F460697

General Info

Members Datasets Scaffolds Average Seq Length
535 280 535 204

Family's Representative Sequence

Representative Sequence 3300044706|Ga0466964_0083598|Ga0466964_0083598_46_765
Length 239
Sequence VAFAIAPRVYVGACRRLVESARVIRTLRFLARNRMLNLKYARLLWRYAWRRLLTPAGWRWETDGPVFFGRGLELQIGRGATVRFGRFCWIGDRTKIRCHEGVIEIGAKTVLGQECTISAYQRVRIGEQCVVADRAMFIDFDHGVVEVERPIRAQGIYKRDVRVGHNVWVGYGTSFLRGARVXDNAVIGTASVVTKDVPANAVAAGAPIRVLRMRERPRSIRWPEPVDPAPPGEPGPSDR

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
207 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
208 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
227 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
228 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
229 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
247 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
250 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
256 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
257 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
258 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
261 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
263 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
274 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
277 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.74
Nodule 0
Rhizoplane 9.53
Rhizosphere 84.3
Stem 0
Stem Tuber 0
Unclassified 2.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10006219 3300001979 Bacteria 4969
2 JGI24748J21848_1000299 3300002074 Bacteria 5810
3 JGI24034J26672_10000180 3300002239 Bacteria 8646
4 JGI24751J29686_10007587 3300002459 Bacteria 2217
5 JGI25407J50210_10012274 3300003373 Bacteria 2195
6 Ga0070658_10274672 3300005327 Bacteria 1434
7 Ga0070683_100003289 3300005329 Bacteria 13064
8 Ga0070683_100006767 3300005329 Bacteria 9633
9 Ga0070683_100295190 3300005329 Bacteria 1541
10 Ga0070670_100147222 3300005331 Bacteria 2038
11 Ga0070677_10000098 3300005333 Bacteria 28689
12 Ga0070680_100283461 3300005336 Bacteria 1404
13 Ga0070682_100000013 3300005337 Bacteria 254641
14 Ga0070682_100000421 3300005337 Bacteria 27464
15 Ga0070682_100016042 3300005337 Bacteria 4351
16 Ga0068868_100004331 3300005338 Bacteria 9949
17 Ga0068868_100004773 3300005338 Bacteria 9518
18 Ga0070691_10004831 3300005341 Bacteria 6134
19 Ga0070661_100000599 3300005344 Bacteria 26985
20 Ga0070661_100336554 3300005344 Bacteria 1181
21 Ga0070661_100395489 3300005344 Bacteria 1092
22 Ga0070692_10022930 3300005345 Bacteria 3055
23 Ga0070692_10043138 3300005345 Bacteria 2319
24 Ga0070668_100395499 3300005347 Bacteria 1179
25 Ga0070675_100000053 3300005354 Bacteria 70601
26 Ga0070675_100064623 3300005354 Bacteria 3025
27 Ga0070674_100000025 3300005356 Bacteria 78679
28 Ga0070674_100023380 3300005356 Bacteria 4000
29 Ga0070674_100040199 3300005356 Bacteria 3163
30 Ga0070673_100169977 3300005364 Bacteria 1860
31 Ga0070688_100000012 3300005365 Bacteria 79406
32 Ga0070688_100000269 3300005365 Bacteria 26936
33 Ga0070688_100142726 3300005365 Bacteria 1629
34 Ga0070659_100118051 3300005366 Bacteria 2146
35 Ga0070659_100422934 3300005366 Bacteria 1127
36 Ga0070667_100001647 3300005367 Bacteria 19972
37 Ga0070703_10027432 3300005406 Bacteria 1697
38 Ga0070701_10019776 3300005438 Bacteria 3185
39 Ga0070711_100037171 3300005439 Bacteria 3265
40 Ga0070700_100115092 3300005441 Bacteria 1794
41 Ga0070663_100001410 3300005455 Bacteria 13139
42 Ga0070663_100009785 3300005455 Bacteria 5954
43 Ga0070678_100013493 3300005456 Bacteria 5126
44 Ga0070678_100031589 3300005456 Bacteria 3656
45 Ga0070678_100250943 3300005456 Bacteria 1484
46 Ga0070678_100663268 3300005456 Bacteria 937
47 Ga0070662_100000007 3300005457 Bacteria 168761
48 Ga0070681_10032650 3300005458 Bacteria 5226
49 Ga0070685_10000018 3300005466 Bacteria 110132
50 Ga0070685_10000142 3300005466 Bacteria 46324
51 Ga0070685_10061070 3300005466 Bacteria 2206
52 Ga0070679_100004180 3300005530 Bacteria 13313
53 Ga0070679_100018917 3300005530 Bacteria 6689
54 Ga0070679_100135888 3300005530 Bacteria 2440
55 Ga0070679_100261196 3300005530 Bacteria 1687
56 Ga0070684_100030694 3300005535 Bacteria 4569
57 Ga0070684_100107492 3300005535 Bacteria 2499
58 Ga0070684_100243693 3300005535 Bacteria 1643
59 Ga0070684_100287992 3300005535 Bacteria 1506
60 Ga0068853_100067597 3300005539 Bacteria 3105
61 Ga0068853_100100626 3300005539 Bacteria 2555
62 Ga0070672_100000030 3300005543 Bacteria 62612
63 Ga0070686_100034395 3300005544 Bacteria 3123
64 Ga0070695_100379688 3300005545 Bacteria 1066
65 Ga0070693_100001370 3300005547 Bacteria 10977
66 Ga0070665_100000776 3300005548 Bacteria 41977
67 Ga0070665_100001190 3300005548 Bacteria 31771
68 Ga0070665_100130454 3300005548 Bacteria 2516
69 Ga0070665_100703241 3300005548 Bacteria 1024
70 Ga0070664_100042879 3300005564 Bacteria 3818
71 Ga0070664_100158166 3300005564 Bacteria 2003
72 Ga0070664_100414037 3300005564 Bacteria 1234
73 Ga0068857_100249196 3300005577 Bacteria 1628
74 Ga0068854_100000031 3300005578 Bacteria 107298
75 Ga0068856_100015030 3300005614 Bacteria 7475
76 Ga0068856_100073883 3300005614 Bacteria 3376
77 Ga0068856_101381778 3300005614 Bacteria 719
78 Ga0070702_100234708 3300005615 Bacteria 1234
79 Ga0068852_100125447 3300005616 Bacteria 2357
80 Ga0068852_100163618 3300005616 Bacteria 2079
81 Ga0068866_10000001 3300005718 Bacteria 519680
82 Ga0068866_10023383 3300005718 Bacteria 2874
83 Ga0068861_100349156 3300005719 Bacteria 1297
84 Ga0068851_10011865 3300005834 Bacteria 4096
85 Ga0068851_10107938 3300005834 Bacteria 1483
86 Ga0068863_100000021 3300005841 Bacteria 198088
87 Ga0068863_100038925 3300005841 Bacteria 4525
88 Ga0068858_100000109 3300005842 Bacteria 86772
89 Ga0068858_100025383 3300005842 Bacteria 5514
90 Ga0068858_100107826 3300005842 Bacteria 2600
91 Ga0068860_100012821 3300005843 Bacteria 8241
92 Ga0068860_100075496 3300005843 Bacteria 3206
93 Ga0068860_100381944 3300005843 Bacteria 1391
94 Ga0068860_100596481 3300005843 Bacteria 1110
95 Ga0068862_100002701 3300005844 Bacteria 15571
96 Ga0081455_10022369 3300005937 Bacteria 5909
97 Ga0081455_10080576 3300005937 Bacteria 2668
98 Ga0081455_10090326 3300005937 Bacteria 2484
99 Ga0081455_10162209 3300005937 Bacteria 1712
100 Ga0081455_10164927 3300005937 Bacteria 1694
101 Ga0081538_10000030 3300005981 Bacteria 124321
102 Ga0081538_10067285 3300005981 Bacteria 2001
103 Ga0081540_1006334 3300005983 Bacteria 8644
104 Ga0081539_10001003 3300005985 Bacteria 52435
105 Ga0081539_10004902 3300005985 Bacteria 14265
106 Ga0081539_10058038 3300005985 Bacteria 2138
107 Ga0075365_10072512 3300006038 Bacteria 2320
108 Ga0075365_10214602 3300006038 Bacteria 1349
109 Ga0075365_10276546 3300006038 Bacteria 1181
110 Ga0075363_100019275 3300006048 Bacteria 3409
111 Ga0075364_10012215 3300006051 Bacteria 5247
112 Ga0075364_10217894 3300006051 Bacteria 1295
113 Ga0070715_10000001 3300006163 Bacteria 693690
114 Ga0070715_10058183 3300006163 Bacteria 1687
115 Ga0070715_10188392 3300006163 Bacteria 1040
116 Ga0070716_100298653 3300006173 Bacteria 1119
117 Ga0070712_100356383 3300006175 Bacteria 1199
118 Ga0075367_10025801 3300006178 Bacteria 3326
119 Ga0075430_100014638 3300006846 Bacteria 6681
120 Ga0075430_100157036 3300006846 Bacteria 1893
121 Ga0075431_100536773 3300006847 Bacteria 1158
122 Ga0075433_10011635 3300006852 Bacteria 7087
123 Ga0075433_10122016 3300006852 Bacteria 2314
124 Ga0075434_100206282 3300006871 Bacteria 1986
125 Ga0068865_100000301 3300006881 Bacteria 27213
126 Ga0068865_100194176 3300006881 Bacteria 1572
127 Ga0075435_100460474 3300007076 Bacteria 1097
128 Ga0111539_10134875 3300009094 Bacteria 2891
129 Ga0105245_10000180 3300009098 Bacteria 59695
130 Ga0105245_10000832 3300009098 Bacteria 28099
131 Ga0105245_10011890 3300009098 Bacteria 7568
132 Ga0105245_10014301 3300009098 Bacteria 6917
133 Ga0105247_10000323 3300009101 Bacteria 42551
134 Ga0114129_10153933 3300009147 Bacteria 3146
135 Ga0105243_10010482 3300009148 Bacteria 7038
136 Ga0105243_10014733 3300009148 Bacteria 5914
137 Ga0105243_10332854 3300009148 Bacteria 1388
138 Ga0105242_10003600 3300009176 Bacteria 12051
139 Ga0105242_10048894 3300009176 Bacteria 3439
140 Ga0105248_10000032 3300009177 Bacteria 201114
141 Ga0105248_10213460 3300009177 Bacteria 2174
142 Ga0105248_10240120 3300009177 Bacteria 2039
143 Ga0105238_10000201 3300009551 Bacteria 66092
144 Ga0105238_10650894 3300009551 Bacteria 1064
145 Ga0105249_10000074 3300009553 Bacteria 145235
146 Ga0105249_10028847 3300009553 Bacteria 5009
147 Ga0105249_10967641 3300009553 Bacteria 919
148 Ga0105249_11009895 3300009553 Bacteria 901
149 Ga0105239_10054592 3300010375 Bacteria 4383
150 Ga0105239_10428672 3300010375 Bacteria 1499
151 Ga0105246_10171863 3300011119 Bacteria 1660
152 Ga0157371_10013940 3300013102 Bacteria 6088
153 Ga0157370_10003066 3300013104 Bacteria 19809
154 Ga0157370_10069893 3300013104 Bacteria 3316
155 Ga0157369_10135949 3300013105 Bacteria 2603
156 Ga0157374_10001471 3300013296 Bacteria 19884
157 Ga0157378_10002558 3300013297 Bacteria 16176
158 Ga0163162_10329846 3300013306 Bacteria 1658
159 Ga0157372_10000308 3300013307 Bacteria 54161
160 Ga0157375_10004976 3300013308 Bacteria 11555
161 Ga0157375_10210708 3300013308 Bacteria 2100
162 Ga0157375_10217413 3300013308 Bacteria 2069
163 Ga0157380_10000158 3300014326 Bacteria 39132
164 Ga0157380_10030540 3300014326 Bacteria 4128
165 Ga0157377_10012521 3300014745 Bacteria 4268
166 Ga0157377_10475511 3300014745 Bacteria 868
167 Ga0157379_10004315 3300014968 Bacteria 12160
168 Ga0206354_11582559 3300020081 Bacteria 959
169 Ga0207656_10000321 3300025321 Bacteria 16492
170 Ga0207656_10027041 3300025321 Bacteria 2344
171 Ga0207653_10021814 3300025885 Bacteria 2032
172 Ga0207682_10000182 3300025893 Bacteria 28392
173 Ga0207642_10000006 3300025899 Bacteria 230268
174 Ga0207642_10000007 3300025899 Bacteria 226017
175 Ga0207710_10000549 3300025900 Bacteria 22590
176 Ga0207688_10137767 3300025901 Bacteria 1434
177 Ga0207680_10005946 3300025903 Bacteria 5864
178 Ga0207680_10010817 3300025903 Bacteria 4581
179 Ga0207680_10039292 3300025903 Bacteria 2745
180 Ga0207685_10000011 3300025905 Bacteria 213430
181 Ga0207643_10027450 3300025908 Bacteria 3156
182 Ga0207705_10067792 3300025909 Bacteria 2583
183 Ga0207705_10182098 3300025909 Bacteria 1586
184 Ga0207705_10231880 3300025909 Bacteria 1404
185 Ga0207654_10212095 3300025911 Bacteria 1280
186 Ga0207707_10017275 3300025912 Bacteria 6288
187 Ga0207693_10007556 3300025915 Bacteria 8932
188 Ga0207663_10000683 3300025916 Bacteria 15043
189 Ga0207663_10087442 3300025916 Bacteria 2058
190 Ga0207649_10000076 3300025920 Bacteria 83824
191 Ga0207649_10277162 3300025920 Bacteria 1218
192 Ga0207652_10000370 3300025921 Bacteria 46725
193 Ga0207652_10012858 3300025921 Bacteria 6767
194 Ga0207652_10286443 3300025921 Bacteria 1486
195 Ga0207652_10313304 3300025921 Bacteria 1416
196 Ga0207694_10000004 3300025924 Bacteria 967075
197 Ga0207650_10106478 3300025925 Bacteria 2166
198 Ga0207659_10000010 3300025926 Bacteria 286639
199 Ga0207659_10054482 3300025926 Bacteria 2857
200 Ga0207687_10000007 3300025927 Bacteria 604185
201 Ga0207687_10000018 3300025927 Bacteria 236159
202 Ga0207687_10002274 3300025927 Bacteria 13067
203 Ga0207687_10005996 3300025927 Bacteria 8042
204 Ga0207687_10139451 3300025927 Bacteria 1838
205 Ga0207687_10250988 3300025927 Unclassified 1406
206 Ga0207700_10529288 3300025928 Bacteria 1045
207 Ga0207644_10301525 3300025931 Bacteria 1291
208 Ga0207690_10091435 3300025932 Bacteria 2151
209 Ga0207690_10392888 3300025932 Bacteria 1105
210 Ga0207706_10000018 3300025933 Bacteria 168729
211 Ga0207686_10000859 3300025934 Bacteria 18488
212 Ga0207686_10612009 3300025934 Bacteria 858
213 Ga0207709_10010539 3300025935 Bacteria 5091
214 Ga0207709_10023271 3300025935 Bacteria 3525
215 Ga0207670_10174054 3300025936 Bacteria 1616
216 Ga0207669_10000009 3300025937 Bacteria 168012
217 Ga0207669_10004394 3300025937 Bacteria 6202
218 Ga0207669_10331622 3300025937 Bacteria 1168
219 Ga0207704_10000720 3300025938 Bacteria 14555
220 Ga0207704_10161763 3300025938 Bacteria 1594
221 Ga0207665_10154233 3300025939 Bacteria 1647
222 Ga0207665_10253483 3300025939 Bacteria 1301
223 Ga0207691_10000190 3300025940 Bacteria 58438
224 Ga0207691_10009388 3300025940 Bacteria 9394
225 Ga0207711_10000020 3300025941 Bacteria 363325
226 Ga0207661_10000403 3300025944 Bacteria 27999
227 Ga0207661_10004642 3300025944 Bacteria 9622
228 Ga0207661_10012409 3300025944 Bacteria 6191
229 Ga0207661_10252826 3300025944 Bacteria 1567
230 Ga0207679_10067633 3300025945 Bacteria 2681
231 Ga0207679_10119171 3300025945 Bacteria 2098
232 Ga0207679_10149061 3300025945 Bacteria 1901
233 Ga0207679_10486131 3300025945 Bacteria 1100
234 Ga0207651_10112095 3300025960 Bacteria 2050
235 Ga0207712_10000007 3300025961 Bacteria 539589
236 Ga0207712_10133084 3300025961 Bacteria 1897
237 Ga0207668_10044195 3300025972 Bacteria 3029
238 Ga0207668_10580458 3300025972 Bacteria 974
239 Ga0207640_10000015 3300025981 Bacteria 215411
240 Ga0207658_10001533 3300025986 Bacteria 17952
241 Ga0207658_10023756 3300025986 Bacteria 4282
242 Ga0207677_10000392 3300026023 Bacteria 30151
243 Ga0207677_10000821 3300026023 Bacteria 17760
244 Ga0207703_10000040 3300026035 Bacteria 168191
245 Ga0207703_10014850 3300026035 Bacteria 6078
246 Ga0207703_10128161 3300026035 Bacteria 2188
247 Ga0207639_10011619 3300026041 Bacteria 6119
248 Ga0207639_10044087 3300026041 Bacteria 3353
249 Ga0207639_10078135 3300026041 Bacteria 2611
250 Ga0207678_10000965 3300026067 Bacteria 26298
251 Ga0207678_10017172 3300026067 Bacteria 6353
252 Ga0207708_10010731 3300026075 Bacteria 6810
253 Ga0207702_10000016 3300026078 Bacteria 226633
254 Ga0207702_10012239 3300026078 Bacteria 7139
255 Ga0207702_10293130 3300026078 Bacteria 1542
256 Ga0207702_10314175 3300026078 Bacteria 1491
257 Ga0207702_10482975 3300026078 Bacteria 1206
258 Ga0207641_10000094 3300026088 Bacteria 124545
259 Ga0207641_10022402 3300026088 Bacteria 5201
260 Ga0207676_10000016 3300026095 Bacteria 311561
261 Ga0207675_100373128 3300026118 Bacteria 1402
262 Ga0207683_10049359 3300026121 Bacteria 3684
263 Ga0207683_10053995 3300026121 Bacteria 3523
264 Ga0207683_10248819 3300026121 Bacteria 1622
265 Ga0207698_10024398 3300026142 Bacteria 4244
266 Ga0207698_10237811 3300026142 Bacteria 1658
267 Ga0207698_10648387 3300026142 Bacteria 1046
268 Ga0207428_10020111 3300027907 Bacteria 5679
269 Ga0268266_10000085 3300028379 Bacteria 201288
270 Ga0268266_10012151 3300028379 Bacteria 7452
271 Ga0268266_10016714 3300028379 Bacteria 6272
272 Ga0268266_10046993 3300028379 Bacteria 3695
273 Ga0268265_10004381 3300028380 Bacteria 9813
274 Ga0268265_10418039 3300028380 Bacteria 1244
275 Ga0268264_10002386 3300028381 Bacteria 16562
276 Ga0268264_10531421 3300028381 Bacteria 1151
277 Ga0265319_1000025 3300028563 Bacteria 142639
278 Ga0265338_10000486 3300028800 Bacteria 70900
279 Ga0307413_10231805 3300031824 Bacteria 1357
280 Ga0307413_10669300 3300031824 Bacteria 858
281 Ga0307407_10426081 3300031903 Bacteria 957
282 Ga0307409_100006593 3300031995 Bacteria 6844
283 Ga0307409_100012316 3300031995 Bacteria 5445
284 Ga0307416_100004093 3300032002 Bacteria 8721
285 Ga0307416_100069010 3300032002 Bacteria 2923
286 Ga0307415_100243460 3300032126 Bacteria 1456
287 Ga0307415_100337501 3300032126 Bacteria 1263
288 Ga0316574_0047407 3300035398 Bacteria 2667
289 Ga0373925_0113370 3300037068 Bacteria 2097
290 Ga0395900_0255786 3300037418 Bacteria 1751
291 Ga0395900_0274135 3300037418 Bacteria 1681
292 Ga0451839_0988598 3300041496 Bacteria 867
293 Ga0451853_3221651 3300041512 Bacteria 929
294 Ga0466966_0055892 3300044684 Bacteria 2498
295 Ga0466963_0000312 3300044694 Bacteria 21872
296 Ga0466963_0023650 3300044694 Bacteria 3905
297 Ga0466963_0035111 3300044694 Bacteria 3265
298 Ga0466963_0451936 3300044694 Bacteria 907
299 Ga0466964_0083598 3300044706 Bacteria 1375
300 Ga0466957_0066244 3300044842 Bacteria 2226
301 Ga0466957_0131527 3300044842 Bacteria 1604
302 Ga0466960_0105417 3300044901 Bacteria 1457
303 Ga0466958_0040747 3300045836 Bacteria 2792
304 Ga0466967_0000033 3300045976 Bacteria 54859
305 Ga0466967_0146488 3300045976 Bacteria 2203
306 Ga0466967_0268156 3300045976 Bacteria 1635
307 Ga0466967_0292033 3300045976 Bacteria 1566
308 Ga0495603_0007993 3300046455 Bacteria 6385
309 Ga0495591_041366 3300046458 Bacteria 1309
310 Ga0495629_0006408 3300046459 Bacteria 8724
311 Ga0495629_0007203 3300046459 Bacteria 8190
312 Ga0495641_0006893 3300046461 Bacteria 7252
313 Ga0495641_0013209 3300046461 Bacteria 4555
314 Ga0495653_0358047 3300046463 Bacteria 937
315 Ga0495582_0006962 3300046473 Bacteria 6289
316 Ga0495662_0093522 3300046476 Bacteria 1467
317 Ga0495662_0325575 3300046476 Bacteria 756
318 Ga0495594_0000003 3300046499 Bacteria 199267
319 Ga0495594_0172051 3300046499 Bacteria 1232
320 Ga0495596_0104682 3300046500 Bacteria 1099
321 Ga0495606_0000221 3300046507 Bacteria 101157
322 Ga0495608_0000031 3300046511 Bacteria 145255
323 Ga0495618_0000004 3300046514 Bacteria 245690
324 Ga0495620_0000246 3300046515 Bacteria 40444
325 Ga0495628_0000595 3300046516 Bacteria 33337
326 Ga0495628_0022989 3300046516 Bacteria 5118
327 Ga0495628_0094633 3300046516 Bacteria 2309
328 Ga0495628_0183765 3300046516 Bacteria 1580
329 Ga0495630_0000018 3300046517 Bacteria 186064
330 Ga0495630_0027320 3300046517 Bacteria 4232
331 Ga0495652_0000019 3300046529 Bacteria 190248
332 Ga0495640_0014065 3300046533 Bacteria 6069
333 Ga0495587_0001523 3300046536 Bacteria 15407
334 Ga0495587_0077590 3300046536 Bacteria 1928
335 Ga0495598_0000203 3300046537 Bacteria 10475
336 Ga0495621_0001660 3300046539 Bacteria 5832
337 Ga0495622_0000014 3300046557 Bacteria 182142
338 Ga0495667_0000032 3300046559 Bacteria 143493
339 Ga0495668_0453962 3300046616 Bacteria 705
340 Ga0495634_0000050 3300046642 Bacteria 94546
341 Ga0495625_0000122 3300046660 Bacteria 121146
342 Ga0495588_0000376 3300046674 Bacteria 26068
343 Ga0495657_0000024 3300046675 Bacteria 145255
344 Ga0495599_0035946 3300046678 Bacteria 3109
345 Ga0495647_0000228 3300046681 Bacteria 15271
346 Ga0495658_0000025 3300046683 Bacteria 79910
347 Ga0495669_0000126 3300046684 Bacteria 48798
348 Ga0495669_0018686 3300046684 Bacteria 2982
349 Ga0495669_0033510 3300046684 Bacteria 2261
350 Ga0495613_0000152 3300046689 Bacteria 68384
351 Ga0495624_0000009 3300046690 Bacteria 145026
352 Ga0495624_0000037 3300046690 Bacteria 83796
353 Ga0495600_0070478 3300046809 Bacteria 2284
354 Ga0495600_0075269 3300046809 Bacteria 2205
355 Ga0495600_0170897 3300046809 Bacteria 1403
356 Ga0495604_0000038 3300047317 Bacteria 123703
357 Ga0495604_0000073 3300047317 Bacteria 86844
358 Ga0495604_0104449 3300047317 Bacteria 2076
359 Ga0495674_0000042 3300047319 Bacteria 94820
360 Ga0495674_0111902 3300047319 Bacteria 2314
361 Ga0495672_0031181 3300047320 Bacteria 3331
362 Ga0495672_0113523 3300047320 Bacteria 1451
363 Ga0495676_0001150 3300047321 Bacteria 22493
364 Ga0495676_0006325 3300047321 Bacteria 10903
365 Ga0495676_0027941 3300047321 Bacteria 4830
366 Ga0495676_0056484 3300047321 Bacteria 3104
367 Ga0495676_0200395 3300047321 Bacteria 1387
368 Ga0495680_0005346 3300047322 Bacteria 12116
369 Ga0495675_0000090 3300047444 Bacteria 63705
370 Ga0495675_0003673 3300047444 Bacteria 9275
371 Ga0495685_041322 3300047447 Bacteria 1576
372 Ga0495673_0059073 3300047469 Bacteria 1650
373 Ga0495593_0121148 3300047673 Bacteria 1331
374 Ga0495593_0203305 3300047673 Bacteria 995
375 Ga0495602_0001155 3300048088 Bacteria 25844
376 Ga0495614_0051308 3300048089 Bacteria 1768
377 Ga0496100_0000002 3300048903 Bacteria 489057
378 Ga0496100_0000038 3300048903 Bacteria 94110
379 Ga0496100_0269056 3300048903 Bacteria 1266
380 Ga0496101_0000001 3300048904 Bacteria 489057
381 Ga0496101_0000153 3300048904 Bacteria 59317
382 Ga0496101_0053959 3300048904 Bacteria 2901
383 Ga0496101_0078457 3300048904 Bacteria 2436
384 Ga0496102_0943011 3300048905 Bacteria 784
385 Ga0496103_0004880 3300048906 Bacteria 8101
386 Ga0496103_0075422 3300048906 Bacteria 2115
387 Ga0496103_0076257 3300048906 Bacteria 2103
388 Ga0496105_0000006 3300048908 Bacteria 393578
389 Ga0496105_0079564 3300048908 Bacteria 2707
390 Ga0496106_0000018 3300048909 Bacteria 175028
391 Ga0496106_0000022 3300048909 Bacteria 166339
392 Ga0496106_0000138 3300048909 Bacteria 54275
393 Ga0496106_0029896 3300048909 Bacteria 4061
394 Ga0496106_0034441 3300048909 Bacteria 3782
395 Ga0496106_0683083 3300048909 Unclassified 819
396 Ga0496106_0769575 3300048909 Bacteria 765
397 Ga0496107_0000006 3300048910 Bacteria 258746
398 Ga0496107_0000016 3300048910 Bacteria 172319
399 Ga0496107_0004661 3300048910 Bacteria 9306
400 Ga0496107_0060785 3300048910 Bacteria 2735
401 Ga0496107_0427057 3300048910 Bacteria 985
402 Ga0496108_0000107 3300048911 Bacteria 86395
403 Ga0496108_0000150 3300048911 Bacteria 67068
404 Ga0496108_0018497 3300048911 Bacteria 5706
405 Ga0496108_0045648 3300048911 Bacteria 3660
406 Ga0496109_0000007 3300048912 Bacteria 247554
407 Ga0496109_0000028 3300048912 Bacteria 168138
408 Ga0496109_0000190 3300048912 Bacteria 61169
409 Ga0496109_0000693 3300048912 Bacteria 28050
410 Ga0496109_0113848 3300048912 Bacteria 2516
411 Ga0496110_0001693 3300048913 Bacteria 16200
412 Ga0496110_0044429 3300048913 Bacteria 3880
413 Ga0496110_0048191 3300048913 Bacteria 3734
414 Ga0496110_0354377 3300048913 Bacteria 1337
415 Ga0496111_0021513 3300048914 Bacteria 4506
416 Ga0496111_0027521 3300048914 Bacteria 4022
417 Ga0496111_0039014 3300048914 Bacteria 3403
418 Ga0496112_0125426 3300048915 Bacteria 2538
419 Ga0496113_0082039 3300048916 Bacteria 2472
420 Ga0496113_0116488 3300048916 Bacteria 2085
421 Ga0496113_0165063 3300048916 Bacteria 1752
422 Ga0496113_0266292 3300048916 Bacteria 1369
423 Ga0496114_0018437 3300048917 Bacteria 5642
424 Ga0496114_0043059 3300048917 Bacteria 3744
425 Ga0496114_0231431 3300048917 Bacteria 1624
426 Ga0496115_0000316 3300048918 Bacteria 41025
427 Ga0496115_0086443 3300048918 Bacteria 2558
428 Ga0496116_0000769 3300048919 Bacteria 40716
429 Ga0496117_0001943 3300048920 Bacteria 27588
430 Ga0496119_0003085 3300048922 Bacteria 17574
431 Ga0496119_0025079 3300048922 Bacteria 4173
432 Ga0496120_0003588 3300048923 Bacteria 13945
433 Ga0496121_0004930 3300048924 Bacteria 17505
434 Ga0496121_0043578 3300048924 Bacteria 3884
435 Ga0496121_0219216 3300048924 Bacteria 1341
436 Ga0496124_0104348 3300048927 Bacteria 2292
437 Ga0496126_0081806 3300048929 Bacteria 2854
438 Ga0496126_0288616 3300048929 Bacteria 1357
439 Ga0501032_0065115 3300049569 Bacteria 2438
440 Ga0501033_0004761 3300049570 Bacteria 10847
441 Ga0501034_0059391 3300049571 Bacteria 3841
442 Ga0501034_0110742 3300049571 Bacteria 2736
443 Ga0501034_0111633 3300049571 Bacteria 2724
444 Ga0501036_0099620 3300049572 Bacteria 2457
445 Ga0501036_0603579 3300049572 Bacteria 910
446 Ga0501037_0388682 3300049573 Bacteria 958
447 Ga0501038_0066271 3300049574 Bacteria 3075
448 Ga0501039_0101035 3300049575 Bacteria 2251
449 Ga0501039_0217504 3300049575 Bacteria 1502
450 Ga0501040_0474519 3300049576 Bacteria 901
451 Ga0501042_0077912 3300049578 Bacteria 2374
452 Ga0501042_0160584 3300049578 Bacteria 1621
453 Ga0501043_0076045 3300049579 Bacteria 2637
454 Ga0501043_0394537 3300049579 Bacteria 1046
455 Ga0501046_0000162 3300049580 Bacteria 69629
456 Ga0501046_0549629 3300049580 Bacteria 823
457 Ga0501047_0000263 3300049581 Bacteria 61685
458 Ga0501047_0098610 3300049581 Bacteria 2800
459 Ga0501047_0132626 3300049581 Bacteria 2371
460 Ga0501048_0072361 3300049582 Bacteria 2433
461 Ga0501067_0002329 3300049583 Bacteria 10503
462 Ga0501067_0067574 3300049583 Bacteria 1979
463 Ga0501068_0076036 3300049584 Bacteria 2054
464 Ga0501068_0089799 3300049584 Bacteria 1895
465 Ga0501068_0129118 3300049584 Bacteria 1580
466 Ga0501068_0159406 3300049584 Bacteria 1422
467 Ga0501070_0001887 3300049586 Bacteria 18534
468 Ga0501070_0021753 3300049586 Bacteria 5375
469 Ga0501071_0120916 3300049587 Bacteria 1941
470 Ga0501071_0152022 3300049587 Bacteria 1727
471 Ga0501071_0237172 3300049587 Bacteria 1375
472 Ga0501072_0065291 3300049588 Bacteria 2870
473 Ga0501073_0072519 3300049589 Bacteria 2398
474 Ga0501074_0009267 3300049590 Bacteria 7150
475 Ga0501074_0253859 3300049590 Bacteria 1250
476 Ga0501074_0296545 3300049590 Bacteria 1148
477 Ga0501075_0021845 3300049591 Bacteria 4669
478 Ga0501076_0151600 3300049592 Bacteria 1886
479 Ga0501076_0501316 3300049592 Bacteria 1001
480 Ga0501079_0266326 3300049741 Bacteria 1339
481 Ga0501079_0273831 3300049741 Bacteria 1319
482 Ga0501081_0080884 3300049743 Bacteria 2275
483 Ga0501083_0056429 3300049744 Bacteria 2631
484 Ga0501083_0066187 3300049744 Bacteria 2406
485 Ga0501035_0000391 3300049822 Bacteria 50329
486 Ga0501035_0455326 3300049822 Bacteria 1058
487 Ga0501044_0003076 3300049823 Bacteria 18881
488 Ga0501044_0030206 3300049823 Bacteria 5712
489 Ga0501044_0030682 3300049823 Bacteria 5663
490 Ga0501045_0029512 3300049824 Bacteria 3965
491 nmdc:mga03n38_12578_c1 3300050490 Bacteria 3189
492 nmdc:mga00v17_263485_c1 3300050491 Bacteria 1118
493 nmdc:mga00v17_269744_c1 3300050491 Bacteria 1104
494 nmdc:mga00v17_67695_c1 3300050491 Bacteria 2207
495 nmdc:mga0yw44_157248_c1 3300050492 Bacteria 1486
496 nmdc:mga0yw44_173853_c1 3300050492 Bacteria 1415
497 nmdc:mga0yw44_199314_c1 3300050492 Bacteria 1322
498 nmdc:mga0yw44_36425_c1 3300050492 Bacteria 2899
499 nmdc:mga0yw44_41116_c1 3300050492 Bacteria 2750
500 nmdc:mga0yw44_517217_c1 3300050492 Bacteria 810
501 nmdc:mga0yw44_636979_c1 3300050492 Bacteria 724
502 nmdc:mga05p37_490020_c1 3300050507 Bacteria 1413
503 nmdc:mga09592_386919_c1 3300050508 Bacteria 1209
504 nmdc:mga0qj67_110266_c1 3300050509 Bacteria 2221
505 nmdc:mga0qj67_126729_c1 3300050509 Bacteria 2066
506 nmdc:mga06r32_2035_c1 3300050510 Bacteria 18077
507 nmdc:mga06r32_685514_c1 3300050510 Bacteria 991
508 nmdc:mga08y16_15591_c1 3300050511 Bacteria 7991
509 nmdc:mga0n895_198093_c1 3300050512 Bacteria 2040
510 nmdc:mga0rr50_101735_c1 3300050513 Bacteria 2259
511 nmdc:mga0rr50_262728_c1 3300050513 Bacteria 1436
512 nmdc:mga0rr50_357521_c1 3300050513 Bacteria 1229
513 nmdc:mga0a205_28171_c1 3300050515 Bacteria 3845
514 nmdc:mga0a205_3884_c1 3300050515 Bacteria 13377
515 Ga0495601_0000039 3300053077 Bacteria 79594
516 Ga0495601_0000126 3300053077 Bacteria 42871
517 Ga0495612_0000195 3300053078 Bacteria 25890
518 Ga0495612_0003451 3300053078 Bacteria 6551
519 Ga0495612_0007882 3300053078 Bacteria 4342
520 Ga0495612_0012840 3300053078 Bacteria 3376
521 Ga0495595_0000014 3300053084 Bacteria 145255
522 Ga0495619_0000021 3300053085 Bacteria 187095
523 Ga0495619_0000114 3300053085 Bacteria 59624
524 Ga0495619_0000135 3300053085 Bacteria 54848
525 Ga0495619_0014237 3300053085 Bacteria 5024
526 Ga0500566_0019922 3300053094 Bacteria 3938
527 Ga0500595_005432 3300053119 Bacteria 5563
528 Ga0501084_0047868 3300054114 Bacteria 3580
529 Ga0501084_0450216 3300054114 Bacteria 1088
530 Ga0501084_0898194 3300054114 Bacteria 745
531 Ga0501082_0030821 3300060353 Bacteria 4623
532 Ga0501082_0106259 3300060353 Bacteria 2428
533 Ga0501082_0514708 3300060353 Bacteria 1046
534 Ga0530510_0033777 3300061734 Bacteria 3683
535 Ga0530510_0165866 3300061734 Bacteria 1635

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005718 Ga0068866_10023383 Ga0068866_100233834 165
2 3300035398 Ga0316574_0047407 Ga0316574_0047407_538_1278 166
3 3300050492 nmdc:mga0yw44_36425_c1 nmdc:mga0yw44_36425_c1_553_1311 167
4 3300005530 Ga0070679_100135888 Ga0070679_1001358884 171
5 3300020081 Ga0206354_11582559 Ga0206354_115825592 171
6 3300025921 Ga0207652_10313304 Ga0207652_103133041 171
7 3300044694 Ga0466963_0451936 Ga0466963_0451936_112_804 171
8 3300005985 Ga0081539_10004902 Ga0081539_100049024 172
9 3300044684 Ga0466966_0055892 Ga0466966_0055892_742_1332 172
10 3300044694 Ga0466963_0023650 Ga0466963_0023650_154_834 172
11 3300005344 Ga0070661_100395489 Ga0070661_1003954892 173
12 3300005564 Ga0070664_100414037 Ga0070664_1004140372 173
13 3300025945 Ga0207679_10119171 Ga0207679_101191712 173
14 3300026142 Ga0207698_10648387 Ga0207698_106483871 173
15 3300045976 Ga0466967_0146488 Ga0466967_0146488_819_1511 173
16 3300005366 Ga0070659_100422934 Ga0070659_1004229342 174
17 3300005548 Ga0070665_100000776 Ga0070665_1000007767 174
18 3300005985 Ga0081539_10058038 Ga0081539_100580382 174
19 3300025909 Ga0207705_10231880 Ga0207705_102318802 174
20 3300025932 Ga0207690_10392888 Ga0207690_103928882 174
21 3300028379 Ga0268266_10016714 Ga0268266_100167142 174
22 3300045976 Ga0466967_0268156 Ga0466967_0268156_449_1120 174
23 3300047320 Ga0495672_0031181 Ga0495672_0031181_2581_3261 174
24 3300005336 Ga0070680_100283461 Ga0070680_1002834612 175
25 3300005535 Ga0070684_100030694 Ga0070684_1000306945 175
26 3300048917 Ga0496114_0231431 Ga0496114_0231431_289_987 175
27 3300037418 Ga0395900_0255786 Ga0395900_0255786_89_682 177
28 3300048912 Ga0496109_0000693 Ga0496109_0000693_9709_10449 177
29 3300009148 Ga0105243_10010482 Ga0105243_100104825 178
30 3300050491 nmdc:mga00v17_263485_c1 nmdc:mga00v17_263485_c1_25_621 178
31 3300031824 Ga0307413_10231805 Ga0307413_102318052 179
32 3300031824 Ga0307413_10669300 Ga0307413_106693001 179
33 3300031903 Ga0307407_10426081 Ga0307407_104260811 179
34 3300031995 Ga0307409_100012316 Ga0307409_1000123164 179
35 3300032002 Ga0307416_100069010 Ga0307416_1000690102 179
36 3300032126 Ga0307415_100337501 Ga0307415_1003375012 179
37 3300005983 Ga0081540_1006334 Ga0081540_10063342 180
38 3300005981 Ga0081538_10067285 Ga0081538_100672852 181
39 3300049584 Ga0501068_0129118 Ga0501068_0129118_280_966 181
40 3300048909 Ga0496106_0769575 Ga0496106_0769575_24_632 182
41 3300049592 Ga0501076_0151600 Ga0501076_0151600_340_948 182
42 3300049743 Ga0501081_0080884 Ga0501081_0080884_973_1581 182
43 3300054114 Ga0501084_0898194 Ga0501084_0898194_63_671 182
44 3300061734 Ga0530510_0165866 Ga0530510_0165866_267_875 182
45 3300006038 Ga0075365_10072512 Ga0075365_100725123 183
46 3300006051 Ga0075364_10217894 Ga0075364_102178941 183
47 3300048905 Ga0496102_0943011 Ga0496102_0943011_39_686 183
48 3300009147 Ga0114129_10153933 Ga0114129_101539332 184
49 3300041496 Ga0451839_0988598 Ga0451839_0988598_181_798 184
50 3300046459 Ga0495629_0006408 Ga0495629_0006408_4298_4966 184
51 3300048910 Ga0496107_0060785 Ga0496107_0060785_172_801 184
52 3300049573 Ga0501037_0388682 Ga0501037_0388682_38_655 184
53 3300050507 nmdc:mga05p37_490020_c1 nmdc:mga05p37_490020_c1_134_763 184
54 3300050513 nmdc:mga0rr50_357521_c1 nmdc:mga0rr50_357521_c1_482_1111 184
55 3300053094 Ga0500566_0019922 Ga0500566_0019922_1133_1801 184
56 3300005341 Ga0070691_10004831 Ga0070691_100048315 185
57 3300009094 Ga0111539_10134875 Ga0111539_101348752 185
58 3300044901 Ga0466960_0105417 Ga0466960_0105417_584_1204 185
59 3300046642 Ga0495634_0000050 Ga0495634_0000050_77551_78171 185
60 3300050492 nmdc:mga0yw44_636979_c1 nmdc:mga0yw44_636979_c1_59_676 185
61 3300053078 Ga0495612_0007882 Ga0495612_0007882_325_966 185
62 3300046500 Ga0495596_0104682 Ga0495596_0104682_302_955 186
63 3300048923 Ga0496120_0003588 Ga0496120_0003588_6035_6754 186
64 3300049571 Ga0501034_0110742 Ga0501034_0110742_1013_1636 186
65 3300049581 Ga0501047_0098610 Ga0501047_0098610_1182_1805 186
66 3300049583 Ga0501067_0002329 Ga0501067_0002329_5496_6116 186
67 3300049822 Ga0501035_0455326 Ga0501035_0455326_101_724 186
68 3300049823 Ga0501044_0030206 Ga0501044_0030206_406_1029 186
69 3300050510 nmdc:mga06r32_2035_c1 nmdc:mga06r32_2035_c1_11326_11973 186
70 3300050511 nmdc:mga08y16_15591_c1 nmdc:mga08y16_15591_c1_1324_1971 186
71 3300050512 nmdc:mga0n895_198093_c1 nmdc:mga0n895_198093_c1_1235_1879 186
72 3300050513 nmdc:mga0rr50_101735_c1 nmdc:mga0rr50_101735_c1_415_1059 186
73 3300050515 nmdc:mga0a205_28171_c1 nmdc:mga0a205_28171_c1_882_1526 186
74 3300005937 Ga0081455_10162209 Ga0081455_101622092 187
75 3300006038 Ga0075365_10214602 Ga0075365_102146022 187
76 3300031995 Ga0307409_100006593 Ga0307409_1000065933 187
77 3300032002 Ga0307416_100004093 Ga0307416_10000409310 187
78 3300032126 Ga0307415_100243460 Ga0307415_1002434601 187
79 3300050491 nmdc:mga00v17_67695_c1 nmdc:mga00v17_67695_c1_688_1446 187
80 3300005347 Ga0070668_100395499 Ga0070668_1003954991 188
81 3300005937 Ga0081455_10080576 Ga0081455_100805762 188
82 3300009551 Ga0105238_10650894 Ga0105238_106508942 188
83 3300025903 Ga0207680_10005946 Ga0207680_100059463 188
84 3300046536 Ga0495587_0077590 Ga0495587_0077590_312_971 188
85 3300046559 Ga0495667_0000032 Ga0495667_0000032_137204_137872 188
86 3300047322 Ga0495680_0005346 Ga0495680_0005346_10506_11174 188
87 3300048908 Ga0496105_0079564 Ga0496105_0079564_571_1257 188
88 3300048910 Ga0496107_0427057 Ga0496107_0427057_172_858 188
89 3300048922 Ga0496119_0025079 Ga0496119_0025079_3370_4056 188
90 3300048924 Ga0496121_0043578 Ga0496121_0043578_3094_3780 188
91 3300049569 Ga0501032_0065115 Ga0501032_0065115_1593_2327 188
92 3300049570 Ga0501033_0004761 Ga0501033_0004761_10007_10741 188
93 3300049571 Ga0501034_0111633 Ga0501034_0111633_386_1120 188
94 3300049572 Ga0501036_0099620 Ga0501036_0099620_97_831 188
95 3300049574 Ga0501038_0066271 Ga0501038_0066271_1611_2345 188
96 3300049575 Ga0501039_0101035 Ga0501039_0101035_65_799 188
97 3300049579 Ga0501043_0076045 Ga0501043_0076045_334_1068 188
98 3300049580 Ga0501046_0000162 Ga0501046_0000162_1613_2347 188
99 3300049581 Ga0501047_0000263 Ga0501047_0000263_1627_2361 188
100 3300049582 Ga0501048_0072361 Ga0501048_0072361_96_830 188
101 3300049584 Ga0501068_0076036 Ga0501068_0076036_67_801 188
102 3300049586 Ga0501070_0001887 Ga0501070_0001887_1631_2365 188
103 3300049587 Ga0501071_0152022 Ga0501071_0152022_889_1623 188
104 3300049589 Ga0501073_0072519 Ga0501073_0072519_69_803 188
105 3300049590 Ga0501074_0009267 Ga0501074_0009267_3086_3820 188
106 3300049590 Ga0501074_0253859 Ga0501074_0253859_398_1099 188
107 3300049741 Ga0501079_0273831 Ga0501079_0273831_105_839 188
108 3300049744 Ga0501083_0066187 Ga0501083_0066187_70_804 188
109 3300049822 Ga0501035_0000391 Ga0501035_0000391_47987_48721 188
110 3300049823 Ga0501044_0003076 Ga0501044_0003076_1633_2367 188
111 3300050492 nmdc:mga0yw44_199314_c1 nmdc:mga0yw44_199314_c1_465_1202 188
112 3300054114 Ga0501084_0450216 Ga0501084_0450216_93_827 188
113 3300060353 Ga0501082_0106259 Ga0501082_0106259_106_840 188
114 3300005841 Ga0068863_100000021 Ga0068863_10000002127 189
115 3300025935 Ga0207709_10023271 Ga0207709_100232712 189
116 3300026088 Ga0207641_10000094 Ga0207641_1000009471 189
117 3300046539 Ga0495621_0001660 Ga0495621_0001660_2095_2727 189
118 3300046690 Ga0495624_0000037 Ga0495624_0000037_18501_19136 189
119 3300048906 Ga0496103_0076257 Ga0496103_0076257_1070_1774 189
120 3300048924 Ga0496121_0219216 Ga0496121_0219216_111_803 189
121 3300048927 Ga0496124_0104348 Ga0496124_0104348_1270_1974 189
122 3300048929 Ga0496126_0288616 Ga0496126_0288616_395_1099 189
123 3300049576 Ga0501040_0474519 Ga0501040_0474519_51_839 189
124 3300049744 Ga0501083_0056429 Ga0501083_0056429_505_1197 189
125 3300053078 Ga0495612_0012840 Ga0495612_0012840_1303_1938 189
126 3300060353 Ga0501082_0514708 Ga0501082_0514708_287_979 189
127 3300005337 Ga0070682_100016042 Ga0070682_1000160425 190
128 3300005345 Ga0070692_10043138 Ga0070692_100431383 190
129 3300005354 Ga0070675_100064623 Ga0070675_1000646232 190
130 3300005356 Ga0070674_100023380 Ga0070674_1000233805 190
131 3300005365 Ga0070688_100000012 Ga0070688_10000001247 190
132 3300005365 Ga0070688_100142726 Ga0070688_1001427263 190
133 3300005438 Ga0070701_10019776 Ga0070701_100197764 190
134 3300005439 Ga0070711_100037171 Ga0070711_1000371712 190
135 3300005455 Ga0070663_100009785 Ga0070663_1000097855 190
136 3300005456 Ga0070678_100250943 Ga0070678_1002509432 190
137 3300005466 Ga0070685_10000142 Ga0070685_1000014212 190
138 3300005466 Ga0070685_10061070 Ga0070685_100610701 190
139 3300005530 Ga0070679_100261196 Ga0070679_1002611963 190
140 3300005535 Ga0070684_100243693 Ga0070684_1002436933 190
141 3300005539 Ga0068853_100067597 Ga0068853_1000675972 190
142 3300005544 Ga0070686_100034395 Ga0070686_1000343954 190
143 3300005545 Ga0070695_100379688 Ga0070695_1003796882 190
144 3300005564 Ga0070664_100158166 Ga0070664_1001581662 190
145 3300005577 Ga0068857_100249196 Ga0068857_1002491963 190
146 3300005614 Ga0068856_101381778 Ga0068856_1013817781 190
147 3300005615 Ga0070702_100234708 Ga0070702_1002347081 190
148 3300005616 Ga0068852_100163618 Ga0068852_1001636182 190
149 3300005719 Ga0068861_100349156 Ga0068861_1003491562 190
150 3300005834 Ga0068851_10011865 Ga0068851_100118655 190
151 3300005842 Ga0068858_100107826 Ga0068858_1001078262 190
152 3300005843 Ga0068860_100075496 Ga0068860_1000754964 190
153 3300005937 Ga0081455_10164927 Ga0081455_101649272 190
154 3300006038 Ga0075365_10276546 Ga0075365_102765461 190
155 3300006048 Ga0075363_100019275 Ga0075363_1000192751 190
156 3300006051 Ga0075364_10012215 Ga0075364_100122153 190
157 3300006163 Ga0070715_10058183 Ga0070715_100581832 190
158 3300006173 Ga0070716_100298653 Ga0070716_1002986531 190
159 3300006175 Ga0070712_100356383 Ga0070712_1003563832 190
160 3300006881 Ga0068865_100194176 Ga0068865_1001941762 190
161 3300007076 Ga0075435_100460474 Ga0075435_1004604741 190
162 3300009098 Ga0105245_10011890 Ga0105245_100118909 190
163 3300009148 Ga0105243_10014733 Ga0105243_100147335 190
164 3300009148 Ga0105243_10332854 Ga0105243_103328542 190
165 3300009177 Ga0105248_10213460 Ga0105248_102134602 190
166 3300009553 Ga0105249_10967641 Ga0105249_109676411 190
167 3300009553 Ga0105249_11009895 Ga0105249_110098952 190
168 3300010375 Ga0105239_10054592 Ga0105239_100545924 190
169 3300013306 Ga0163162_10329846 Ga0163162_103298462 190
170 3300013308 Ga0157375_10217413 Ga0157375_102174133 190
171 3300014326 Ga0157380_10030540 Ga0157380_100305403 190
172 3300014745 Ga0157377_10012521 Ga0157377_100125214 190
173 3300014745 Ga0157377_10475511 Ga0157377_104755111 190
174 3300025901 Ga0207688_10137767 Ga0207688_101377672 190
175 3300025909 Ga0207705_10067792 Ga0207705_100677923 190
176 3300025921 Ga0207652_10286443 Ga0207652_102864433 190
177 3300025926 Ga0207659_10054482 Ga0207659_100544824 190
178 3300025927 Ga0207687_10139451 Ga0207687_101394512 190
179 3300025934 Ga0207686_10612009 Ga0207686_106120092 190
180 3300025935 Ga0207709_10010539 Ga0207709_100105395 190
181 3300025937 Ga0207669_10004394 Ga0207669_100043944 190
182 3300025938 Ga0207704_10161763 Ga0207704_101617632 190
183 3300025939 Ga0207665_10253483 Ga0207665_102534832 190
184 3300025940 Ga0207691_10009388 Ga0207691_100093885 190
185 3300025945 Ga0207679_10149061 Ga0207679_101490613 190
186 3300026035 Ga0207703_10128161 Ga0207703_101281613 190
187 3300026041 Ga0207639_10044087 Ga0207639_100440874 190
188 3300026067 Ga0207678_10017172 Ga0207678_100171725 190
189 3300026075 Ga0207708_10010731 Ga0207708_100107315 190
190 3300026078 Ga0207702_10314175 Ga0207702_103141752 190
191 3300026118 Ga0207675_100373128 Ga0207675_1003731282 190
192 3300026121 Ga0207683_10049359 Ga0207683_100493593 190
193 3300026121 Ga0207683_10248819 Ga0207683_102488192 190
194 3300026142 Ga0207698_10024398 Ga0207698_100243985 190
195 3300028380 Ga0268265_10418039 Ga0268265_104180392 190
196 3300037068 Ga0373925_0113370 Ga0373925_0113370_1121_1756 190
197 3300046458 Ga0495591_041366 Ga0495591_041366_432_1091 190
198 3300046461 Ga0495641_0013209 Ga0495641_0013209_3782_4417 190
199 3300046473 Ga0495582_0006962 Ga0495582_0006962_4040_4675 190
200 3300046499 Ga0495594_0172051 Ga0495594_0172051_320_955 190
201 3300047321 Ga0495676_0001150 Ga0495676_0001150_7760_8431 190
202 3300047321 Ga0495676_0027941 Ga0495676_0027941_527_1162 190
203 3300048089 Ga0495614_0051308 Ga0495614_0051308_77_712 190
204 3300048903 Ga0496100_0000038 Ga0496100_0000038_28253_28912 190
205 3300048903 Ga0496100_0269056 Ga0496100_0269056_265_900 190
206 3300048904 Ga0496101_0000153 Ga0496101_0000153_18481_19140 190
207 3300048904 Ga0496101_0053959 Ga0496101_0053959_1914_2549 190
208 3300048904 Ga0496101_0078457 Ga0496101_0078457_1108_1845 190
209 3300048906 Ga0496103_0004880 Ga0496103_0004880_887_1522 190
210 3300048909 Ga0496106_0000018 Ga0496106_0000018_113451_114110 190
211 3300048909 Ga0496106_0000138 Ga0496106_0000138_50393_51058 190
212 3300048909 Ga0496106_0029896 Ga0496106_0029896_1294_1929 190
213 3300048909 Ga0496106_0034441 Ga0496106_0034441_145_882 190
214 3300048910 Ga0496107_0000006 Ga0496107_0000006_40157_40816 190
215 3300048910 Ga0496107_0004661 Ga0496107_0004661_6783_7418 190
216 3300048911 Ga0496108_0045648 Ga0496108_0045648_1011_1748 190
217 3300048912 Ga0496109_0113848 Ga0496109_0113848_671_1306 190
218 3300048913 Ga0496110_0048191 Ga0496110_0048191_638_1273 190
219 3300048914 Ga0496111_0027521 Ga0496111_0027521_3035_3670 190
220 3300048915 Ga0496112_0125426 Ga0496112_0125426_1419_2054 190
221 3300048916 Ga0496113_0082039 Ga0496113_0082039_367_1002 190
222 3300048916 Ga0496113_0165063 Ga0496113_0165063_60_797 190
223 3300048917 Ga0496114_0018437 Ga0496114_0018437_1458_2093 190
224 3300048918 Ga0496115_0086443 Ga0496115_0086443_1560_2195 190
225 3300050492 nmdc:mga0yw44_173853_c1 nmdc:mga0yw44_173853_c1_40_675 190
226 3300050492 nmdc:mga0yw44_517217_c1 nmdc:mga0yw44_517217_c1_50_778 190
227 3300050513 nmdc:mga0rr50_262728_c1 nmdc:mga0rr50_262728_c1_97_756 190
228 3300005406 Ga0070703_10027432 Ga0070703_100274322 191
229 3300025885 Ga0207653_10021814 Ga0207653_100218142 191
230 3300045976 Ga0466967_0292033 Ga0466967_0292033_912_1550 191
231 3300048909 Ga0496106_0683083 Ga0496106_0683083_82_723 191
232 3300049578 Ga0501042_0160584 Ga0501042_0160584_53_700 191
233 3300049580 Ga0501046_0549629 Ga0501046_0549629_164_811 191
234 3300049586 Ga0501070_0021753 Ga0501070_0021753_3423_4154 191
235 3300049588 Ga0501072_0065291 Ga0501072_0065291_577_1224 191
236 3300049591 Ga0501075_0021845 Ga0501075_0021845_1282_1929 191
237 3300049824 Ga0501045_0029512 Ga0501045_0029512_2389_3036 191
238 3300054114 Ga0501084_0047868 Ga0501084_0047868_677_1324 191
239 3300060353 Ga0501082_0030821 Ga0501082_0030821_2405_3052 191
240 3300061734 Ga0530510_0033777 Ga0530510_0033777_2132_2779 191
241 3300005338 Ga0068868_100004773 Ga0068868_1000047735 192
242 3300005366 Ga0070659_100118051 Ga0070659_1001180513 192
243 3300005547 Ga0070693_100001370 Ga0070693_10000137012 192
244 3300005616 Ga0068852_100125447 Ga0068852_1001254473 192
245 3300006847 Ga0075431_100536773 Ga0075431_1005367732 192
246 3300025932 Ga0207690_10091435 Ga0207690_100914352 192
247 3300026023 Ga0207677_10000821 Ga0207677_100008215 192
248 3300026142 Ga0207698_10237811 Ga0207698_102378112 192
249 3300050492 nmdc:mga0yw44_157248_c1 nmdc:mga0yw44_157248_c1_529_1170 192
250 3300050510 nmdc:mga06r32_685514_c1 nmdc:mga06r32_685514_c1_268_912 192
251 3300005834 Ga0068851_10107938 Ga0068851_101079383 193
252 3300025321 Ga0207656_10027041 Ga0207656_100270413 193
253 3300047320 Ga0495672_0113523 Ga0495672_0113523_247_894 193
254 3300047321 Ga0495676_0200395 Ga0495676_0200395_600_1265 193
255 3300053119 Ga0500595_005432 Ga0500595_005432_4637_5314 193
256 3300005329 Ga0070683_100295190 Ga0070683_1002951902 194
257 3300005937 Ga0081455_10022369 Ga0081455_100223699 194
258 3300005985 Ga0081539_10001003 Ga0081539_1000100345 194
259 3300006846 Ga0075430_100157036 Ga0075430_1001570362 194
260 3300009176 Ga0105242_10003600 Ga0105242_100036007 194
261 3300025934 Ga0207686_10000859 Ga0207686_1000085915 194
262 3300025945 Ga0207679_10486131 Ga0207679_104861312 194
263 3300044706 Ga0466964_0083598 Ga0466964_0083598_46_765 194
264 3300046463 Ga0495653_0358047 Ga0495653_0358047_183_839 194
265 3300046516 Ga0495628_0094633 Ga0495628_0094633_868_1524 194
266 3300046533 Ga0495640_0014065 Ga0495640_0014065_722_1369 194
267 3300046809 Ga0495600_0070478 Ga0495600_0070478_1037_1693 194
268 3300046809 Ga0495600_0170897 Ga0495600_0170897_20_676 194
269 3300047317 Ga0495604_0104449 Ga0495604_0104449_1342_1998 194
270 3300047319 Ga0495674_0000042 Ga0495674_0000042_82449_83096 194
271 3300047319 Ga0495674_0111902 Ga0495674_0111902_778_1434 194
272 3300047321 Ga0495676_0056484 Ga0495676_0056484_1843_2496 194
273 3300048913 Ga0496110_0001693 Ga0496110_0001693_4683_5339 194
274 3300048914 Ga0496111_0039014 Ga0496111_0039014_1353_2009 194
275 3300049578 Ga0501042_0077912 Ga0501042_0077912_960_1616 194
276 3300049587 Ga0501071_0237172 Ga0501071_0237172_426_1091 194
277 3300050492 nmdc:mga0yw44_41116_c1 nmdc:mga0yw44_41116_c1_1436_2086 194
278 3300050509 nmdc:mga0qj67_110266_c1 nmdc:mga0qj67_110266_c1_1016_1663 194
279 3300053078 Ga0495612_0000195 Ga0495612_0000195_10599_11255 194
280 3300053085 Ga0495619_0014237 Ga0495619_0014237_1418_2074 194
281 3300003373 JGI25407J50210_10012274 JGI25407J50210_100122742 195
282 3300005338 Ga0068868_100004331 Ga0068868_1000043314 195
283 3300005548 Ga0070665_100130454 Ga0070665_1001304543 195
284 3300005841 Ga0068863_100038925 Ga0068863_1000389253 195
285 3300005842 Ga0068858_100025383 Ga0068858_1000253832 195
286 3300005981 Ga0081538_10000030 Ga0081538_1000003068 195
287 3300006852 Ga0075433_10122016 Ga0075433_101220161 195
288 3300025916 Ga0207663_10087442 Ga0207663_100874423 195
289 3300025927 Ga0207687_10250988 Ga0207687_102509881 195
290 3300025931 Ga0207644_10301525 Ga0207644_103015252 195
291 3300025972 Ga0207668_10044195 Ga0207668_100441954 195
292 3300026023 Ga0207677_10000392 Ga0207677_1000039212 195
293 3300026035 Ga0207703_10014850 Ga0207703_100148507 195
294 3300026088 Ga0207641_10022402 Ga0207641_100224025 195
295 3300028379 Ga0268266_10012151 Ga0268266_100121514 195
296 3300041512 Ga0451853_3221651 Ga0451853_3221651_52_705 195
297 3300046536 Ga0495587_0001523 Ga0495587_0001523_6035_6682 195
298 3300046660 Ga0495625_0000122 Ga0495625_0000122_62841_63488 195
299 3300047673 Ga0495593_0203305 Ga0495593_0203305_203_859 195
300 3300049571 Ga0501034_0059391 Ga0501034_0059391_2219_2872 195
301 3300049572 Ga0501036_0603579 Ga0501036_0603579_112_798 195
302 3300049575 Ga0501039_0217504 Ga0501039_0217504_16_702 195
303 3300049584 Ga0501068_0159406 Ga0501068_0159406_123_773 195
304 3300005331 Ga0070670_100147222 Ga0070670_1001472221 196
305 3300005364 Ga0070673_100169977 Ga0070673_1001699772 196
306 3300005367 Ga0070667_100001647 Ga0070667_1000016476 196
307 3300005548 Ga0070665_100703241 Ga0070665_1007032411 196
308 3300005843 Ga0068860_100381944 Ga0068860_1003819441 196
309 3300005844 Ga0068862_100002701 Ga0068862_1000027014 196
310 3300006163 Ga0070715_10188392 Ga0070715_101883921 196
311 3300006178 Ga0075367_10025801 Ga0075367_100258012 196
312 3300006846 Ga0075430_100014638 Ga0075430_1000146388 196
313 3300009553 Ga0105249_10000074 Ga0105249_10000074141 196
314 3300009553 Ga0105249_10028847 Ga0105249_100288475 196
315 3300013102 Ga0157371_10013940 Ga0157371_100139405 196
316 3300014968 Ga0157379_10004315 Ga0157379_100043152 196
317 3300025911 Ga0207654_10212095 Ga0207654_102120951 196
318 3300025925 Ga0207650_10106478 Ga0207650_101064782 196
319 3300025960 Ga0207651_10112095 Ga0207651_101120953 196
320 3300025961 Ga0207712_10000007 Ga0207712_10000007144 196
321 3300025961 Ga0207712_10133084 Ga0207712_101330842 196
322 3300025972 Ga0207668_10580458 Ga0207668_105804581 196
323 3300025986 Ga0207658_10001533 Ga0207658_100015334 196
324 3300028380 Ga0268265_10004381 Ga0268265_100043814 196
325 3300028381 Ga0268264_10531421 Ga0268264_105314211 196
326 3300044694 Ga0466963_0035111 Ga0466963_0035111_1013_1675 196
327 3300046499 Ga0495594_0000003 Ga0495594_0000003_14058_14711 196
328 3300046515 Ga0495620_0000246 Ga0495620_0000246_30541_31197 196
329 3300046557 Ga0495622_0000014 Ga0495622_0000014_57885_58535 196
330 3300046684 Ga0495669_0000126 Ga0495669_0000126_23080_23733 196
331 3300048913 Ga0496110_0354377 Ga0496110_0354377_436_1092 196
332 3300050490 nmdc:mga03n38_12578_c1 nmdc:mga03n38_12578_c1_2188_2844 196
333 3300050491 nmdc:mga00v17_269744_c1 nmdc:mga00v17_269744_c1_80_736 196
334 3300050508 nmdc:mga09592_386919_c1 nmdc:mga09592_386919_c1_412_1095 196
335 3300050509 nmdc:mga0qj67_126729_c1 nmdc:mga0qj67_126729_c1_346_1029 196
336 3300053085 Ga0495619_0000135 Ga0495619_0000135_20413_21069 196
337 3300002074 JGI24748J21848_1000299 JGI24748J21848_10002996 197
338 3300002239 JGI24034J26672_10000180 JGI24034J26672_100001802 197
339 3300005329 Ga0070683_100003289 Ga0070683_10000328914 197
340 3300005329 Ga0070683_100006767 Ga0070683_1000067676 197
341 3300005337 Ga0070682_100000013 Ga0070682_100000013229 197
342 3300005344 Ga0070661_100000599 Ga0070661_1000005995 197
343 3300005354 Ga0070675_100000053 Ga0070675_1000000538 197
344 3300005356 Ga0070674_100040199 Ga0070674_1000401992 197
345 3300005365 Ga0070688_100000269 Ga0070688_1000002699 197
346 3300005456 Ga0070678_100663268 Ga0070678_1006632681 197
347 3300005458 Ga0070681_10032650 Ga0070681_100326504 197
348 3300005466 Ga0070685_10000018 Ga0070685_1000001851 197
349 3300005530 Ga0070679_100018917 Ga0070679_1000189174 197
350 3300005535 Ga0070684_100107492 Ga0070684_1001074922 197
351 3300005578 Ga0068854_100000031 Ga0068854_10000003123 197
352 3300005614 Ga0068856_100015030 Ga0068856_1000150306 197
353 3300005614 Ga0068856_100073883 Ga0068856_1000738834 197
354 3300005842 Ga0068858_100000109 Ga0068858_10000010943 197
355 3300006852 Ga0075433_10011635 Ga0075433_100116357 197
356 3300006871 Ga0075434_100206282 Ga0075434_1002062822 197
357 3300006881 Ga0068865_100000301 Ga0068865_10000030129 197
358 3300009098 Ga0105245_10014301 Ga0105245_100143013 197
359 3300009176 Ga0105242_10048894 Ga0105242_100488942 197
360 3300009177 Ga0105248_10000032 Ga0105248_10000032196 197
361 3300010375 Ga0105239_10428672 Ga0105239_104286723 197
362 3300013104 Ga0157370_10003066 Ga0157370_1000306612 197
363 3300013104 Ga0157370_10069893 Ga0157370_100698932 197
364 3300013297 Ga0157378_10002558 Ga0157378_100025583 197
365 3300013307 Ga0157372_10000308 Ga0157372_1000030834 197
366 3300013308 Ga0157375_10004976 Ga0157375_1000497612 197
367 3300025321 Ga0207656_10000321 Ga0207656_100003215 197
368 3300025903 Ga0207680_10010817 Ga0207680_100108173 197
369 3300025908 Ga0207643_10027450 Ga0207643_100274504 197
370 3300025912 Ga0207707_10017275 Ga0207707_100172754 197
371 3300025915 Ga0207693_10007556 Ga0207693_100075565 197
372 3300025920 Ga0207649_10000076 Ga0207649_1000007635 197
373 3300025921 Ga0207652_10012858 Ga0207652_100128584 197
374 3300025926 Ga0207659_10000010 Ga0207659_10000010291 197
375 3300025927 Ga0207687_10005996 Ga0207687_100059966 197
376 3300025928 Ga0207700_10529288 Ga0207700_105292882 197
377 3300025937 Ga0207669_10331622 Ga0207669_103316222 197
378 3300025938 Ga0207704_10000720 Ga0207704_100007208 197
379 3300025941 Ga0207711_10000020 Ga0207711_10000020178 197
380 3300025944 Ga0207661_10000403 Ga0207661_100004037 197
381 3300025944 Ga0207661_10004642 Ga0207661_100046426 197
382 3300025981 Ga0207640_10000015 Ga0207640_10000015192 197
383 3300026035 Ga0207703_10000040 Ga0207703_1000004049 197
384 3300026041 Ga0207639_10011619 Ga0207639_100116194 197
385 3300026078 Ga0207702_10000016 Ga0207702_10000016166 197
386 3300026078 Ga0207702_10012239 Ga0207702_100122396 197
387 3300026095 Ga0207676_10000016 Ga0207676_10000016178 197
388 3300027907 Ga0207428_10020111 Ga0207428_100201116 197
389 3300028563 Ga0265319_1000025 Ga0265319_1000025146 197
390 3300028800 Ga0265338_10000486 Ga0265338_100004867 197
391 3300044694 Ga0466963_0000312 Ga0466963_0000312_10366_11022 197
392 3300044842 Ga0466957_0131527 Ga0466957_0131527_891_1550 197
393 3300045976 Ga0466967_0000033 Ga0466967_0000033_37314_37979 197
394 3300046476 Ga0495662_0093522 Ga0495662_0093522_161_814 197
395 3300046511 Ga0495608_0000031 Ga0495608_0000031_75542_76201 197
396 3300046516 Ga0495628_0000595 Ga0495628_0000595_25732_26388 197
397 3300046529 Ga0495652_0000019 Ga0495652_0000019_159957_160613 197
398 3300046537 Ga0495598_0000203 Ga0495598_0000203_7839_8498 197
399 3300046675 Ga0495657_0000024 Ga0495657_0000024_75542_76201 197
400 3300046678 Ga0495599_0035946 Ga0495599_0035946_1627_2283 197
401 3300046684 Ga0495669_0033510 Ga0495669_0033510_905_1561 197
402 3300046809 Ga0495600_0075269 Ga0495600_0075269_1214_1873 197
403 3300047317 Ga0495604_0000073 Ga0495604_0000073_70953_71612 197
404 3300047321 Ga0495676_0006325 Ga0495676_0006325_8003_8659 197
405 3300047444 Ga0495675_0000090 Ga0495675_0000090_30157_30816 197
406 3300048088 Ga0495602_0001155 Ga0495602_0001155_9620_10276 197
407 3300048903 Ga0496100_0000002 Ga0496100_0000002_139246_139902 197
408 3300048904 Ga0496101_0000001 Ga0496101_0000001_139246_139902 197
409 3300048909 Ga0496106_0000022 Ga0496106_0000022_133526_134182 197
410 3300048910 Ga0496107_0000016 Ga0496107_0000016_32418_33074 197
411 3300048911 Ga0496108_0000107 Ga0496108_0000107_46457_47113 197
412 3300048912 Ga0496109_0000028 Ga0496109_0000028_85600_86265 197
413 3300048912 Ga0496109_0000190 Ga0496109_0000190_14130_14786 197
414 3300048916 Ga0496113_0266292 Ga0496113_0266292_450_1106 197
415 3300048917 Ga0496114_0043059 Ga0496114_0043059_1448_2104 197
416 3300048918 Ga0496115_0000316 Ga0496115_0000316_6033_6692 197
417 3300048919 Ga0496116_0000769 Ga0496116_0000769_30921_31589 197
418 3300048922 Ga0496119_0003085 Ga0496119_0003085_8969_9637 197
419 3300049579 Ga0501043_0394537 Ga0501043_0394537_55_738 197
420 3300049584 Ga0501068_0089799 Ga0501068_0089799_940_1602 197
421 3300049587 Ga0501071_0120916 Ga0501071_0120916_100_783 197
422 3300049590 Ga0501074_0296545 Ga0501074_0296545_141_824 197
423 3300049741 Ga0501079_0266326 Ga0501079_0266326_555_1238 197
424 3300049823 Ga0501044_0030682 Ga0501044_0030682_346_1029 197
425 3300050515 nmdc:mga0a205_3884_c1 nmdc:mga0a205_3884_c1_666_1334 197
426 3300053077 Ga0495601_0000039 Ga0495601_0000039_59214_59879 197
427 3300053077 Ga0495601_0000126 Ga0495601_0000126_27823_28479 197
428 3300053078 Ga0495612_0003451 Ga0495612_0003451_2044_2700 197
429 3300053084 Ga0495595_0000014 Ga0495595_0000014_69055_69714 197
430 3300053085 Ga0495619_0000021 Ga0495619_0000021_57913_58569 197
431 3300053085 Ga0495619_0000114 Ga0495619_0000114_41827_42486 197
432 3300005327 Ga0070658_10274672 Ga0070658_102746722 198
433 3300005337 Ga0070682_100000421 Ga0070682_10000042112 198
434 3300005344 Ga0070661_100336554 Ga0070661_1003365541 198
435 3300005345 Ga0070692_10022930 Ga0070692_100229301 198
436 3300005356 Ga0070674_100000025 Ga0070674_10000002513 198
437 3300005455 Ga0070663_100001410 Ga0070663_1000014107 198
438 3300005456 Ga0070678_100013493 Ga0070678_1000134934 198
439 3300005456 Ga0070678_100031589 Ga0070678_1000315895 198
440 3300005530 Ga0070679_100004180 Ga0070679_1000041807 198
441 3300005535 Ga0070684_100287992 Ga0070684_1002879923 198
442 3300005539 Ga0068853_100100626 Ga0068853_1001006262 198
443 3300005543 Ga0070672_100000030 Ga0070672_10000003030 198
444 3300005548 Ga0070665_100001190 Ga0070665_10000119035 198
445 3300005564 Ga0070664_100042879 Ga0070664_1000428793 198
446 3300005718 Ga0068866_10000001 Ga0068866_10000001164 198
447 3300005843 Ga0068860_100012821 Ga0068860_1000128218 198
448 3300005843 Ga0068860_100596481 Ga0068860_1005964812 198
449 3300006163 Ga0070715_10000001 Ga0070715_10000001136 198
450 3300009098 Ga0105245_10000180 Ga0105245_1000018045 198
451 3300009177 Ga0105248_10240120 Ga0105248_102401202 198
452 3300009551 Ga0105238_10000201 Ga0105238_1000020125 198
453 3300013105 Ga0157369_10135949 Ga0157369_101359493 198
454 3300013308 Ga0157375_10210708 Ga0157375_102107082 198
455 3300025899 Ga0207642_10000006 Ga0207642_10000006167 198
456 3300025899 Ga0207642_10000007 Ga0207642_1000000768 198
457 3300025903 Ga0207680_10039292 Ga0207680_100392922 198
458 3300025905 Ga0207685_10000011 Ga0207685_10000011136 198
459 3300025909 Ga0207705_10182098 Ga0207705_101820982 198
460 3300025920 Ga0207649_10277162 Ga0207649_102771622 198
461 3300025921 Ga0207652_10000370 Ga0207652_1000037036 198
462 3300025924 Ga0207694_10000004 Ga0207694_10000004663 198
463 3300025927 Ga0207687_10000007 Ga0207687_10000007196 198
464 3300025936 Ga0207670_10174054 Ga0207670_101740542 198
465 3300025937 Ga0207669_10000009 Ga0207669_10000009163 198
466 3300025939 Ga0207665_10154233 Ga0207665_101542333 198
467 3300025940 Ga0207691_10000190 Ga0207691_1000019011 198
468 3300025944 Ga0207661_10012409 Ga0207661_100124097 198
469 3300025944 Ga0207661_10252826 Ga0207661_102528262 198
470 3300025945 Ga0207679_10067633 Ga0207679_100676333 198
471 3300025986 Ga0207658_10023756 Ga0207658_100237564 198
472 3300026041 Ga0207639_10078135 Ga0207639_100781352 198
473 3300026067 Ga0207678_10000965 Ga0207678_1000096518 198
474 3300026078 Ga0207702_10293130 Ga0207702_102931302 198
475 3300026078 Ga0207702_10482975 Ga0207702_104829751 198
476 3300026121 Ga0207683_10053995 Ga0207683_100539954 198
477 3300028379 Ga0268266_10000085 Ga0268266_1000008538 198
478 3300028379 Ga0268266_10046993 Ga0268266_100469935 198
479 3300028381 Ga0268264_10002386 Ga0268264_1000238612 198
480 3300037418 Ga0395900_0274135 Ga0395900_0274135_233_901 198
481 3300044842 Ga0466957_0066244 Ga0466957_0066244_1551_2213 198
482 3300045836 Ga0466958_0040747 Ga0466958_0040747_1179_1841 198
483 3300046455 Ga0495603_0007993 Ga0495603_0007993_3308_3967 198
484 3300046459 Ga0495629_0007203 Ga0495629_0007203_3624_4286 198
485 3300046461 Ga0495641_0006893 Ga0495641_0006893_674_1336 198
486 3300046476 Ga0495662_0325575 Ga0495662_0325575_39_695 198
487 3300046507 Ga0495606_0000221 Ga0495606_0000221_91855_92517 198
488 3300046516 Ga0495628_0022989 Ga0495628_0022989_1531_2193 198
489 3300046517 Ga0495630_0000018 Ga0495630_0000018_81385_82047 198
490 3300046674 Ga0495588_0000376 Ga0495588_0000376_5193_5855 198
491 3300046681 Ga0495647_0000228 Ga0495647_0000228_4976_5638 198
492 3300046683 Ga0495658_0000025 Ga0495658_0000025_64964_65623 198
493 3300046689 Ga0495613_0000152 Ga0495613_0000152_64041_64700 198
494 3300046690 Ga0495624_0000009 Ga0495624_0000009_74084_74743 198
495 3300047447 Ga0495685_041322 Ga0495685_041322_728_1387 198
496 3300047469 Ga0495673_0059073 Ga0495673_0059073_387_1046 198
497 3300047673 Ga0495593_0121148 Ga0495593_0121148_576_1235 198
498 3300048906 Ga0496103_0075422 Ga0496103_0075422_607_1353 198
499 3300048911 Ga0496108_0000150 Ga0496108_0000150_19486_20148 198
500 3300048911 Ga0496108_0018497 Ga0496108_0018497_3074_3739 198
501 3300048912 Ga0496109_0000007 Ga0496109_0000007_200163_200825 198
502 3300048913 Ga0496110_0044429 Ga0496110_0044429_1667_2329 198
503 3300048914 Ga0496111_0021513 Ga0496111_0021513_2552_3214 198
504 3300048920 Ga0496117_0001943 Ga0496117_0001943_12127_12873 198
505 3300048924 Ga0496121_0004930 Ga0496121_0004930_12333_13052 198
506 3300048929 Ga0496126_0081806 Ga0496126_0081806_1655_2332 198
507 3300049581 Ga0501047_0132626 Ga0501047_0132626_1551_2249 198
508 3300049583 Ga0501067_0067574 Ga0501067_0067574_397_1065 198
509 3300049592 Ga0501076_0501316 Ga0501076_0501316_231_890 198
510 3300002459 JGI24751J29686_10007587 JGI24751J29686_100075872 199
511 3300005457 Ga0070662_100000007 Ga0070662_100000007182 199
512 3300005937 Ga0081455_10090326 Ga0081455_100903262 199
513 3300009098 Ga0105245_10000832 Ga0105245_1000083212 199
514 3300009101 Ga0105247_10000323 Ga0105247_1000032334 199
515 3300025900 Ga0207710_10000549 Ga0207710_1000054917 199
516 3300025916 Ga0207663_10000683 Ga0207663_1000068311 199
517 3300025927 Ga0207687_10000018 Ga0207687_1000001812 199
518 3300025933 Ga0207706_10000018 Ga0207706_100000184 199
519 3300046684 Ga0495669_0018686 Ga0495669_0018686_1519_2184 199
520 3300048908 Ga0496105_0000006 Ga0496105_0000006_16522_17187 199
521 3300048916 Ga0496113_0116488 Ga0496113_0116488_1315_1983 199
522 3300001979 JGI24740J21852_10006219 JGI24740J21852_100062195 200
523 3300005333 Ga0070677_10000098 Ga0070677_1000009814 200
524 3300005441 Ga0070700_100115092 Ga0070700_1001150923 200
525 3300011119 Ga0105246_10171863 Ga0105246_101718632 200
526 3300013296 Ga0157374_10001471 Ga0157374_100014713 200
527 3300014326 Ga0157380_10000158 Ga0157380_1000015810 200
528 3300025893 Ga0207682_10000182 Ga0207682_1000018217 200
529 3300025927 Ga0207687_10002274 Ga0207687_100022748 200
530 3300046514 Ga0495618_0000004 Ga0495618_0000004_155602_156267 200
531 3300046516 Ga0495628_0183765 Ga0495628_0183765_594_1259 200
532 3300046517 Ga0495630_0027320 Ga0495630_0027320_1796_2464 200
533 3300046616 Ga0495668_0453962 Ga0495668_0453962_23_688 200
534 3300047317 Ga0495604_0000038 Ga0495604_0000038_121584_122249 200
535 3300047444 Ga0495675_0003673 Ga0495675_0003673_2158_2823 200

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jly-assembly1.cif.gz_J eif2a - eif2b complex 0.7976 39 161
3ect-assembly1.cif.gz_A crystal structure of the hexapeptide-repeat containing-acetyltransferase vca0836 from vibrio cholerae 0.7183 67 173
3vbl-assembly1.cif.gz_A crystal structure of the s84c mutant of antd, an n-acyltransferase from bacillus cereus in complex with dtdp-4-amino-4,6-dideoxyglucose and coenzyme a 0.689 36 173
3vbk-assembly1.cif.gz_E crystal structure of the s84a mutant of antd, an n-acyltransferase from bacillus cereus in complex with dtdp-4-amino-4,6-dideoxyglucose and coenzyme a 0.6743 37 173
5t2y-assembly1.cif.gz_A crystal structure of c. jejuni pgld in complex with 5-methyl-4-(methylamino)-2-phenethylthieno[2,3-d]pyrimidine-6-carboxylic acid 0.6713 43 168
ID Description Score Start End Superfamily
af_P39206_2_173_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8697 43 171 2.160.10.10
af_O53281_107_298_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8549 33 171 2.160.10.10
af_Q4D1S1_471_572_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8296 43 113 2.160.10.10
af_O60064_269_353_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.7445 38 113 2.160.10.10
af_P37750_24_194_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.7414 51 170 2.160.10.10
ID Description Score Start End GO Terms
AF-A0A838PPW3-F1-model_v4 Acyltransferase 0.9587 2 145 GO:0016746
AF-A0A7V9VQV6-F1-model_v4 deleted 0.9584 2 119
AF-A0A7M3MMV8-F1-model_v4 Acyltransferase 0.9235 2 113
AF-A0A7J9VP95-F1-model_v4 Acyltransferase 0.9078 1 170 GO:0016746
AF-A0A1I3AFX9-F1-model_v4 Acetyltransferase (Isoleucine patch superfamily) 0.9056 2 170 GO:0016740

Feature Viewer

pLDDT pTM Quality
81.18 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map