Ga0207651_10425935 3300025960 Bacteria 1134
202 Ga0207712_10086153 3300025961 Bacteria 2301
203 Ga0207712_10539687 3300025961 Unclassified 1002
204 Ga0207668_10117272 3300025972 Bacteria 2009
205 Ga0207640_10305591 3300025981 Bacteria 1260
206 Ga0207658_10063491 3300025986 Bacteria 2768
207 Ga0207677_10180219 3300026023 Bacteria 1661
208 Ga0207703_10770771 3300026035 Bacteria 917
209 Ga0207703_12079963 3300026035 Bacteria 544
210 Ga0207639_10048155 3300026041 Bacteria 3225
211 Ga0207678_10001841 3300026067 Bacteria 19446
212 Ga0207678_11718103 3300026067 Unclassified 551
213 Ga0207708_10000979 3300026075 Bacteria 21417
214 Ga0207708_10589032 3300026075 Unclassified 941
215 Ga0207702_10001437 3300026078 Bacteria 23675
216 Ga0207702_10605362 3300026078 Bacteria 1075
217 Ga0207702_11405912 3300026078 Bacteria 691
218 Ga0207641_10390669 3300026088 Bacteria 1334
219 Ga0207648_10005480 3300026089 Bacteria 12788
220 Ga0207676_10094251 3300026095 Bacteria 2466
221 Ga0207674_10043553 3300026116 Bacteria 4628
222 Ga0207674_10089988 3300026116 Bacteria 3061
223 Ga0207674_10117642 3300026116 Bacteria 2628
224 Ga0207675_100003947 3300026118 Bacteria 14395
225 Ga0207683_10004915 3300026121 Bacteria 11496
226 Ga0207683_10041233 3300026121 Bacteria 4030
227 Ga0207683_11480127 3300026121 Unclassified 627
228 Ga0207698_10157033 3300026142 Bacteria 1983
229 Ga0207428_10067174 3300027907 Bacteria 2823
230 Ga0207428_10528414 3300027907 Unclassified 855
231 Ga0268264_10185960 3300028381 Unclassified 1890
232 Ga0268264_10298699 3300028381 Bacteria 1515
233 Ga0265319_1025185 3300028563 Bacteria 2133
234 Ga0265319_1088161 3300028563 Bacteria 981
235 Ga0265318_10059685 3300028577 Unclassified 1422
236 Ga0265318_10130838 3300028577 Bacteria 923
237 Ga0265320_10562781 3300031240 Bacteria 504
238 Ga0316583_10024989 3300032133 Bacteria 2134
239 Ga0373948_0116833 3300034817 Bacteria 641
240 Ga0373950_0123875 3300034818 Bacteria 574
241 Ga0373958_0139515 3300034819 Bacteria 599
242 Ga0373944_0150595 3300035089 Bacteria 820
243 Ga0373944_0257920 3300035089 Bacteria 645
244 Ga0373952_0015399 3300035092 Bacteria 1544
245 Ga0373936_0037083 3300035113 Bacteria 1946
246 Ga0373941_0360570 3300035115 Bacteria 593
247 Ga0373945_0298380 3300035116 Bacteria 690
248 Ga0373956_0111881 3300035119 Bacteria 1271
249 Ga0373960_0148712 3300035121 Bacteria 798
250 Ga0373943_0528726 3300035170 Bacteria 691
251 Ga0373943_0664165 3300035170 Bacteria 616
252 Ga0373943_0806198 3300035170 Unclassified 559
253 Ga0373946_0159595 3300035171 Bacteria 1058
254 Ga0373946_0385790 3300035171 Bacteria 705
255 Ga0373946_0548829 3300035171 Bacteria 596
256 Ga0373955_0522200 3300035172 Bacteria 726
257 Ga0373942_0009330 3300035207 Bacteria 2295
258 Ga0373961_0014657 3300035241 Bacteria 1994
259 Ga0373962_0129832 3300035242 Unclassified 810
260 Ga0373962_0315762 3300035242 Bacteria 557
261 Ga0373924_0563161 3300035410 Unclassified 513
262 Ga0373931_0329683 3300035691 Bacteria 950
263 Ga0373931_0365237 3300035691 Unclassified 906
264 Ga0373935_0071076 3300035692 Bacteria 2245
265 Ga0373947_0079842 3300035725 Bacteria 2023
266 Ga0373947_0121901 3300035725 Bacteria 1657
267 Ga0373947_0940980 3300035725 Bacteria 590
268 Ga0373937_0435158 3300036401 Bacteria 1245
269 Ga0373937_0956197 3300036401 Bacteria 805
270 Ga0373925_0133755 3300037068 Bacteria 1936
271 Ga0373925_0398514 3300037068 Unclassified 1122
272 Ga0373925_0656047 3300037068 Bacteria 865
273 Ga0373925_0793778 3300037068 Bacteria 781
274 Ga0242420_012326 3300038996 Bacteria 1446
275 Ga0451807_0433098 3300041486 Bacteria 926
276 Ga0451847_0874677 3300041503 Bacteria 648
277 Ga0466963_0959867 3300044694 Bacteria 602
278 Ga0466971_0032692 3300044719 Bacteria 2331
279 Ga0466957_0070285 3300044842 Bacteria 2163
280 Ga0466958_0588614 3300045836 Bacteria 723
281 Ga0466967_0345180 3300045976 Bacteria 1440
282 Ga0466967_0554833 3300045976 Bacteria 1131
283 Ga0495592_0555164 3300046454 Bacteria 706
284 Ga0495603_0010811 3300046455 Bacteria 5538
285 Ga0495603_0050959 3300046455 Bacteria 2460
286 Ga0495603_0165417 3300046455 Bacteria 1282
287 Ga0495603_0196970 3300046455 Bacteria 1164
288 Ga0495603_0382353 3300046455 Bacteria 807
289 Ga0495603_0507485 3300046455 Bacteria 691
290 Ga0495629_0104298 3300046459 Bacteria 1977
291 Ga0495629_0134851 3300046459 Unclassified 1719
292 Ga0495629_0173591 3300046459 Bacteria 1495
293 Ga0495629_0211953 3300046459 Bacteria 1338
294 Ga0495629_0311709 3300046459 Archaea 1076
295 Ga0495629_0338206 3300046459 Unclassified 1028
296 Ga0495641_0049373 3300046461 Bacteria 1926
297 Ga0495641_0053615 3300046461 Unclassified 1834
298 Ga0495641_0068359 3300046461 Bacteria 1597
299 Ga0495641_0109481 3300046461 Bacteria 1233
300 Ga0495641_0161852 3300046461 Bacteria 1001
301 Ga0495641_0227110 3300046461 Bacteria 838
302 Ga0495651_0523183 3300046462 Bacteria 757
303 Ga0495653_0278003 3300046463 Bacteria 1100
304 Ga0495653_0290516 3300046463 Bacteria 1069
305 Ga0495653_0357142 3300046463 Archaea 938
306 Ga0495653_0566188 3300046463 Bacteria 702
307 Ga0495580_0356143 3300046472 Bacteria 991
308 Ga0495580_0622483 3300046472 Bacteria 712
309 Ga0495580_0749382 3300046472 Bacteria 636
310 Ga0495582_0017893 3300046473 Bacteria 3874
311 Ga0495582_0078762 3300046473 Bacteria 1828
312 Ga0495582_0342301 3300046473 Archaea 861
313 Ga0495582_0476075 3300046473 Unclassified 722
314 Ga0495582_0562625 3300046473 Bacteria 660
315 Ga0495639_0015474 3300046475 Bacteria 3308
316 Ga0495639_0274248 3300046475 Unclassified 837
317 Ga0495639_0576854 3300046475 Bacteria 577
318 Ga0495662_0505128 3300046476 Unclassified 593
319 Ga0495664_0077319 3300046477 Bacteria 1993
320 Ga0495664_0266848 3300046477 Unclassified 1035
321 Ga0495664_0442440 3300046477 Bacteria 779
322 Ga0495585_0204474 3300046492 Unclassified 1004
323 Ga0495594_0179975 3300046499 Unclassified 1203
324 Ga0495594_0232821 3300046499 Unclassified 1050
325 Ga0495594_0743762 3300046499 Bacteria 554
326 Ga0495594_0830504 3300046499 Unclassified 520
327 Ga0495594_0876150 3300046499 Unclassified 505
328 Ga0495608_0254443 3300046511 Archaea 1094
329 Ga0495618_0047528 3300046514 Bacteria 2709
330 Ga0495630_0044293 3300046517 Bacteria 3325
331 Ga0495630_0057359 3300046517 Bacteria 2918
332 Ga0495630_0075483 3300046517 Bacteria 2540
333 Ga0495630_0197225 3300046517 Unclassified 1536
334 Ga0495630_0237023 3300046517 Bacteria 1394
335 Ga0495630_0369730 3300046517 Bacteria 1098
336 Ga0495630_0859668 3300046517 Bacteria 691
337 Ga0495666_0444736 3300046526 Bacteria 581
338 Ga0495666_0546216 3300046526 Bacteria 517
339 Ga0495652_0719370 3300046529 Bacteria 670
340 Ga0495665_0011256 3300046531 Bacteria 4844
341 Ga0495665_0189218 3300046531 Bacteria 1068
342 Ga0495640_0313914 3300046533 Bacteria 972
343 Ga0495640_0564609 3300046533 Bacteria 689
344 Ga0495586_0116649 3300046535 Bacteria 1489
345 Ga0495586_0329928 3300046535 Unclassified 875
346 Ga0495587_0139542 3300046536 Bacteria 1384
347 Ga0495645_0086157 3300046543 Bacteria 2248
348 Ga0495645_0284168 3300046543 Bacteria 1087
349 Ga0495622_0198906 3300046557 Bacteria 894
350 Ga0495667_0036745 3300046559 Unclassified 3267
351 Ga0495667_0561519 3300046559 Bacteria 713
352 Ga0495635_0063374 3300046663 Unclassified 2539
353 Ga0495635_0841597 3300046663 Bacteria 590
354 Ga0495588_0019794 3300046674 Bacteria 3302
355 Ga0495588_0041731 3300046674 Unclassified 2344
356 Ga0495588_0553736 3300046674 Bacteria 603
357 Ga0495588_0731525 3300046674 Bacteria 517
358 Ga0495646_0279782 3300046680 Unclassified 887
359 Ga0495646_0551114 3300046680 Bacteria 589
360 Ga0495647_0037903 3300046681 Bacteria 1821
361 Ga0495647_0081460 3300046681 Unclassified 1313
362 Ga0495647_0106492 3300046681 Unclassified 1166
363 Ga0495658_0014445 3300046683 Bacteria 4037
364 Ga0495658_0048913 3300046683 Bacteria 2386
365 Ga0495658_0051135 3300046683 Bacteria 2340
366 Ga0495658_0086260 3300046683 Bacteria 1852
367 Ga0495658_0629085 3300046683 Bacteria 687
368 Ga0495658_1053327 3300046683 Archaea 519
369 Ga0495613_0086747 3300046689 Bacteria 2269
370 Ga0495613_0097481 3300046689 Bacteria 2125
371 Ga0495613_0137083 3300046689 Bacteria 1750
372 Ga0495613_0258903 3300046689 Bacteria 1213
373 Ga0495613_0835603 3300046689 Bacteria 599
374 Ga0495624_0008041 3300046690 Bacteria 7387
375 Ga0495624_0083901 3300046690 Bacteria 1970
376 Ga0495624_0310616 3300046690 Archaea 950
377 Ga0495624_0330365 3300046690 Bacteria 918
378 Ga0495624_0394087 3300046690 Bacteria 831
379 Ga0495600_0344365 3300046809 Bacteria 934
380 Ga0495581_0001948 3300047315 Bacteria 11567
381 Ga0495581_0004797 3300047315 Bacteria 7817
382 Ga0495581_0118714 3300047315 Unclassified 1539
383 Ga0495581_0267694 3300047315 Bacteria 999
384 Ga0495581_0363323 3300047315 Bacteria 845
385 Ga0495581_0403069 3300047315 Unclassified 798
386 Ga0495581_0637109 3300047315 Bacteria 616
387 Ga0495581_0699114 3300047315 Bacteria 585
388 Ga0495604_0191400 3300047317 Bacteria 1425
389 Ga0495604_0360800 3300047317 Bacteria 964
390 Ga0495674_0021835 3300047319 Bacteria 5914
391 Ga0495676_0006497 3300047321 Bacteria 10775
392 Ga0495676_0021962 3300047321 Bacteria 5562
393 Ga0495676_0076755 3300047321 Unclassified 2550
394 Ga0495676_0366465 3300047321 Bacteria 961
395 Ga0495676_0370441 3300047321 Bacteria 954
396 Ga0495676_0689171 3300047321 Bacteria 661
397 Ga0495676_0993908 3300047321 Bacteria 535
398 Ga0495676_1122276 3300047321 Bacteria 500
399 Ga0495680_0017526 3300047322 Bacteria 6111
400 Ga0495680_0302578 3300047322 Bacteria 1122
401 Ga0495680_0930949 3300047322 Bacteria 559
402 Ga0495684_0358656 3300047471 Unclassified 1033
403 Ga0495602_0569454 3300048088 Bacteria 783
404 Ga0495614_0164498 3300048089 Archaea 994
405 Ga0495614_0433149 3300048089 Bacteria 621
406 Ga0496100_0697100 3300048903 Unclassified 792
407 Ga0496100_1147987 3300048903 Bacteria 612
408 Ga0496101_0195698 3300048904 Bacteria 1562
409 Ga0496101_0260278 3300048904 Bacteria 1353
410 Ga0496101_0291308 3300048904 Unclassified 1277
411 Ga0496101_0551577 3300048904 Bacteria 911
412 Ga0496101_0782473 3300048904 Bacteria 753
413 Ga0496102_0163058 3300048905 Unclassified 2097
414 Ga0496102_0213227 3300048905 Bacteria 1820
415 Ga0496104_0027946 3300048907 Bacteria 5224
416 Ga0496104_0048992 3300048907 Bacteria 3984
417 Ga0496104_0181785 3300048907 Bacteria 2013
418 Ga0496104_1510459 3300048907 Unclassified 575
419 Ga0496104_1829612 3300048907 Unclassified 509
420 Ga0496105_0077555 3300048908 Unclassified 2744
421 Ga0496105_0337626 3300048908 Unclassified 1205
422 Ga0496105_0603046 3300048908 Bacteria 852
423 Ga0496106_0010504 3300048909 Bacteria 6839
424 Ga0496106_0037967 3300048909 Bacteria 3604
425 Ga0496107_0055375 3300048910 Bacteria 2864
426 Ga0496108_0013554 3300048911 Bacteria 6653
427 Ga0496108_0028817 3300048911 Bacteria 4595
428 Ga0496108_0338881 3300048911 Bacteria 1312
429 Ga0496108_0346139 3300048911 Bacteria 1297
430 Ga0496108_0494598 3300048911 Bacteria 1068
431 Ga0496108_1024312 3300048911 Unclassified 704
432 Ga0496109_0004482 3300048912 Bacteria 11668
433 Ga0496109_0163540 3300048912 Bacteria 2085
434 Ga0496109_1493315 3300048912 Bacteria 611
435 Ga0496110_0002631 3300048913 Bacteria 13521
436 Ga0496110_0005778 3300048913 Bacteria 9723
437 Ga0496110_0006178 3300048913 Bacteria 9452
438 Ga0496110_0053090 3300048913 Bacteria 3562
439 Ga0496110_0503495 3300048913 Bacteria 1103
440 Ga0496110_0503831 3300048913 Unclassified 1102
441 Ga0496110_0727655 3300048913 Unclassified 895
442 Ga0496110_1454471 3300048913 Bacteria 595
443 Ga0496110_1862689 3300048913 Bacteria 512
444 Ga0496111_0003989 3300048914 Bacteria 9266
445 Ga0496111_0010217 3300048914 Bacteria 6290
446 Ga0496111_0020524 3300048914 Bacteria 4601
447 Ga0496111_0030875 3300048914 Bacteria 3812
448 Ga0496111_0110568 3300048914 Bacteria 2024
449 Ga0496111_0398294 3300048914 Bacteria 1017
450 Ga0496111_1063719 3300048914 Bacteria 578
451 Ga0496112_0044818 3300048915 Bacteria 4335
452 Ga0496112_0178769 3300048915 Bacteria 2085
453 Ga0496112_0411095 3300048915 Bacteria 1292
454 Ga0496112_0617008 3300048915 Bacteria 1016
455 Ga0496113_0023950 3300048916 Bacteria 4334
456 Ga0496113_0337935 3300048916 Unclassified 1208
457 Ga0496113_0499165 3300048916 Bacteria 977
458 Ga0496114_0003844 3300048917 Bacteria 11582
459 Ga0496114_0051716 3300048917 Bacteria 3421
460 Ga0496114_0113856 3300048917 Unclassified 2319
461 Ga0496114_1471476 3300048917 Bacteria 569
462 Ga0496114_1670829 3300048917 Bacteria 525
463 Ga0496115_0775223 3300048918 Unclassified 748
464 Ga0496115_0916854 3300048918 Bacteria 675
465 Ga0501031_0007702 3300049568 Bacteria 7011
466 Ga0501031_0041570 3300049568 Bacteria 3001
467 Ga0501032_0998574 3300049569 Archaea 526
468 Ga0501033_0186088 3300049570 Unclassified 1488
469 Ga0501036_0014861 3300049572 Bacteria 6495
470 Ga0501036_0090315 3300049572 Bacteria 2588
471 Ga0501037_0075085 3300049573 Bacteria 2456
472 Ga0501037_0229174 3300049573 Unclassified 1305
473 Ga0501038_0033318 3300049574 Bacteria 4539
474 Ga0501038_1156170 3300049574 Archaea 563
475 Ga0501039_0023902 3300049575 Bacteria 4691
476 Ga0501039_0106501 3300049575 Bacteria 2190
477 Ga0501040_0024155 3300049576 Bacteria 4078
478 Ga0501040_0059323 3300049576 Unclassified 2629
479 Ga0501041_0004768 3300049577 Bacteria 7873
480 Ga0501041_0030840 3300049577 Bacteria 3236
481 Ga0501042_0003158 3300049578 Bacteria 10271
482 Ga0501042_0006842 3300049578 Bacteria 7440
483 Ga0501046_0115734 3300049580 Bacteria 2045
484 Ga0501046_0171455 3300049580 Bacteria 1628
485 Ga0501048_0001343 3300049582 Bacteria 18645
486 Ga0501048_0057763 3300049582 Bacteria 2751
487 Ga0501068_0054145 3300049584 Bacteria 2431
488 Ga0501068_0593971 3300049584 Unclassified 721
489 Ga0501069_0173002 3300049585 Unclassified 1246
490 Ga0501069_0467825 3300049585 Archaea 750
491 Ga0501070_0169306 3300049586 Bacteria 1800
492 Ga0501071_0015026 3300049587 Bacteria 5307
493 Ga0501071_0019507 3300049587 Bacteria 4705
494 Ga0501072_0007598 3300049588 Bacteria 8225
495 Ga0501072_0051042 3300049588 Bacteria 3257
496 Ga0501074_0038840 3300049590 Bacteria 3448
497 Ga0501074_0216164 3300049590 Unclassified 1365
498 Ga0501075_0030435 3300049591 Bacteria 3998
499 Ga0501075_0126961 3300049591 Bacteria 1942
500 Ga0501076_0004547 3300049592 Bacteria 9881
501 Ga0501076_0023440 3300049592 Bacteria 4758
502 Ga0501076_1316234 3300049592 Bacteria 594
503 Ga0501077_0001510 3300049593 Bacteria 14036
504 Ga0501077_0010631 3300049593 Bacteria 5731
505 Ga0501077_0065189 3300049593 Bacteria 2310
506 Ga0501079_0000542 3300049741 Bacteria 24598
507 Ga0501079_0021110 3300049741 Bacteria 4978
508 Ga0501080_0197359 3300049742 Bacteria 1848
509 Ga0501081_0002743 3300049743 Bacteria 11160
510 Ga0501081_1327706 3300049743 Unclassified 545
511 Ga0501083_0093944 3300049744 Bacteria 1980
512 Ga0501083_0222229 3300049744 Unclassified 1230
513 Ga0501035_0024886 3300049822 Bacteria 5490
514 Ga0501035_0329241 3300049822 Unclassified 1282
515 Ga0501044_0483449 3300049823 Bacteria 1141
516 Ga0501044_0860346 3300049823 Unclassified 783
517 Ga0501045_0003033 3300049824 Bacteria 11481
518 Ga0501045_0003453 3300049824 Bacteria 10816
519 nmdc:mga0yw44_260256_c1 3300050492 Unclassified 1156
520 nmdc:mga08y16_152971_c1 3300050511 Bacteria 2398
521 nmdc:mga08y16_31214_c1 3300050511 Bacteria 5606
522 Ga0495601_0218381 3300053077 Unclassified 1245
523 Ga0495612_0337453 3300053078 Bacteria 679
524 Ga0495595_0053771 3300053084 Bacteria 1871
525 Ga0495595_0230101 3300053084 Bacteria 926
526 Ga0495619_0014718 3300053085 Bacteria 4941
527 Ga0495619_0187341 3300053085 Archaea 1432
528 Ga0495619_0284154 3300053085 Bacteria 1146
529 Ga0495619_0679562 3300053085 Bacteria 701
530 Ga0501084_0014222 3300054114 Bacteria 6590
531 Ga0501084_0025799 3300054114 Bacteria 4901
532 Ga0501082_0002796 3300060353 Bacteria 15224
533 Ga0501082_0138619 3300060353 Bacteria 2111
534 Ga0466962_0446046 3300061719 Bacteria 651
535 Ga0530510_0024826 3300061734 Bacteria 4282
536 Ga0530510_0064352 3300061734 Bacteria 2656
537 Ga0496109_0552607
538 Ga0070676_10191071
539 Ga0068869_100027660
540 Ga0070666_10179138
541 Ga0070680_100060601
542 Ga0070682_100248642
543 Ga0070682_100262497
544 Ga0070682_100436350
545 Ga0068868_100197007
546 Ga0068868_101973233
547 Ga0070660_100247896
548 Ga0070689_100002798
549 Ga0070691_10263844
550 Ga0070661_100093291
551 Ga0070692_10122293
552 Ga0070668_100028062
553 Ga0070669_100352020
554 Ga0070675_100137109
555 Ga0070671_100007107
556 Ga0070671_100599029
557 Ga0070671_101437381
558 Ga0070674_100083389
559 Ga0070673_100063979
560 Ga0070673_101161008
561 Ga0070688_100000664
562 Ga0070667_100729484
563 Ga0070703_10171717
564 Ga0070714_100184379
565 Ga0070714_100707059
566 Ga0070713_100002923
567 Ga0070710_10766766
568 Ga0070701_10003643
569 Ga0070711_100003985
570 Ga0070705_100056946
571 Ga0070700_100012505
572 Ga0070694_100389757
573 Ga0070663_100018558
574 Ga0070663_100174270
575 Ga0070678_100046741
576 Ga0070678_100051695
577 Ga0070678_102226926
578 Ga0070662_100085243
579 Ga0070662_101750793
580 Ga0070681_10699692
581 Ga0068867_100002910
582 Ga0068867_101619595
583 Ga0070685_10003539
584 Ga0070685_10649084
585 Ga0070698_101171171
586 Ga0070699_101491396
587 Ga0070684_100001563
588 Ga0070684_100078259
589 Ga0070684_100109987
590 Ga0070684_100394571
591 Ga0070684_100741239
592 Ga0068853_100070675
593 Ga0070672_100013015
594 Ga0070686_100020878
595 Ga0070686_101158818
596 Ga0070686_101499182
597 Ga0070695_100845503
598 Ga0070695_101604527
599 Ga0070696_100034792
600 Ga0070696_101192182
601 Ga0070693_100003870
602 Ga0070693_100978368
603 Ga0070704_100048401
604 Ga0070704_100216652
605 Ga0068855_100258557
606 Ga0070664_100253502
607 Ga0070664_100293531
608 Ga0068857_100114888
609 Ga0068857_100401347
610 Ga0068857_102028221
611 Ga0068854_100311449
612 Ga0068856_100052093
613 Ga0068856_101102724
614 Ga0070702_100007720
615 Ga0070702_101447407
616 Ga0068852_100019358
617 Ga0068864_100016687
618 Ga0068866_10060100
619 Ga0068866_10563020
620 Ga0068861_100106945
621 Ga0068851_10494579
622 Ga0068870_10031644
623 Ga0068870_10034211
624 Ga0068870_10802984
625 Ga0068870_11464997
626 Ga0068863_100100178
627 Ga0068858_100011595
628 Ga0068860_100004450
629 Ga0068860_100773991
630 Ga0068862_100027874
631 Ga0081455_10041893
632 Ga0081538_10000603
633 Ga0081538_10013993
634 Ga0081538_10082202
635 Ga0081538_10306524
636 Ga0070717_11425564
637 Ga0075365_10175498
638 Ga0075432_10010682
639 Ga0070716_100374563
640 Ga0070712_100035783
641 Ga0070712_100579904
642 Ga0097621_100154828
643 Ga0068871_100059577
644 Ga0068871_100469709
645 Ga0068871_102098670
646 Ga0068865_100003218
647 Ga0111539_10001881
648 Ga0111539_10139860
649 Ga0105245_10060832
650 Ga0105245_10159045
651 Ga0105243_12042540
652 Ga0105241_10373859
653 Ga0105241_11572411
654 Ga0105242_10006708
655 Ga0105242_10384904
656 Ga0105248_10152567
657 Ga0105238_12353553
658 Ga0105239_10652025
659 Ga0105246_10048905
660 Ga0105246_10203361
661 Ga0105246_10231067
662 Ga0105246_12310318
663 Ga0157343_1009382
664 Ga0157342_1018919
665 Ga0157338_1003251
666 Ga0157371_10158635
667 Ga0157374_10119550
668 Ga0157375_10043381
669 Ga0157375_12510601
670 Ga0163163_10834380
671 Ga0163163_13197210
672 Ga0157380_11198089
673 Ga0157377_10173219
674 Ga0157377_10258122
675 Ga0157377_11184758
676 Ga0157379_10027441
677 Ga0157376_10251801
678 Ga0163161_10011581
679 Ga0207656_10045235
680 Ga0207642_10007229
681 Ga0207642_10225254
682 Ga0207710_10123713
683 Ga0207688_10007469
684 Ga0207647_10033219
685 Ga0207645_10073082
686 Ga0207643_10052923
687 Ga0207643_10053020
688 Ga0207707_10065149
689 Ga0207707_10542167
690 Ga0207693_10044336
691 Ga0207693_10359232
692 Ga0207663_10022166
693 Ga0207660_10131098
694 Ga0207660_11192276
695 Ga0207662_10204746
696 Ga0207657_10181918
697 Ga0207649_10268658
698 Ga0207649_10849992
699 Ga0207652_10263187
700 Ga0207681_10451474
701 Ga0207694_10143862
702 Ga0207650_10138259
703 Ga0207687_10097809
704 Ga0207687_10112246
705 Ga0207687_10574899
706 Ga0207700_10000001
707 Ga0207664_10105947
708 Ga0207664_10221096
709 Ga0207664_10433603
710 Ga0207644_10026276
711 Ga0207644_10582612
712 Ga0207644_10896167
713 Ga0207690_10029224
714 Ga0207706_10085389
715 Ga0207686_10014208
716 Ga0207686_10098769
717 Ga0207709_10012819
718 Ga0207670_10029667
719 Ga0207670_11443266
720 Ga0207669_10075476
721 Ga0207669_11799082
722 Ga0207704_10021838
723 Ga0207665_10006920
724 Ga0207665_11452039
725 Ga0207691_10001783
726 Ga0207711_10130407
727 Ga0207711_10188886
728 Ga0207711_10308691
729 Ga0207689_10017645
730 Ga0207661_10027825
731 Ga0207661_10040689
732 Ga0207661_10481869
733 Ga0207679_10240746
734 Ga0207679_10399804
735 Ga0207667_10904519
736 Ga0207651_10335719
737 Ga0207651_10425935
738 Ga0207712_10086153
739 Ga0207712_10539687
740 Ga0207668_10117272
741 Ga0207640_10305591
742 Ga0207658_10063491
743 Ga0207677_10180219
744 Ga0207703_10770771
745 Ga0207703_12079963
746 Ga0207639_10048155
747 Ga0207678_10001841
748 Ga0207678_11718103
749 Ga0207708_10000979
750 Ga0207708_10589032
751 Ga0207702_10001437
752 Ga0207702_10605362
753 Ga0207702_11405912
754 Ga0207641_10390669
755 Ga0207648_10005480
756 Ga0207676_10094251
757 Ga0207674_10043553
758 Ga0207674_10089988
759 Ga0207674_10117642
760 Ga0207675_100003947
761 Ga0207683_10004915
762 Ga0207683_10041233
763 Ga0207683_11480127
764 Ga0207698_10157033
765 Ga0207428_10067174
766 Ga0207428_10528414
767 Ga0268264_10185960
768 Ga0268264_10298699
769 Ga0265319_1025185
770 Ga0265319_1088161
771 Ga0265318_10059685
772 Ga0265318_10130838
773 Ga0265320_10562781
774 Ga0316583_10024989
775 Ga0373948_0116833
776 Ga0373950_0123875
777 Ga0373958_0139515
778 Ga0373944_0150595
779 Ga0373944_0257920
780 Ga0373952_0015399
781 Ga0373936_0037083
782 Ga0373941_0360570
783 Ga0373945_0298380
784 Ga0373956_0111881
785 Ga0373960_0148712
786 Ga0373943_0528726
787 Ga0373943_0664165
788 Ga0373943_0806198
789 Ga0373946_0159595
790 Ga0373946_0385790
791 Ga0373946_0548829
792 Ga0373955_0522200
793 Ga0373942_0009330
794 Ga0373961_0014657
795 Ga0373962_0129832
796 Ga0373962_0315762
797 Ga0373924_0563161
798 Ga0373931_0329683
799 Ga0373931_0365237
800 Ga0373935_0071076
801 Ga0373947_0079842
802 Ga0373947_0121901
803 Ga0373947_0940980
804 Ga0373937_0435158
805 Ga0373937_0956197
806 Ga0373925_0133755
807 Ga0373925_0398514
808 Ga0373925_0656047
809 Ga0373925_0793778
810 Ga0242420_012326
811 Ga0451807_0433098
812 Ga0451847_0874677
813 Ga0466963_0959867
814 Ga0466971_0032692
815 Ga0466957_0070285
816 Ga0466958_0588614
817 Ga0466967_0345180
818 Ga0466967_0554833
819 Ga0495592_0555164
820 Ga0495603_0010811
821 Ga0495603_0050959
822 Ga0495603_0165417
823 Ga0495603_0196970
824 Ga0495603_0382353
825 Ga0495603_0507485
826 Ga0495629_0104298
827 Ga0495629_0134851
828 Ga0495629_0173591
829 Ga0495629_0211953
830 Ga0495629_0311709
831 Ga0495629_0338206
832 Ga0495641_0049373
833 Ga0495641_0053615
834 Ga0495641_0068359
835 Ga0495641_0109481
836 Ga0495641_0161852
837 Ga0495641_0227110
838 Ga0495651_0523183
839 Ga0495653_0278003
840 Ga0495653_0290516
841 Ga0495653_0357142
842 Ga0495653_0566188
843 Ga0495580_0356143
844 Ga0495580_0622483
845 Ga0495580_0749382
846 Ga0495582_0017893
847 Ga0495582_0078762
848 Ga0495582_0342301
849 Ga0495582_0476075
850 Ga0495582_0562625
851 Ga0495639_0015474
852 Ga0495639_0274248
853 Ga0495639_0576854
854 Ga0495662_0505128
855 Ga0495664_0077319
856 Ga0495664_0266848
857 Ga0495664_0442440
858 Ga0495585_0204474
859 Ga0495594_0179975
860 Ga0495594_0232821
861 Ga0495594_0743762
862 Ga0495594_0830504
863 Ga0495594_0876150
864 Ga0495608_0254443
865 Ga0495618_0047528
866 Ga0495630_0044293
867 Ga0495630_0057359
868 Ga0495630_0075483
869 Ga0495630_0197225
870 Ga0495630_0237023
871 Ga0495630_0369730
872 Ga0495630_0859668
873 Ga0495666_0444736
874 Ga0495666_0546216
875 Ga0495652_0719370
876 Ga0495665_0011256
877 Ga0495665_0189218
878 Ga0495640_0313914
879 Ga0495640_0564609
880 Ga0495586_0116649
881 Ga0495586_0329928
882 Ga0495587_0139542
883 Ga0495645_0086157
884 Ga0495645_0284168
885 Ga0495622_0198906
886 Ga0495667_0036745
887 Ga0495667_0561519
888 Ga0495635_0063374
889 Ga0495635_0841597
890 Ga0495588_0019794
891 Ga0495588_0041731
892 Ga0495588_0553736
893 Ga0495588_0731525
894 Ga0495646_0279782
895 Ga0495646_0551114
896 Ga0495647_0037903
897 Ga0495647_0081460
898 Ga0495647_0106492
899 Ga0495658_0014445
900 Ga0495658_0048913
901 Ga0495658_0051135
902 Ga0495658_0086260
903 Ga0495658_0629085
904 Ga0495658_1053327
905 Ga0495613_0086747
906 Ga0495613_0097481
907 Ga0495613_0137083
908 Ga0495613_0258903
909 Ga0495613_0835603
910 Ga0495624_0008041
911 Ga0495624_0083901
912 Ga0495624_0310616
913 Ga0495624_0330365
914 Ga0495624_0394087
915 Ga0495600_0344365
916 Ga0495581_0001948
917 Ga0495581_0004797
918 Ga0495581_0118714
919 Ga0495581_0267694
920 Ga0495581_0363323
921 Ga0495581_0403069
922 Ga0495581_0637109
923 Ga0495581_0699114
924 Ga0495604_0191400
925 Ga0495604_0360800
926 Ga0495674_0021835
927 Ga0495676_0006497
928 Ga0495676_0021962
929 Ga0495676_0076755
930 Ga0495676_0366465
931 Ga0495676_0370441
932 Ga0495676_0689171
933 Ga0495676_0993908
934 Ga0495676_1122276
935 Ga0495680_0017526
936 Ga0495680_0302578
937 Ga0495680_0930949
938 Ga0495684_0358656
939 Ga0495602_0569454
940 Ga0495614_0164498
941 Ga0495614_0433149
942 Ga0496100_0697100
943 Ga0496100_1147987
944 Ga0496101_0195698
945 Ga0496101_0260278
946 Ga0496101_0291308
947 Ga0496101_0551577
948 Ga0496101_0782473
949 Ga0496102_0163058
950 Ga0496102_0213227
951 Ga0496104_0027946
952 Ga0496104_0048992
953 Ga0496104_0181785
954 Ga0496104_1510459
955 Ga0496104_1829612
956 Ga0496105_0077555
957 Ga0496105_0337626
958 Ga0496105_0603046
959 Ga0496106_0010504
960 Ga0496106_0037967
961 Ga0496107_0055375
962 Ga0496108_0013554
963 Ga0496108_0028817
964 Ga0496108_0338881
965 Ga0496108_0346139
966 Ga0496108_0494598
967 Ga0496108_1024312
968 Ga0496109_0004482
969 Ga0496109_0163540
970 Ga0496109_1493315
971 Ga0496110_0002631
972 Ga0496110_0005778
973 Ga0496110_0006178
974 Ga0496110_0053090
975 Ga0496110_0503495
976 Ga0496110_0503831
977 Ga0496110_0727655
978 Ga0496110_1454471
979 Ga0496110_1862689
980 Ga0496111_0003989
981 Ga0496111_0010217
982 Ga0496111_0020524
983 Ga0496111_0030875
984 Ga0496111_0110568
985 Ga0496111_0398294
986 Ga0496111_1063719
987 Ga0496112_0044818
988 Ga0496112_0178769
989 Ga0496112_0411095
990 Ga0496112_0617008
991 Ga0496113_0023950
992 Ga0496113_0337935
993 Ga0496113_0499165
994 Ga0496114_0003844
995 Ga0496114_0051716
996 Ga0496114_0113856
997 Ga0496114_1471476
998 Ga0496114_1670829
999 Ga0496115_0775223
1000 Ga0496115_0916854
1001 Ga0501031_0007702
1002 Ga0501031_0041570
1003 Ga0501032_0998574
1004 Ga0501033_0186088
1005 Ga0501036_0014861
1006 Ga0501036_0090315
1007 Ga0501037_0075085
1008 Ga0501037_0229174
1009 Ga0501038_0033318
1010 Ga0501038_1156170
1011 Ga0501039_0023902
1012 Ga0501039_0106501
1013 Ga0501040_0024155
1014 Ga0501040_0059323
1015 Ga0501041_0004768
1016 Ga0501041_0030840
1017 Ga0501042_0003158
1018 Ga0501042_0006842
1019 Ga0501046_0115734
1020 Ga0501046_0171455
1021 Ga0501048_0001343
1022 Ga0501048_0057763
1023 Ga0501068_0054145
1024 Ga0501068_0593971
1025 Ga0501069_0173002
1026 Ga0501069_0467825
1027 Ga0501070_0169306
1028 Ga0501071_0015026
1029 Ga0501071_0019507
1030 Ga0501072_0007598
1031 Ga0501072_0051042
1032 Ga0501074_0038840
1033 Ga0501074_0216164
1034 Ga0501075_0030435
1035 Ga0501075_0126961
1036 Ga0501076_0004547
1037 Ga0501076_0023440
1038 Ga0501076_1316234
1039 Ga0501077_0001510
1040 Ga0501077_0010631
1041 Ga0501077_0065189
1042 Ga0501079_0000542
1043 Ga0501079_0021110
1044 Ga0501080_0197359
1045 Ga0501081_0002743
1046 Ga0501081_1327706
1047 Ga0501083_0093944
1048 Ga0501083_0222229
1049 Ga0501035_0024886
1050 Ga0501035_0329241
1051 Ga0501044_0483449
1052 Ga0501044_0860346
1053 Ga0501045_0003033
1054 Ga0501045_0003453
1055 nmdc:mga0yw44_260256_c1
1056 nmdc:mga08y16_152971_c1
1057 nmdc:mga08y16_31214_c1
1058 Ga0495601_0218381
1059 Ga0495612_0337453
1060 Ga0495595_0053771
1061 Ga0495595_0230101
1062 Ga0495619_0014718
1063 Ga0495619_0187341
1064 Ga0495619_0284154
1065 Ga0495619_0679562
1066 Ga0501084_0014222
1067 Ga0501084_0025799
1068 Ga0501082_0002796
1069 Ga0501082_0138619
1070 Ga0466962_0446046
1071 Ga0530510_0024826
1072 Ga0530510_0064352

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13459

Fer4_15

4Fe-4S single cluster domain

19

74

0.96

PF06902

Fer4_19

Divergent 4Fe-4S mono-cluster

12

77

0.89

PF13370

Fer4_13

4Fe-4S single cluster domain of Ferredoxin I

21

74

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vjw-assembly1.cif.gz_A structure of oxidoreductase (nadp+(a),ferredoxin(a)) 0.9835 3 57
1siz-assembly1.cif.gz_C crystal structure of the [fe3s4]-ferredoxin from the hyperthermophilic archaeon pyrococcus furiosus 0.9274 1 61
4dhv-assembly1.cif.gz_A crystal structure of the pyrococcus furiosus ferredoxin d14c variant containing the heterometallic [agfe3s4] cluster 0.9145 1 61
1vjw-assembly1.cif.gz_A structure of oxidoreductase (nadp+(a),ferredoxin(a)) 0.9031 3 57
4id8-assembly1.cif.gz_A the crystal structure of a [3fe-4s] ferredoxin associated with cyp194a4 from r. palustris haa2 0.9016 3 57
ID Description Score Start End Superfamily
1vjwA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9835 3 57 3.30.70.20
2xc1B01 Mainly Beta;Beta Complex;Tailspike Protein; Chain;Phage P22 tailspike-like, N-terminal domain 0.9526 57 68 2.170.14.10
1sizA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9189 1 61 3.30.70.20
1vjwA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9031 3 57 3.30.70.20
af_Q5JNF3_161_221_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9025 3 57 3.30.70.20
ID Description Score Start End GO Terms
AF-A5IIK8-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.9844 2 61 GO:0005506
GO:0008176
GO:0009055
GO:0043527
GO:0051536
AF-P29604-F1-model_v4 Ferredoxin 0.9801 3 57 GO:0005506
GO:0009055
GO:0051538
GO:0051539
AF-P46797-F1-model_v4 Ferredoxin 0.9776 3 61 GO:0005506
GO:0009055
GO:0051539
AF-A0A662NM13-F1-model_v4 deleted 0.9775 3 53
AF-A0A1E3G0V0-F1-model_v4 Ferredoxin 0.9733 3 57 GO:0005506
GO:0009055
GO:0051536

Map