F460814

General Info

Members Datasets Scaffolds Average Seq Length
536 237 1072 202

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0007357|Ga0373937_0007357_6991_7743
Length 250
Sequence MVESELGSTETAALRSTSNLANCRFHSCKPASREELESEHHISHQEQTMATTLDSIRPAAEYAEMACRPLETEQCALVVIDIQEKLLPPIFQKDQLVRNAQLLIRAAAILKIPALVSTQYAKGLGGTVPEIASLLSGTEAIDKTLFSCFGSDVFCSVLKRLPGKRNTLLLCGMESHICVTQTALGALREGYLVHVASDAVSSRAEWNWKIGLERMRAAGAVISSTEMMIYELMRSSSSAAFKELLPHLKG

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
99 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
100 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
165 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
166 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
167 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
174 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
175 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
179 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
186 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
210 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
232 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
233 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 1.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.92
Rhizosphere 95.9
Stem 0
Stem Tuber 0
Unclassified 16.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0007357 3300036401 Bacteria 9534
2 LJNas_1000474 3300000546 Bacteria 7035
3 Ga0065715_10010469 3300005293 Bacteria 2346
4 Ga0070676_10003528 3300005328 Bacteria 8177
5 Ga0070683_100002104 3300005329 Bacteria 15726
6 Ga0070683_100121717 3300005329 Bacteria 2465
7 Ga0070683_100148927 3300005329 Bacteria 2219
8 Ga0070690_100487178 3300005330 Unclassified 920
9 Ga0070670_100103334 3300005331 Bacteria 2454
10 Ga0070670_100371602 3300005331 Bacteria 1259
11 Ga0070680_100023034 3300005336 Bacteria 4964
12 Ga0070680_100924278 3300005336 Bacteria 753
13 Ga0070682_100016816 3300005337 Bacteria 4257
14 Ga0068868_100003214 3300005338 Bacteria 11378
15 Ga0068868_100134076 3300005338 Bacteria 2029
16 Ga0068868_100215129 3300005338 Bacteria 1607
17 Ga0068868_100536271 3300005338 Unclassified 1029
18 Ga0070660_100008486 3300005339 Bacteria 7190
19 Ga0070660_100356529 3300005339 Bacteria 1205
20 Ga0070689_100024067 3300005340 Bacteria 4566
21 Ga0070689_100638268 3300005340 Unclassified 925
22 Ga0070661_100003118 3300005344 Bacteria 11405
23 Ga0070661_100116836 3300005344 Bacteria 1995
24 Ga0070661_100179349 3300005344 Bacteria 1611
25 Ga0070661_100961037 3300005344 Unclassified 707
26 Ga0070692_10312691 3300005345 Bacteria 963
27 Ga0070669_100012221 3300005353 Bacteria 6094
28 Ga0070675_100016254 3300005354 Bacteria 5904
29 Ga0070674_100161173 3300005356 Bacteria 1702
30 Ga0070673_100006285 3300005364 Bacteria 7707
31 Ga0070673_100331640 3300005364 Bacteria 1346
32 Ga0070659_100002365 3300005366 Bacteria 13399
33 Ga0070667_100219917 3300005367 Bacteria 1690
34 Ga0070709_10002369 3300005434 Bacteria 10198
35 Ga0070709_10005429 3300005434 Bacteria 6907
36 Ga0070709_10415785 3300005434 Bacteria 1007
37 Ga0070709_10433106 3300005434 Bacteria 988
38 Ga0070714_100000060 3300005435 Bacteria 100913
39 Ga0070714_100002486 3300005435 Bacteria 13602
40 Ga0070714_100093376 3300005435 Bacteria 2639
41 Ga0070714_100139606 3300005435 Unclassified 2173
42 Ga0070714_100349352 3300005435 Bacteria 1389
43 Ga0070714_100381774 3300005435 Bacteria 1328
44 Ga0070713_100000287 3300005436 Bacteria 33358
45 Ga0070713_100001637 3300005436 Bacteria 14372
46 Ga0070713_100009314 3300005436 Bacteria 7020
47 Ga0070713_100029238 3300005436 Bacteria 4362
48 Ga0070713_100049770 3300005436 Bacteria 3458
49 Ga0070713_100199421 3300005436 Bacteria 1807
50 Ga0070713_100685643 3300005436 Bacteria 978
51 Ga0070713_100877376 3300005436 Bacteria 862
52 Ga0070710_10001682 3300005437 Bacteria 10423
53 Ga0070710_10006776 3300005437 Bacteria 5523
54 Ga0070710_10012710 3300005437 Bacteria 4189
55 Ga0070710_10021384 3300005437 Unclassified 3371
56 Ga0070711_100001303 3300005439 Bacteria 13567
57 Ga0070711_100027842 3300005439 Bacteria 3714
58 Ga0070711_100056045 3300005439 Bacteria 2724
59 Ga0070711_100067994 3300005439 Bacteria 2502
60 Ga0070711_100138031 3300005439 Bacteria 1825
61 Ga0070711_100201286 3300005439 Unclassified 1537
62 Ga0070711_100607677 3300005439 Bacteria 913
63 Ga0070711_100814357 3300005439 Unclassified 793
64 Ga0070708_100004964 3300005445 Bacteria 10514
65 Ga0070708_100011926 3300005445 Bacteria 7081
66 Ga0070708_100012657 3300005445 Bacteria 6889
67 Ga0070708_100035795 3300005445 Bacteria 4327
68 Ga0070708_100059975 3300005445 Bacteria 3394
69 Ga0070708_100712408 3300005445 Bacteria 944
70 Ga0070708_100845693 3300005445 Bacteria 860
71 Ga0070663_100018431 3300005455 Bacteria 4577
72 Ga0070662_100008716 3300005457 Bacteria 6613
73 Ga0070681_10026270 3300005458 Bacteria 5853
74 Ga0070681_10055518 3300005458 Bacteria 3943
75 Ga0070681_10147223 3300005458 Bacteria 2283
76 Ga0068867_100002480 3300005459 Bacteria 12965
77 Ga0068867_100172218 3300005459 Bacteria 1715
78 Ga0070685_10006841 3300005466 Bacteria 5822
79 Ga0070706_100029882 3300005467 Bacteria 5019
80 Ga0070706_100631424 3300005467 Bacteria 995
81 Ga0070707_100012693 3300005468 Bacteria 7866
82 Ga0070707_100012960 3300005468 Bacteria 7792
83 Ga0070707_100036762 3300005468 Bacteria 4673
84 Ga0070707_100095127 3300005468 Bacteria 2885
85 Ga0070698_100001177 3300005471 Bacteria 29030
86 Ga0070698_100037640 3300005471 Bacteria 4987
87 Ga0070698_100214716 3300005471 Unclassified 1858
88 Ga0070698_100550146 3300005471 Bacteria 1094
89 Ga0070699_100001643 3300005518 Bacteria 20405
90 Ga0070699_100030460 3300005518 Bacteria 4658
91 Ga0070699_100032692 3300005518 Bacteria 4493
92 Ga0070699_100556136 3300005518 Bacteria 1045
93 Ga0070679_100018359 3300005530 Bacteria 6787
94 Ga0070679_100692721 3300005530 Bacteria 962
95 Ga0070679_100809975 3300005530 Unclassified 880
96 Ga0070697_100022267 3300005536 Bacteria 5029
97 Ga0070697_100140028 3300005536 Bacteria 2034
98 Ga0070697_100217529 3300005536 Bacteria 1628
99 Ga0070697_100223152 3300005536 Bacteria 1606
100 Ga0068853_100010950 3300005539 Bacteria 7349
101 Ga0068853_100028735 3300005539 Bacteria 4679
102 Ga0070672_100003623 3300005543 Bacteria 10021
103 Ga0070686_100431882 3300005544 Unclassified 1008
104 Ga0070693_100197350 3300005547 Bacteria 1305
105 Ga0070665_100532579 3300005548 Bacteria 1186
106 Ga0070665_101248419 3300005548 Unclassified 753
107 Ga0068855_100005074 3300005563 Bacteria 16056
108 Ga0068855_100038300 3300005563 Bacteria 5697
109 Ga0068855_100150584 3300005563 Unclassified 2646
110 Ga0068855_100286979 3300005563 Unclassified 1825
111 Ga0070664_100057005 3300005564 Bacteria 3320
112 Ga0070664_100212323 3300005564 Bacteria 1730
113 Ga0068857_100001077 3300005577 Bacteria 21136
114 Ga0068857_100448231 3300005577 Unclassified 1206
115 Ga0068854_100025671 3300005578 Bacteria 4043
116 Ga0068854_100141240 3300005578 Unclassified 1848
117 Ga0068856_100000900 3300005614 Bacteria 31839
118 Ga0068856_100095089 3300005614 Bacteria 2967
119 Ga0068856_100416360 3300005614 Unclassified 1364
120 Ga0070702_100011890 3300005615 Bacteria 4341
121 Ga0068852_100001023 3300005616 Bacteria 18446
122 Ga0068852_101028482 3300005616 Bacteria 843
123 Ga0068859_100071267 3300005617 Unclassified 3511
124 Ga0068864_100035931 3300005618 Bacteria 4220
125 Ga0068864_100051452 3300005618 Bacteria 3549
126 Ga0068864_100921637 3300005618 Unclassified 864
127 Ga0068866_10002471 3300005718 Bacteria 7622
128 Ga0068866_10068043 3300005718 Bacteria 1871
129 Ga0068863_100014276 3300005841 Bacteria 7650
130 Ga0068863_100020775 3300005841 Bacteria 6271
131 Ga0068863_100121797 3300005841 Unclassified 2488
132 Ga0068858_100041612 3300005842 Bacteria 4260
133 Ga0068858_100050612 3300005842 Bacteria 3845
134 Ga0068858_100148945 3300005842 Bacteria 2199
135 Ga0068858_100896499 3300005842 Bacteria 867
136 Ga0068860_100017024 3300005843 Bacteria 7085
137 Ga0068860_100096614 3300005843 Bacteria 2816
138 Ga0068860_100102408 3300005843 Bacteria 2732
139 Ga0068860_100500109 3300005843 Bacteria 1213
140 Ga0068862_100032350 3300005844 Bacteria 4419
141 Ga0070717_10002397 3300006028 Bacteria 13219
142 Ga0070717_10027372 3300006028 Bacteria 4556
143 Ga0070717_10029281 3300006028 Bacteria 4416
144 Ga0070717_10036005 3300006028 Bacteria 4012
145 Ga0070717_10079978 3300006028 Bacteria 2742
146 Ga0070717_10086720 3300006028 Bacteria 2635
147 Ga0070717_10130244 3300006028 Bacteria 2163
148 Ga0070717_10155875 3300006028 Bacteria 1978
149 Ga0070717_10222161 3300006028 Bacteria 1661
150 Ga0070717_10669542 3300006028 Unclassified 942
151 Ga0070715_10016263 3300006163 Bacteria 2792
152 Ga0070715_10043678 3300006163 Unclassified 1891
153 Ga0070715_10244562 3300006163 Bacteria 935
154 Ga0070716_100000087 3300006173 Bacteria 36197
155 Ga0070716_100010292 3300006173 Bacteria 4685
156 Ga0070716_100032982 3300006173 Bacteria 2829
157 Ga0070716_100131893 3300006173 Bacteria 1581
158 Ga0070716_100165462 3300006173 Bacteria 1438
159 Ga0070716_100252913 3300006173 Unclassified 1201
160 Ga0070712_100000154 3300006175 Bacteria 36911
161 Ga0070712_100019656 3300006175 Bacteria 4410
162 Ga0070712_100054203 3300006175 Unclassified 2803
163 Ga0070712_100059199 3300006175 Bacteria 2697
164 Ga0070712_100071648 3300006175 Bacteria 2480
165 Ga0070712_100159249 3300006175 Bacteria 1742
166 Ga0070712_100289296 3300006175 Bacteria 1322
167 Ga0070712_100490338 3300006175 Bacteria 1029
168 Ga0070712_100576602 3300006175 Unclassified 950
169 Ga0097621_100000442 3300006237 Bacteria 29002
170 Ga0097621_100197111 3300006237 Bacteria 1746
171 Ga0097621_100716054 3300006237 Unclassified 922
172 Ga0097621_100733145 3300006237 Bacteria 912
173 Ga0068871_100000231 3300006358 Bacteria 39603
174 Ga0068871_100001932 3300006358 Bacteria 14032
175 Ga0068871_100141109 3300006358 Bacteria 2049
176 Ga0075433_10051454 3300006852 Bacteria 3587
177 Ga0075434_100012735 3300006871 Bacteria 7982
178 Ga0075434_100106048 3300006871 Bacteria 2820
179 Ga0068865_100197399 3300006881 Bacteria 1560
180 Ga0068865_100724973 3300006881 Unclassified 852
181 Ga0075436_100005216 3300006914 Bacteria 8944
182 Ga0075436_100436004 3300006914 Bacteria 953
183 Ga0097620_100071263 3300006931 Unclassified 3511
184 Ga0075435_100064301 3300007076 Unclassified 2981
185 Ga0075435_100466563 3300007076 Bacteria 1090
186 Ga0099795_10113188 3300007788 Unclassified 1078
187 Ga0099795_10231092 3300007788 Unclassified 791
188 Ga0105250_10011542 3300009092 Bacteria 3663
189 Ga0105240_10176935 3300009093 Bacteria 2522
190 Ga0105240_10369192 3300009093 Bacteria 1623
191 Ga0105240_10391991 3300009093 Bacteria 1566
192 Ga0105245_10001110 3300009098 Bacteria 24344
193 Ga0105247_10001093 3300009101 Bacteria 20215
194 Ga0105241_10001486 3300009174 Bacteria 17962
195 Ga0105241_10012792 3300009174 Bacteria 6158
196 Ga0105241_10512118 3300009174 Unclassified 1072
197 Ga0105242_10014194 3300009176 Bacteria 6167
198 Ga0105242_10315893 3300009176 Bacteria 1431
199 Ga0105248_10037481 3300009177 Bacteria 5424
200 Ga0105248_10049900 3300009177 Bacteria 4692
201 Ga0105248_10103020 3300009177 Bacteria 3217
202 Ga0105248_10545769 3300009177 Bacteria 1308
203 Ga0105237_10034042 3300009545 Bacteria 5160
204 Ga0105237_10086787 3300009545 Bacteria 3119
205 Ga0105238_10038593 3300009551 Bacteria 4850
206 Ga0105238_10136463 3300009551 Bacteria 2431
207 Ga0105249_10027635 3300009553 Bacteria 5119
208 Ga0105249_10058204 3300009553 Bacteria 3542
209 Ga0105249_10540318 3300009553 Unclassified 1215
210 Ga0105239_10008317 3300010375 Bacteria 11824
211 Ga0105239_10840460 3300010375 Bacteria 1053
212 Ga0105246_10023571 3300011119 Bacteria 3985
213 Ga0157373_10005075 3300013100 Bacteria 9893
214 Ga0157373_10017420 3300013100 Bacteria 5233
215 Ga0157373_10027865 3300013100 Bacteria 4075
216 Ga0157373_10177929 3300013100 Bacteria 1498
217 Ga0157371_10010557 3300013102 Bacteria 7177
218 Ga0157370_10073366 3300013104 Bacteria 3229
219 Ga0157370_10091253 3300013104 Bacteria 2860
220 Ga0157369_10007600 3300013105 Bacteria 12472
221 Ga0157369_10032703 3300013105 Bacteria 5716
222 Ga0157369_10239770 3300013105 Unclassified 1894
223 Ga0157369_10600783 3300013105 Bacteria 1136
224 Ga0157374_10044654 3300013296 Unclassified 4096
225 Ga0157374_10054725 3300013296 Bacteria 3723
226 Ga0157374_10109339 3300013296 Bacteria 2657
227 Ga0157374_10155421 3300013296 Bacteria 2226
228 Ga0157374_10428077 3300013296 Unclassified 1323
229 Ga0157374_10458736 3300013296 Bacteria 1276
230 Ga0157374_10531827 3300013296 Bacteria 1182
231 Ga0157374_10869501 3300013296 Unclassified 919
232 Ga0157378_10000151 3300013297 Bacteria 65215
233 Ga0157378_10000487 3300013297 Bacteria 37522
234 Ga0157378_10129684 3300013297 Bacteria 2333
235 Ga0157378_10400063 3300013297 Unclassified 1353
236 Ga0163162_10221011 3300013306 Bacteria 2024
237 Ga0163162_10856789 3300013306 Unclassified 1024
238 Ga0157372_10001548 3300013307 Bacteria 25035
239 Ga0157372_10028847 3300013307 Bacteria 6057
240 Ga0157372_10078546 3300013307 Bacteria 3729
241 Ga0157372_10201195 3300013307 Bacteria 2307
242 Ga0157372_10301475 3300013307 Bacteria 1864
243 Ga0163163_10001875 3300014325 Bacteria 17773
244 Ga0163163_10126969 3300014325 Bacteria 2589
245 Ga0163163_10146281 3300014325 Bacteria 2407
246 Ga0163163_10739204 3300014325 Bacteria 1047
247 Ga0157380_10168681 3300014326 Bacteria 1910
248 Ga0182008_10008076 3300014497 Bacteria 5765
249 Ga0182008_10037717 3300014497 Bacteria 2418
250 Ga0157377_10009837 3300014745 Unclassified 4711
251 Ga0157379_10007786 3300014968 Bacteria 9278
252 Ga0157379_10256208 3300014968 Unclassified 1589
253 Ga0157376_10031670 3300014969 Bacteria 4238
254 Ga0157376_10216670 3300014969 Unclassified 1771
255 Ga0157376_11355974 3300014969 Unclassified 742
256 Ga0182007_10002315 3300015262 Bacteria 9568
257 Ga0182007_10009200 3300015262 Bacteria 4006
258 Ga0163161_10004203 3300017792 Bacteria 10050
259 Ga0224571_107824 3300022734 Bacteria 723
260 Ga0224572_1001948 3300024225 Bacteria 3216
261 Ga0224572_1002566 3300024225 Bacteria 2960
262 Ga0224572_1011864 3300024225 Bacteria 1650
263 Ga0228598_1003558 3300024227 Bacteria 3347
264 Ga0228598_1004767 3300024227 Unclassified 2866
265 Ga0228598_1007086 3300024227 Unclassified 2298
266 Ga0207692_10000622 3300025898 Bacteria 12444
267 Ga0207692_10020281 3300025898 Bacteria 3020
268 Ga0207692_10030842 3300025898 Unclassified 2561
269 Ga0207692_10088210 3300025898 Unclassified 1676
270 Ga0207642_10007113 3300025899 Bacteria 3760
271 Ga0207642_10055088 3300025899 Bacteria 1817
272 Ga0207710_10223887 3300025900 Unclassified 935
273 Ga0207680_10151083 3300025903 Bacteria 1548
274 Ga0207647_10004556 3300025904 Bacteria 10270
275 Ga0207685_10034488 3300025905 Unclassified 1839
276 Ga0207685_10139967 3300025905 Unclassified 1084
277 Ga0207699_10005879 3300025906 Bacteria 5901
278 Ga0207699_10010664 3300025906 Bacteria 4621
279 Ga0207699_10014141 3300025906 Bacteria 4105
280 Ga0207699_10026239 3300025906 Bacteria 3208
281 Ga0207645_10001075 3300025907 Bacteria 22584
282 Ga0207643_10000541 3300025908 Bacteria 24303
283 Ga0207705_10165668 3300025909 Bacteria 1662
284 Ga0207684_10004999 3300025910 Bacteria 12353
285 Ga0207684_10084888 3300025910 Unclassified 2697
286 Ga0207684_10169341 3300025910 Bacteria 1883
287 Ga0207654_10214974 3300025911 Unclassified 1272
288 Ga0207654_10245625 3300025911 Bacteria 1198
289 Ga0207707_10029976 3300025912 Bacteria 4757
290 Ga0207707_10052598 3300025912 Bacteria 3545
291 Ga0207695_10357004 3300025913 Bacteria 1348
292 Ga0207695_10965702 3300025913 Unclassified 732
293 Ga0207693_10000004 3300025915 Bacteria 193261
294 Ga0207693_10018996 3300025915 Bacteria 5470
295 Ga0207693_10023554 3300025915 Bacteria 4888
296 Ga0207693_10063039 3300025915 Bacteria 2904
297 Ga0207693_10094693 3300025915 Bacteria 2340
298 Ga0207693_10145829 3300025915 Bacteria 1861
299 Ga0207693_10306757 3300025915 Bacteria 1243
300 Ga0207693_10491727 3300025915 Unclassified 958
301 Ga0207663_10001360 3300025916 Bacteria 11334
302 Ga0207663_10024795 3300025916 Bacteria 3459
303 Ga0207663_10053949 3300025916 Bacteria 2514
304 Ga0207663_10066107 3300025916 Bacteria 2313
305 Ga0207663_10125064 3300025916 Bacteria 1767
306 Ga0207663_10625206 3300025916 Unclassified 848
307 Ga0207663_10900310 3300025916 Unclassified 707
308 Ga0207660_10017174 3300025917 Bacteria 4802
309 Ga0207662_10035912 3300025918 Bacteria 2896
310 Ga0207657_10006588 3300025919 Bacteria 12029
311 Ga0207657_10009286 3300025919 Bacteria 9904
312 Ga0207652_10068448 3300025921 Bacteria 3081
313 Ga0207652_10097633 3300025921 Bacteria 2590
314 Ga0207652_10154989 3300025921 Bacteria 2052
315 Ga0207646_10005140 3300025922 Bacteria 13871
316 Ga0207646_10051508 3300025922 Bacteria 3684
317 Ga0207646_10088646 3300025922 Bacteria 2768
318 Ga0207646_10158140 3300025922 Unclassified 2044
319 Ga0207646_10163556 3300025922 Bacteria 2009
320 Ga0207646_10280578 3300025922 Bacteria 1505
321 Ga0207646_10301507 3300025922 Unclassified 1447
322 Ga0207681_10281500 3300025923 Bacteria 1309
323 Ga0207694_10252106 3300025924 Bacteria 1444
324 Ga0207650_10000098 3300025925 Bacteria 115403
325 Ga0207650_10495222 3300025925 Bacteria 1021
326 Ga0207700_10000307 3300025928 Bacteria 28738
327 Ga0207700_10001456 3300025928 Bacteria 13436
328 Ga0207700_10007428 3300025928 Bacteria 6694
329 Ga0207700_10027076 3300025928 Bacteria 4009
330 Ga0207700_10038089 3300025928 Bacteria 3488
331 Ga0207700_10055821 3300025928 Bacteria 2970
332 Ga0207664_10000017 3300025929 Bacteria 230967
333 Ga0207664_10001242 3300025929 Bacteria 16867
334 Ga0207664_10087109 3300025929 Bacteria 2552
335 Ga0207664_10207121 3300025929 Bacteria 1695
336 Ga0207664_10245094 3300025929 Bacteria 1562
337 Ga0207664_10251870 3300025929 Bacteria 1541
338 Ga0207644_10392862 3300025931 Bacteria 1133
339 Ga0207706_10001102 3300025933 Bacteria 27497
340 Ga0207706_10248053 3300025933 Bacteria 1556
341 Ga0207669_10219522 3300025937 Bacteria 1394
342 Ga0207704_10068263 3300025938 Bacteria 2240
343 Ga0207704_10144194 3300025938 Bacteria 1670
344 Ga0207665_10014972 3300025939 Bacteria 5095
345 Ga0207665_10020256 3300025939 Bacteria 4370
346 Ga0207665_10179903 3300025939 Bacteria 1531
347 Ga0207665_10277433 3300025939 Unclassified 1246
348 Ga0207665_10385264 3300025939 Unclassified 1065
349 Ga0207665_10390222 3300025939 Bacteria 1058
350 Ga0207665_10441712 3300025939 Bacteria 997
351 Ga0207665_10503192 3300025939 Bacteria 936
352 Ga0207691_10000038 3300025940 Bacteria 107867
353 Ga0207711_10034085 3300025941 Bacteria 4311
354 Ga0207689_10000925 3300025942 Bacteria 28187
355 Ga0207661_10000307 3300025944 Bacteria 31202
356 Ga0207661_10320297 3300025944 Bacteria 1394
357 Ga0207679_10000078 3300025945 Bacteria 86272
358 Ga0207679_10186843 3300025945 Bacteria 1719
359 Ga0207667_10050198 3300025949 Bacteria 4402
360 Ga0207667_10096882 3300025949 Unclassified 3045
361 Ga0207651_10287793 3300025960 Bacteria 1361
362 Ga0207712_10080038 3300025961 Bacteria 2375
363 Ga0207712_10183952 3300025961 Bacteria 1644
364 Ga0207668_10534399 3300025972 Bacteria 1013
365 Ga0207640_10227857 3300025981 Bacteria 1431
366 Ga0207658_10010184 3300025986 Bacteria 6390
367 Ga0207677_10002752 3300026023 Bacteria 9281
368 Ga0207677_10003559 3300026023 Bacteria 8257
369 Ga0207703_10030456 3300026035 Bacteria 4265
370 Ga0207703_10037627 3300026035 Bacteria 3855
371 Ga0207703_10054585 3300026035 Bacteria 3250
372 Ga0207639_10057895 3300026041 Bacteria 2978
373 Ga0207639_10394200 3300026041 Bacteria 1246
374 Ga0207639_10589028 3300026041 Bacteria 1024
375 Ga0207678_10000348 3300026067 Bacteria 41968
376 Ga0207702_10017893 3300026078 Bacteria 5865
377 Ga0207702_10025922 3300026078 Bacteria 4867
378 Ga0207702_10137525 3300026078 Bacteria 2206
379 Ga0207641_10000021 3300026088 Bacteria 279851
380 Ga0207641_10014075 3300026088 Bacteria 6558
381 Ga0207648_10000353 3300026089 Bacteria 50521
382 Ga0207648_10250561 3300026089 Unclassified 1579
383 Ga0207676_10000262 3300026095 Bacteria 45744
384 Ga0207676_10065452 3300026095 Bacteria 2894
385 Ga0207674_10000386 3300026116 Bacteria 57404
386 Ga0207675_100236161 3300026118 Unclassified 1765
387 Ga0207683_10000045 3300026121 Bacteria 89294
388 Ga0207698_10312276 3300026142 Unclassified 1468
389 Ga0207698_10710549 3300026142 Bacteria 1001
390 Ga0265354_1003292 3300028016 Bacteria 1826
391 Ga0268266_10014913 3300028379 Bacteria 6673
392 Ga0268265_10111135 3300028380 Unclassified 2237
393 Ga0268264_10038408 3300028381 Bacteria 3952
394 Ga0268264_10093413 3300028381 Bacteria 2599
395 Ga0268264_10109585 3300028381 Bacteria 2416
396 Ga0265326_10016324 3300028558 Bacteria 2147
397 Ga0265338_10025362 3300028800 Bacteria 6019
398 Ga0265338_10028177 3300028800 Bacteria 5609
399 Ga0265338_10087586 3300028800 Bacteria 2586
400 Ga0265338_10106949 3300028800 Bacteria 2263
401 Ga0265762_1000565 3300030760 Bacteria 6513
402 Ga0265762_1007924 3300030760 Bacteria 1893
403 Ga0265765_1002112 3300030879 Bacteria 1898
404 Ga0265760_10000140 3300031090 Bacteria 18310
405 Ga0265760_10000303 3300031090 Bacteria 13547
406 Ga0265760_10005540 3300031090 Bacteria 3615
407 Ga0265330_10008549 3300031235 Unclassified 4923
408 Ga0265325_10012268 3300031241 Bacteria 4903
409 Ga0265325_10131682 3300031241 Bacteria 1197
410 Ga0265340_10005657 3300031247 Bacteria 6912
411 Ga0265339_10020373 3300031249 Bacteria 3876
412 Ga0265339_10024598 3300031249 Bacteria 3468
413 Ga0265339_10062195 3300031249 Bacteria 2007
414 Ga0265339_10219415 3300031249 Bacteria 931
415 Ga0265316_10012916 3300031344 Bacteria 7452
416 Ga0265316_10026007 3300031344 Bacteria 4876
417 Ga0265316_10328248 3300031344 Bacteria 1110
418 Ga0265316_10382597 3300031344 Bacteria 1015
419 Ga0265313_10079023 3300031595 Bacteria 1498
420 Ga0265314_10006900 3300031711 Bacteria 9948
421 Ga0265314_10065604 3300031711 Bacteria 2451
422 Ga0265314_10421348 3300031711 Unclassified 717
423 Ga0265342_10134215 3300031712 Bacteria 1385
424 Ga0265342_10168800 3300031712 Bacteria 1205
425 Ga0307407_10452324 3300031903 Unclassified 932
426 Ga0316212_1017094 3300033547 Bacteria 1021
427 Ga0373926_0078365 3300035083 Bacteria 1219
428 Ga0373926_0097715 3300035083 Bacteria 1096
429 Ga0373944_0035289 3300035089 Unclassified 1523
430 Ga0373923_0017454 3300035111 Bacteria 2746
431 Ga0373936_0001594 3300035113 Bacteria 8283
432 Ga0373936_0040910 3300035113 Bacteria 1858
433 Ga0373945_0026875 3300035116 Bacteria 2007
434 Ga0373953_0016777 3300035117 Bacteria 2679
435 Ga0373956_0088362 3300035119 Bacteria 1428
436 Ga0373957_0100317 3300035120 Unclassified 1158
437 Ga0373943_0007714 3300035170 Bacteria 4832
438 Ga0373943_0041135 3300035170 Unclassified 2234
439 Ga0373946_0002850 3300035171 Bacteria 6126
440 Ga0373955_0029231 3300035172 Unclassified 2865
441 Ga0373955_0036426 3300035172 Bacteria 2610
442 Ga0373955_0499979 3300035172 Unclassified 742
443 Ga0373961_0071022 3300035241 Bacteria 1076
444 Ga0373924_0030839 3300035410 Bacteria 2151
445 Ga0373924_0208599 3300035410 Unclassified 862
446 Ga0373935_0001452 3300035692 Bacteria 13139
447 Ga0373935_0009498 3300035692 Bacteria 5820
448 Ga0373927_0001907 3300035695 Bacteria 15406
449 Ga0373927_0054496 3300035695 Unclassified 2587
450 Ga0373927_0058173 3300035695 Bacteria 2500
451 Ga0373927_0485550 3300035695 Unclassified 816
452 Ga0373933_0062230 3300035724 Bacteria 2253
453 Ga0373933_0081034 3300035724 Bacteria 1990
454 Ga0373947_0001410 3300035725 Bacteria 14808
455 Ga0373947_0001966 3300035725 Bacteria 12585
456 Ga0373947_0022099 3300035725 Bacteria 3687
457 Ga0373947_0152590 3300035725 Bacteria 1489
458 Ga0373947_0276465 3300035725 Bacteria 1116
459 Ga0373947_0279074 3300035725 Bacteria 1110
460 Ga0373925_0000873 3300037068 Bacteria 27568
461 Ga0373925_0001030 3300037068 Bacteria 25248
462 Ga0373925_0009485 3300037068 Bacteria 7086
463 Ga0373925_0110465 3300037068 Unclassified 2123
464 Ga0373925_0893464 3300037068 Unclassified 732
465 Ga0466964_0367975 3300044706 Unclassified 743
466 Ga0453684_0364279 3300044712 Unclassified 1627
467 Ga0466959_0058626 3300045049 Bacteria 2804
468 Ga0451576_0337306 3300045051 Bacteria 1578
469 Ga0466967_0030460 3300045976 Bacteria 4529
470 Ga0495629_0020451 3300046459 Bacteria 4727
471 Ga0495580_0001031 3300046472 Bacteria 24463
472 Ga0495580_0001130 3300046472 Bacteria 23534
473 Ga0495580_0005692 3300046472 Bacteria 10251
474 Ga0495580_0018218 3300046472 Bacteria 5231
475 Ga0495580_0023653 3300046472 Bacteria 4507
476 Ga0495580_0030353 3300046472 Bacteria 3914
477 Ga0495580_0055728 3300046472 Bacteria 2784
478 Ga0495580_0083680 3300046472 Bacteria 2223
479 Ga0495582_0002585 3300046473 Bacteria 10070
480 Ga0495582_0073517 3300046473 Bacteria 1892
481 Ga0495582_0394581 3300046473 Bacteria 798
482 Ga0495639_0142879 3300046475 Unclassified 1151
483 Ga0495664_0061147 3300046477 Bacteria 2243
484 Ga0495584_0188176 3300046491 Unclassified 1049
485 Ga0495630_0043386 3300046517 Bacteria 3360
486 Ga0495630_0496137 3300046517 Bacteria 936
487 Ga0495665_0000423 3300046531 Bacteria 21589
488 Ga0495634_0178666 3300046642 Bacteria 1330
489 Ga0495588_0176071 3300046674 Bacteria 1131
490 Ga0495657_0307190 3300046675 Bacteria 945
491 Ga0495599_0073257 3300046678 Bacteria 2138
492 Ga0495623_0119599 3300046679 Bacteria 1587
493 Ga0495647_0151488 3300046681 Unclassified 994
494 Ga0495658_0070353 3300046683 Bacteria 2030
495 Ga0495669_0199938 3300046684 Unclassified 955
496 Ga0495624_0023753 3300046690 Bacteria 4041
497 Ga0495624_0137695 3300046690 Bacteria 1496
498 Ga0495674_0056911 3300047319 Bacteria 3423
499 Ga0495684_0130061 3300047471 Bacteria 1891
500 Ga0495593_0264601 3300047673 Unclassified 861
501 Ga0495602_0063967 3300048088 Bacteria 3184
502 Ga0496101_0132044 3300048904 Bacteria 1897
503 Ga0496102_0050195 3300048905 Bacteria 3798
504 Ga0496102_0324741 3300048905 Bacteria 1450
505 Ga0496102_0972843 3300048905 Bacteria 769
506 Ga0496103_0087618 3300048906 Bacteria 1963
507 Ga0496104_0147813 3300048907 Bacteria 2257
508 Ga0496105_0207711 3300048908 Bacteria 1597
509 Ga0496106_0074773 3300048909 Bacteria 2594
510 Ga0496108_0000429 3300048911 Bacteria 33965
511 Ga0496109_0000019 3300048912 Bacteria 190096
512 Ga0496109_0125065 3300048912 Bacteria 2397
513 Ga0496110_0002743 3300048913 Bacteria 13295
514 Ga0496111_0140224 3300048914 Bacteria 1791
515 Ga0496111_0140765 3300048914 Bacteria 1787
516 Ga0496112_0000149 3300048915 Bacteria 44049
517 Ga0496112_0503486 3300048915 Bacteria 1146
518 Ga0496112_0665010 3300048915 Bacteria 971
519 Ga0496113_0003188 3300048916 Bacteria 9772
520 Ga0496115_0017838 3300048918 Bacteria 5436
521 Ga0496115_0231183 3300048918 Unclassified 1525
522 Ga0496115_0323097 3300048918 Bacteria 1262
523 Ga0501298_004671 3300049521 Bacteria 2168
524 Ga0501235_085795 3300049669 Unclassified 756
525 Ga0501242_021293 3300049674 Unclassified 837
526 nmdc:mga0n895_103008_c1 3300050512 Bacteria 2865
527 nmdc:mga0n895_7816_c1 3300050512 Bacteria 9214
528 nmdc:mga0rr50_48122_c1 3300050513 Bacteria 3150
529 nmdc:mga0rr50_59246_c1 3300050513 Bacteria 2874
530 nmdc:mga0rr50_77786_c1 3300050513 Bacteria 2550
531 nmdc:mga08x19_1355_c1 3300050514 Bacteria 15184
532 nmdc:mga08x19_15790_c1 3300050514 Bacteria 4597
533 nmdc:mga08x19_325633_c1 3300050514 Unclassified 1070
534 nmdc:mga08x19_54365_c1 3300050514 Unclassified 2577
535 nmdc:mga08x19_61182_c1 3300050514 Bacteria 2440
536 Ga0495601_0008397 3300053077 Bacteria 6100
537 Ga0373937_0007357
538 LJNas_1000474
539 Ga0065715_10010469
540 Ga0070676_10003528
541 Ga0070683_100002104
542 Ga0070683_100121717
543 Ga0070683_100148927
544 Ga0070690_100487178
545 Ga0070670_100103334
546 Ga0070670_100371602
547 Ga0070680_100023034
548 Ga0070680_100924278
549 Ga0070682_100016816
550 Ga0068868_100003214
551 Ga0068868_100134076
552 Ga0068868_100215129
553 Ga0068868_100536271
554 Ga0070660_100008486
555 Ga0070660_100356529
556 Ga0070689_100024067
557 Ga0070689_100638268
558 Ga0070661_100003118
559 Ga0070661_100116836
560 Ga0070661_100179349
561 Ga0070661_100961037
562 Ga0070692_10312691
563 Ga0070669_100012221
564 Ga0070675_100016254
565 Ga0070674_100161173
566 Ga0070673_100006285
567 Ga0070673_100331640
568 Ga0070659_100002365
569 Ga0070667_100219917
570 Ga0070709_10002369
571 Ga0070709_10005429
572 Ga0070709_10415785
573 Ga0070709_10433106
574 Ga0070714_100000060
575 Ga0070714_100002486
576 Ga0070714_100093376
577 Ga0070714_100139606
578 Ga0070714_100349352
579 Ga0070714_100381774
580 Ga0070713_100000287
581 Ga0070713_100001637
582 Ga0070713_100009314
583 Ga0070713_100029238
584 Ga0070713_100049770
585 Ga0070713_100199421
586 Ga0070713_100685643
587 Ga0070713_100877376
588 Ga0070710_10001682
589 Ga0070710_10006776
590 Ga0070710_10012710
591 Ga0070710_10021384
592 Ga0070711_100001303
593 Ga0070711_100027842
594 Ga0070711_100056045
595 Ga0070711_100067994
596 Ga0070711_100138031
597 Ga0070711_100201286
598 Ga0070711_100607677
599 Ga0070711_100814357
600 Ga0070708_100004964
601 Ga0070708_100011926
602 Ga0070708_100012657
603 Ga0070708_100035795
604 Ga0070708_100059975
605 Ga0070708_100712408
606 Ga0070708_100845693
607 Ga0070663_100018431
608 Ga0070662_100008716
609 Ga0070681_10026270
610 Ga0070681_10055518
611 Ga0070681_10147223
612 Ga0068867_100002480
613 Ga0068867_100172218
614 Ga0070685_10006841
615 Ga0070706_100029882
616 Ga0070706_100631424
617 Ga0070707_100012693
618 Ga0070707_100012960
619 Ga0070707_100036762
620 Ga0070707_100095127
621 Ga0070698_100001177
622 Ga0070698_100037640
623 Ga0070698_100214716
624 Ga0070698_100550146
625 Ga0070699_100001643
626 Ga0070699_100030460
627 Ga0070699_100032692
628 Ga0070699_100556136
629 Ga0070679_100018359
630 Ga0070679_100692721
631 Ga0070679_100809975
632 Ga0070697_100022267
633 Ga0070697_100140028
634 Ga0070697_100217529
635 Ga0070697_100223152
636 Ga0068853_100010950
637 Ga0068853_100028735
638 Ga0070672_100003623
639 Ga0070686_100431882
640 Ga0070693_100197350
641 Ga0070665_100532579
642 Ga0070665_101248419
643 Ga0068855_100005074
644 Ga0068855_100038300
645 Ga0068855_100150584
646 Ga0068855_100286979
647 Ga0070664_100057005
648 Ga0070664_100212323
649 Ga0068857_100001077
650 Ga0068857_100448231
651 Ga0068854_100025671
652 Ga0068854_100141240
653 Ga0068856_100000900
654 Ga0068856_100095089
655 Ga0068856_100416360
656 Ga0070702_100011890
657 Ga0068852_100001023
658 Ga0068852_101028482
659 Ga0068859_100071267
660 Ga0068864_100035931
661 Ga0068864_100051452
662 Ga0068864_100921637
663 Ga0068866_10002471
664 Ga0068866_10068043
665 Ga0068863_100014276
666 Ga0068863_100020775
667 Ga0068863_100121797
668 Ga0068858_100041612
669 Ga0068858_100050612
670 Ga0068858_100148945
671 Ga0068858_100896499
672 Ga0068860_100017024
673 Ga0068860_100096614
674 Ga0068860_100102408
675 Ga0068860_100500109
676 Ga0068862_100032350
677 Ga0070717_10002397
678 Ga0070717_10027372
679 Ga0070717_10029281
680 Ga0070717_10036005
681 Ga0070717_10079978
682 Ga0070717_10086720
683 Ga0070717_10130244
684 Ga0070717_10155875
685 Ga0070717_10222161
686 Ga0070717_10669542
687 Ga0070715_10016263
688 Ga0070715_10043678
689 Ga0070715_10244562
690 Ga0070716_100000087
691 Ga0070716_100010292
692 Ga0070716_100032982
693 Ga0070716_100131893
694 Ga0070716_100165462
695 Ga0070716_100252913
696 Ga0070712_100000154
697 Ga0070712_100019656
698 Ga0070712_100054203
699 Ga0070712_100059199
700 Ga0070712_100071648
701 Ga0070712_100159249
702 Ga0070712_100289296
703 Ga0070712_100490338
704 Ga0070712_100576602
705 Ga0097621_100000442
706 Ga0097621_100197111
707 Ga0097621_100716054
708 Ga0097621_100733145
709 Ga0068871_100000231
710 Ga0068871_100001932
711 Ga0068871_100141109
712 Ga0075433_10051454
713 Ga0075434_100012735
714 Ga0075434_100106048
715 Ga0068865_100197399
716 Ga0068865_100724973
717 Ga0075436_100005216
718 Ga0075436_100436004
719 Ga0097620_100071263
720 Ga0075435_100064301
721 Ga0075435_100466563
722 Ga0099795_10113188
723 Ga0099795_10231092
724 Ga0105250_10011542
725 Ga0105240_10176935
726 Ga0105240_10369192
727 Ga0105240_10391991
728 Ga0105245_10001110
729 Ga0105247_10001093
730 Ga0105241_10001486
731 Ga0105241_10012792
732 Ga0105241_10512118
733 Ga0105242_10014194
734 Ga0105242_10315893
735 Ga0105248_10037481
736 Ga0105248_10049900
737 Ga0105248_10103020
738 Ga0105248_10545769
739 Ga0105237_10034042
740 Ga0105237_10086787
741 Ga0105238_10038593
742 Ga0105238_10136463
743 Ga0105249_10027635
744 Ga0105249_10058204
745 Ga0105249_10540318
746 Ga0105239_10008317
747 Ga0105239_10840460
748 Ga0105246_10023571
749 Ga0157373_10005075
750 Ga0157373_10017420
751 Ga0157373_10027865
752 Ga0157373_10177929
753 Ga0157371_10010557
754 Ga0157370_10073366
755 Ga0157370_10091253
756 Ga0157369_10007600
757 Ga0157369_10032703
758 Ga0157369_10239770
759 Ga0157369_10600783
760 Ga0157374_10044654
761 Ga0157374_10054725
762 Ga0157374_10109339
763 Ga0157374_10155421
764 Ga0157374_10428077
765 Ga0157374_10458736
766 Ga0157374_10531827
767 Ga0157374_10869501
768 Ga0157378_10000151
769 Ga0157378_10000487
770 Ga0157378_10129684
771 Ga0157378_10400063
772 Ga0163162_10221011
773 Ga0163162_10856789
774 Ga0157372_10001548
775 Ga0157372_10028847
776 Ga0157372_10078546
777 Ga0157372_10201195
778 Ga0157372_10301475
779 Ga0163163_10001875
780 Ga0163163_10126969
781 Ga0163163_10146281
782 Ga0163163_10739204
783 Ga0157380_10168681
784 Ga0182008_10008076
785 Ga0182008_10037717
786 Ga0157377_10009837
787 Ga0157379_10007786
788 Ga0157379_10256208
789 Ga0157376_10031670
790 Ga0157376_10216670
791 Ga0157376_11355974
792 Ga0182007_10002315
793 Ga0182007_10009200
794 Ga0163161_10004203
795 Ga0224571_107824
796 Ga0224572_1001948
797 Ga0224572_1002566
798 Ga0224572_1011864
799 Ga0228598_1003558
800 Ga0228598_1004767
801 Ga0228598_1007086
802 Ga0207692_10000622
803 Ga0207692_10020281
804 Ga0207692_10030842
805 Ga0207692_10088210
806 Ga0207642_10007113
807 Ga0207642_10055088
808 Ga0207710_10223887
809 Ga0207680_10151083
810 Ga0207647_10004556
811 Ga0207685_10034488
812 Ga0207685_10139967
813 Ga0207699_10005879
814 Ga0207699_10010664
815 Ga0207699_10014141
816 Ga0207699_10026239
817 Ga0207645_10001075
818 Ga0207643_10000541
819 Ga0207705_10165668
820 Ga0207684_10004999
821 Ga0207684_10084888
822 Ga0207684_10169341
823 Ga0207654_10214974
824 Ga0207654_10245625
825 Ga0207707_10029976
826 Ga0207707_10052598
827 Ga0207695_10357004
828 Ga0207695_10965702
829 Ga0207693_10000004
830 Ga0207693_10018996
831 Ga0207693_10023554
832 Ga0207693_10063039
833 Ga0207693_10094693
834 Ga0207693_10145829
835 Ga0207693_10306757
836 Ga0207693_10491727
837 Ga0207663_10001360
838 Ga0207663_10024795
839 Ga0207663_10053949
840 Ga0207663_10066107
841 Ga0207663_10125064
842 Ga0207663_10625206
843 Ga0207663_10900310
844 Ga0207660_10017174
845 Ga0207662_10035912
846 Ga0207657_10006588
847 Ga0207657_10009286
848 Ga0207652_10068448
849 Ga0207652_10097633
850 Ga0207652_10154989
851 Ga0207646_10005140
852 Ga0207646_10051508
853 Ga0207646_10088646
854 Ga0207646_10158140
855 Ga0207646_10163556
856 Ga0207646_10280578
857 Ga0207646_10301507
858 Ga0207681_10281500
859 Ga0207694_10252106
860 Ga0207650_10000098
861 Ga0207650_10495222
862 Ga0207700_10000307
863 Ga0207700_10001456
864 Ga0207700_10007428
865 Ga0207700_10027076
866 Ga0207700_10038089
867 Ga0207700_10055821
868 Ga0207664_10000017
869 Ga0207664_10001242
870 Ga0207664_10087109
871 Ga0207664_10207121
872 Ga0207664_10245094
873 Ga0207664_10251870
874 Ga0207644_10392862
875 Ga0207706_10001102
876 Ga0207706_10248053
877 Ga0207669_10219522
878 Ga0207704_10068263
879 Ga0207704_10144194
880 Ga0207665_10014972
881 Ga0207665_10020256
882 Ga0207665_10179903
883 Ga0207665_10277433
884 Ga0207665_10385264
885 Ga0207665_10390222
886 Ga0207665_10441712
887 Ga0207665_10503192
888 Ga0207691_10000038
889 Ga0207711_10034085
890 Ga0207689_10000925
891 Ga0207661_10000307
892 Ga0207661_10320297
893 Ga0207679_10000078
894 Ga0207679_10186843
895 Ga0207667_10050198
896 Ga0207667_10096882
897 Ga0207651_10287793
898 Ga0207712_10080038
899 Ga0207712_10183952
900 Ga0207668_10534399
901 Ga0207640_10227857
902 Ga0207658_10010184
903 Ga0207677_10002752
904 Ga0207677_10003559
905 Ga0207703_10030456
906 Ga0207703_10037627
907 Ga0207703_10054585
908 Ga0207639_10057895
909 Ga0207639_10394200
910 Ga0207639_10589028
911 Ga0207678_10000348
912 Ga0207702_10017893
913 Ga0207702_10025922
914 Ga0207702_10137525
915 Ga0207641_10000021
916 Ga0207641_10014075
917 Ga0207648_10000353
918 Ga0207648_10250561
919 Ga0207676_10000262
920 Ga0207676_10065452
921 Ga0207674_10000386
922 Ga0207675_100236161
923 Ga0207683_10000045
924 Ga0207698_10312276
925 Ga0207698_10710549
926 Ga0265354_1003292
927 Ga0268266_10014913
928 Ga0268265_10111135
929 Ga0268264_10038408
930 Ga0268264_10093413
931 Ga0268264_10109585
932 Ga0265326_10016324
933 Ga0265338_10025362
934 Ga0265338_10028177
935 Ga0265338_10087586
936 Ga0265338_10106949
937 Ga0265762_1000565
938 Ga0265762_1007924
939 Ga0265765_1002112
940 Ga0265760_10000140
941 Ga0265760_10000303
942 Ga0265760_10005540
943 Ga0265330_10008549
944 Ga0265325_10012268
945 Ga0265325_10131682
946 Ga0265340_10005657
947 Ga0265339_10020373
948 Ga0265339_10024598
949 Ga0265339_10062195
950 Ga0265339_10219415
951 Ga0265316_10012916
952 Ga0265316_10026007
953 Ga0265316_10328248
954 Ga0265316_10382597
955 Ga0265313_10079023
956 Ga0265314_10006900
957 Ga0265314_10065604
958 Ga0265314_10421348
959 Ga0265342_10134215
960 Ga0265342_10168800
961 Ga0307407_10452324
962 Ga0316212_1017094
963 Ga0373926_0078365
964 Ga0373926_0097715
965 Ga0373944_0035289
966 Ga0373923_0017454
967 Ga0373936_0001594
968 Ga0373936_0040910
969 Ga0373945_0026875
970 Ga0373953_0016777
971 Ga0373956_0088362
972 Ga0373957_0100317
973 Ga0373943_0007714
974 Ga0373943_0041135
975 Ga0373946_0002850
976 Ga0373955_0029231
977 Ga0373955_0036426
978 Ga0373955_0499979
979 Ga0373961_0071022
980 Ga0373924_0030839
981 Ga0373924_0208599
982 Ga0373935_0001452
983 Ga0373935_0009498
984 Ga0373927_0001907
985 Ga0373927_0054496
986 Ga0373927_0058173
987 Ga0373927_0485550
988 Ga0373933_0062230
989 Ga0373933_0081034
990 Ga0373947_0001410
991 Ga0373947_0001966
992 Ga0373947_0022099
993 Ga0373947_0152590
994 Ga0373947_0276465
995 Ga0373947_0279074
996 Ga0373925_0000873
997 Ga0373925_0001030
998 Ga0373925_0009485
999 Ga0373925_0110465
1000 Ga0373925_0893464
1001 Ga0466964_0367975
1002 Ga0453684_0364279
1003 Ga0466959_0058626
1004 Ga0451576_0337306
1005 Ga0466967_0030460
1006 Ga0495629_0020451
1007 Ga0495580_0001031
1008 Ga0495580_0001130
1009 Ga0495580_0005692
1010 Ga0495580_0018218
1011 Ga0495580_0023653
1012 Ga0495580_0030353
1013 Ga0495580_0055728
1014 Ga0495580_0083680
1015 Ga0495582_0002585
1016 Ga0495582_0073517
1017 Ga0495582_0394581
1018 Ga0495639_0142879
1019 Ga0495664_0061147
1020 Ga0495584_0188176
1021 Ga0495630_0043386
1022 Ga0495630_0496137
1023 Ga0495665_0000423
1024 Ga0495634_0178666
1025 Ga0495588_0176071
1026 Ga0495657_0307190
1027 Ga0495599_0073257
1028 Ga0495623_0119599
1029 Ga0495647_0151488
1030 Ga0495658_0070353
1031 Ga0495669_0199938
1032 Ga0495624_0023753
1033 Ga0495624_0137695
1034 Ga0495674_0056911
1035 Ga0495684_0130061
1036 Ga0495593_0264601
1037 Ga0495602_0063967
1038 Ga0496101_0132044
1039 Ga0496102_0050195
1040 Ga0496102_0324741
1041 Ga0496102_0972843
1042 Ga0496103_0087618
1043 Ga0496104_0147813
1044 Ga0496105_0207711
1045 Ga0496106_0074773
1046 Ga0496108_0000429
1047 Ga0496109_0000019
1048 Ga0496109_0125065
1049 Ga0496110_0002743
1050 Ga0496111_0140224
1051 Ga0496111_0140765
1052 Ga0496112_0000149
1053 Ga0496112_0503486
1054 Ga0496112_0665010
1055 Ga0496113_0003188
1056 Ga0496115_0017838
1057 Ga0496115_0231183
1058 Ga0496115_0323097
1059 Ga0501298_004671
1060 Ga0501235_085795
1061 Ga0501242_021293
1062 nmdc:mga0n895_103008_c1
1063 nmdc:mga0n895_7816_c1
1064 nmdc:mga0rr50_48122_c1
1065 nmdc:mga0rr50_59246_c1
1066 nmdc:mga0rr50_77786_c1
1067 nmdc:mga08x19_1355_c1
1068 nmdc:mga08x19_15790_c1
1069 nmdc:mga08x19_325633_c1
1070 nmdc:mga08x19_54365_c1
1071 nmdc:mga08x19_61182_c1
1072 Ga0495601_0008397

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

75

227

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b34-assembly1.cif.gz_A structure of mar1 ribonuclease from caenorhabditis elegans 0.9414 18 201
4wgf-assembly1.cif.gz_C ycac from pseudomonas aeruginosa with hexane-2,5-diol and covalent acrylamide 0.9175 18 200
4wh0-assembly1.cif.gz_A ycac from pseudomonas aeruginosa with s-mercaptocysteine active site cysteine 0.9143 18 198
1yzv-assembly1.cif.gz_A hypothetical protein from trypanosoma cruzi 0.9092 24 201
1yac-assembly1.cif.gz_A the 1.8 angstrom crystal structure of the ycac gene product from escherichia coli reveals an octameric hydrolase of unknown specificity 0.9012 19 199
ID Description Score Start End Superfamily
af_A0JME6_2_195_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9634 19 201 3.40.50.850
af_Q54NZ8_2_198_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9463 19 200 3.40.50.850
af_Q54RF0_1_198_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9334 19 200 3.40.50.850
af_Q9W127_4_199_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9297 17 201 3.40.50.850
af_Q54RC7_3_195_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9229 18 200 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A1Q6XHI8-F1-model_v4 Isochorismatase-like domain-containing protein 0.9917 16 199
AF-A0A7T9CH82-F1-model_v4 deleted 0.9872 18 183
AF-A0A0S8J358-F1-model_v4 Isochorismatase-like domain-containing protein 0.9851 19 199
AF-A0A1G2ZH86-F1-model_v4 Isochorismatase-like domain-containing protein 0.9845 19 200
AF-K2KG33-F1-model_v4 Putative isochorismatase hydrolase 0.9844 18 200 GO:0016787

Map