F460643

General Info

Members Datasets Scaffolds Average Seq Length
535 179 1070 112

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10724513|Ga0075433_107245132
Length 122
Sequence MCAAHIVCAHTDTPMALRPVEFHILLALAADERHGYSILQEVAELTDGDLSIEPGTLYRALHRMLKDGWVVESGRRPAADVDDERRRYYRLTPLGRRVATAEADRLWRLLAVARRHKLLSRV

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
84 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
138 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
139 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
140 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
141 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
142 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
149 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
153 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
154 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
165 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
166 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
167 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
168 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
169 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.06
Nodule 0
Rhizoplane 1.31
Rhizosphere 96.64
Stem 0
Stem Tuber 0
Unclassified 25.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10724513 3300006852 Bacteria 870
2 JGI25406J46586_10170271 3300003203 Bacteria 635
3 Ga0065707_10430398 3300005295 Bacteria 821
4 Ga0070676_10006898 3300005328 Bacteria 6079
5 Ga0070690_100066619 3300005330 Bacteria 2331
6 Ga0070690_101111122 3300005330 Unclassified 627
7 Ga0070690_101319237 3300005330 Unclassified 579
8 Ga0070670_100931550 3300005331 Bacteria 788
9 Ga0070677_10424322 3300005333 Bacteria 706
10 Ga0068869_101020241 3300005334 Bacteria 721
11 Ga0070666_11096250 3300005335 Unclassified 592
12 Ga0070680_100982605 3300005336 Bacteria 729
13 Ga0068868_100504311 3300005338 Unclassified 1060
14 Ga0070689_100159270 3300005340 Unclassified 1824
15 Ga0070689_100410801 3300005340 Unclassified 1146
16 Ga0070689_101280522 3300005340 Bacteria 660
17 Ga0070689_102139075 3300005340 Bacteria 512
18 Ga0070691_10011485 3300005341 Bacteria 4043
19 Ga0070691_11026482 3300005341 Bacteria 516
20 Ga0070687_100135313 3300005343 Bacteria 1428
21 Ga0070687_100210250 3300005343 Bacteria 1185
22 Ga0070687_100507540 3300005343 Bacteria 813
23 Ga0070692_10267097 3300005345 Bacteria 1031
24 Ga0070692_10560379 3300005345 Bacteria 750
25 Ga0070668_100077057 3300005347 Unclassified 2606
26 Ga0070668_100185242 3300005347 Bacteria 1702
27 Ga0070668_100352076 3300005347 Bacteria 1247
28 Ga0070668_102213622 3300005347 Unclassified 508
29 Ga0070669_100034521 3300005353 Unclassified 3662
30 Ga0070669_100141465 3300005353 Bacteria 1855
31 Ga0070669_100144099 3300005353 Bacteria 1839
32 Ga0070669_100285384 3300005353 Bacteria 1324
33 Ga0070669_101417395 3300005353 Bacteria 603
34 Ga0070669_101908559 3300005353 Unclassified 519
35 Ga0070675_100000646 3300005354 Bacteria 24086
36 Ga0070675_100081901 3300005354 Bacteria 2692
37 Ga0070675_101815037 3300005354 Unclassified 562
38 Ga0070671_100015464 3300005355 Bacteria 6165
39 Ga0070671_100447957 3300005355 Bacteria 1107
40 Ga0070674_100004867 3300005356 Bacteria 7697
41 Ga0070674_102174044 3300005356 Bacteria 507
42 Ga0070673_100074787 3300005364 Bacteria 2731
43 Ga0070673_100091360 3300005364 Unclassified 2489
44 Ga0070673_100490811 3300005364 Unclassified 1110
45 Ga0070673_100920833 3300005364 Unclassified 811
46 Ga0070673_101090296 3300005364 Unclassified 746
47 Ga0070688_100015804 3300005365 Bacteria 4301
48 Ga0070688_100110995 3300005365 Unclassified 1824
49 Ga0070688_100213833 3300005365 Bacteria 1355
50 Ga0070667_100012313 3300005367 Bacteria 7076
51 Ga0070667_100029780 3300005367 Unclassified 4550
52 Ga0070703_10060664 3300005406 Bacteria 1237
53 Ga0070703_10563330 3300005406 Unclassified 521
54 Ga0070709_10957934 3300005434 Unclassified 679
55 Ga0070701_10005444 3300005438 Bacteria 5262
56 Ga0070701_10504925 3300005438 Unclassified 786
57 Ga0070701_10874118 3300005438 Unclassified 619
58 Ga0070711_100191527 3300005439 Bacteria 1572
59 Ga0070711_100507900 3300005439 Bacteria 995
60 Ga0070705_100010012 3300005440 Bacteria 4733
61 Ga0070705_100593129 3300005440 Unclassified 856
62 Ga0070700_100011240 3300005441 Bacteria 4957
63 Ga0070700_100316502 3300005441 Bacteria 1145
64 Ga0070700_100411264 3300005441 Unclassified 1020
65 Ga0070700_101245952 3300005441 Unclassified 623
66 Ga0070700_101304852 3300005441 Bacteria 610
67 Ga0070700_101992072 3300005441 Unclassified 504
68 Ga0070694_100056791 3300005444 Bacteria 2659
69 Ga0070694_100069496 3300005444 Bacteria 2423
70 Ga0070708_100147169 3300005445 Bacteria 2189
71 Ga0070708_100319385 3300005445 Bacteria 1463
72 Ga0070708_100696262 3300005445 Bacteria 957
73 Ga0070708_101934781 3300005445 Unclassified 546
74 Ga0070678_100964897 3300005456 Bacteria 782
75 Ga0070678_101268182 3300005456 Bacteria 685
76 Ga0070662_100240086 3300005457 Bacteria 1453
77 Ga0070662_100434225 3300005457 Unclassified 1088
78 Ga0070662_101865239 3300005457 Unclassified 519
79 Ga0070681_10110480 3300005458 Unclassified 2689
80 Ga0068867_100017168 3300005459 Bacteria 5142
81 Ga0068867_100295921 3300005459 Bacteria 1332
82 Ga0070706_100051975 3300005467 Bacteria 3783
83 Ga0070707_100080831 3300005468 Bacteria 3137
84 Ga0070707_100226206 3300005468 Bacteria 1822
85 Ga0070707_100498270 3300005468 Bacteria 1180
86 Ga0070707_100593953 3300005468 Unclassified 1069
87 Ga0070707_102293953 3300005468 Bacteria 507
88 Ga0070698_100008414 3300005471 Bacteria 11151
89 Ga0070698_100648597 3300005471 Bacteria 997
90 Ga0070698_100753451 3300005471 Unclassified 917
91 Ga0070698_101070347 3300005471 Bacteria 754
92 Ga0070698_101401563 3300005471 Bacteria 650
93 Ga0070698_101456512 3300005471 Bacteria 636
94 Ga0070698_101891275 3300005471 Bacteria 550
95 Ga0070699_100051367 3300005518 Bacteria 3569
96 Ga0070699_100132462 3300005518 Bacteria 2198
97 Ga0070699_100165257 3300005518 Unclassified 1960
98 Ga0070699_100180948 3300005518 Bacteria 1871
99 Ga0070699_100847233 3300005518 Unclassified 837
100 Ga0070697_100095334 3300005536 Bacteria 2467
101 Ga0070697_100155065 3300005536 Bacteria 1932
102 Ga0070697_100359273 3300005536 Unclassified 1259
103 Ga0070672_100080196 3300005543 Bacteria 2614
104 Ga0070672_100250467 3300005543 Unclassified 1492
105 Ga0070672_100495935 3300005543 Bacteria 1056
106 Ga0070695_100002747 3300005545 Bacteria 10206
107 Ga0070695_100010637 3300005545 Bacteria 5499
108 Ga0070695_100303704 3300005545 Bacteria 1181
109 Ga0070696_100011794 3300005546 Bacteria 5856
110 Ga0070696_100028451 3300005546 Bacteria 3814
111 Ga0070696_100079691 3300005546 Bacteria 2317
112 Ga0070696_100415725 3300005546 Bacteria 1055
113 Ga0070696_101113922 3300005546 Bacteria 664
114 Ga0070696_102018769 3300005546 Bacteria 501
115 Ga0070704_100001732 3300005549 Bacteria 11908
116 Ga0070704_100007654 3300005549 Bacteria 6440
117 Ga0070704_102226537 3300005549 Bacteria 510
118 Ga0068854_100808633 3300005578 Bacteria 818
119 Ga0070702_100015694 3300005615 Bacteria 3873
120 Ga0068859_100029841 3300005617 Bacteria 5471
121 Ga0068859_100242029 3300005617 Unclassified 1894
122 Ga0068859_101324768 3300005617 Unclassified 794
123 Ga0068864_100352787 3300005618 Bacteria 1388
124 Ga0068864_100968836 3300005618 Bacteria 842
125 Ga0068864_102652003 3300005618 Bacteria 507
126 Ga0068866_10046291 3300005718 Bacteria 2187
127 Ga0068861_100162485 3300005719 Bacteria 1843
128 Ga0068861_100163230 3300005719 Bacteria 1840
129 Ga0068861_100230786 3300005719 Bacteria 1569
130 Ga0068861_100300968 3300005719 Viruses 1389
131 Ga0068861_101107728 3300005719 Bacteria 761
132 Ga0068870_10375321 3300005840 Bacteria 919
133 Ga0068863_100004770 3300005841 Bacteria 13360
134 Ga0068858_100149697 3300005842 Unclassified 2194
135 Ga0068858_100279544 3300005842 Bacteria 1589
136 Ga0068858_101474413 3300005842 Bacteria 671
137 Ga0068860_100076502 3300005843 Bacteria 3183
138 Ga0068860_100113392 3300005843 Unclassified 2592
139 Ga0068860_100248085 3300005843 Bacteria 1733
140 Ga0068860_100486314 3300005843 Bacteria 1231
141 Ga0068862_100029986 3300005844 Unclassified 4583
142 Ga0068862_100064717 3300005844 Bacteria 3148
143 Ga0068862_100412640 3300005844 Bacteria 1265
144 Ga0068862_100876628 3300005844 Bacteria 881
145 Ga0068862_101055276 3300005844 Bacteria 806
146 Ga0068862_101444060 3300005844 Bacteria 692
147 Ga0081455_10067248 3300005937 Unclassified 2987
148 Ga0081455_10502483 3300005937 Unclassified 814
149 Ga0081455_10782120 3300005937 Bacteria 600
150 Ga0081539_10011740 3300005985 Bacteria 6868
151 Ga0081539_10240015 3300005985 Bacteria 812
152 Ga0075368_10056264 3300006042 Bacteria 1569
153 Ga0070715_10988301 3300006163 Bacteria 524
154 Ga0075362_10113208 3300006177 Bacteria 1279
155 Ga0075367_10010560 3300006178 Bacteria 4854
156 Ga0075366_10018669 3300006195 Bacteria 4005
157 Ga0097621_100402174 3300006237 Bacteria 1226
158 Ga0068871_100163441 3300006358 Unclassified 1905
159 Ga0075428_100063403 3300006844 Bacteria 4046
160 Ga0075428_100146923 3300006844 Unclassified 2562
161 Ga0075428_100268086 3300006844 Bacteria 1837
162 Ga0075428_100360038 3300006844 Bacteria 1561
163 Ga0075428_100491328 3300006844 Bacteria 1313
164 Ga0075428_100638943 3300006844 Bacteria 1135
165 Ga0075430_100004498 3300006846 Bacteria 11747
166 Ga0075430_100681664 3300006846 Unclassified 847
167 Ga0075430_101625851 3300006846 Bacteria 530
168 Ga0075431_100057133 3300006847 Unclassified 4025
169 Ga0075431_100098803 3300006847 Bacteria 3013
170 Ga0075431_100122969 3300006847 Bacteria 2678
171 Ga0075431_100157580 3300006847 Bacteria 2336
172 Ga0075433_10076873 3300006852 Bacteria 2940
173 Ga0075433_10077781 3300006852 Bacteria 2923
174 Ga0075433_10082535 3300006852 Bacteria 2835
175 Ga0075433_10111945 3300006852 Bacteria 2422
176 Ga0075433_10238622 3300006852 Bacteria 1614
177 Ga0075433_10314392 3300006852 Unclassified 1386
178 Ga0075433_10381739 3300006852 Unclassified 1244
179 Ga0075433_10433969 3300006852 Bacteria 1158
180 Ga0075433_10480346 3300006852 Bacteria 1095
181 Ga0075433_10563386 3300006852 Bacteria 1001
182 Ga0075433_10857932 3300006852 Bacteria 792
183 Ga0075433_11576496 3300006852 Bacteria 567
184 Ga0075434_100000019 3300006871 Bacteria 73391
185 Ga0075434_100029213 3300006871 Bacteria 5421
186 Ga0075434_100055726 3300006871 Unclassified 3928
187 Ga0075434_100065084 3300006871 Bacteria 3631
188 Ga0075434_100143073 3300006871 Bacteria 2412
189 Ga0075434_100199105 3300006871 Bacteria 2022
190 Ga0075434_100379946 3300006871 Bacteria 1433
191 Ga0075434_100728301 3300006871 Bacteria 1009
192 Ga0075434_100888757 3300006871 Bacteria 906
193 Ga0075434_100904326 3300006871 Unclassified 897
194 Ga0075434_100956988 3300006871 Unclassified 871
195 Ga0075434_101274192 3300006871 Unclassified 746
196 Ga0075434_101291798 3300006871 Unclassified 741
197 Ga0075434_101348566 3300006871 Bacteria 724
198 Ga0075434_101408717 3300006871 Bacteria 707
199 Ga0075434_101532279 3300006871 Unclassified 676
200 Ga0075434_102102896 3300006871 Bacteria 569
201 Ga0075429_100068330 3300006880 Bacteria 3092
202 Ga0075429_100200641 3300006880 Unclassified 1747
203 Ga0075429_100827300 3300006880 Unclassified 811
204 Ga0075429_100971699 3300006880 Viruses 743
205 Ga0075429_101354910 3300006880 Unclassified 620
206 Ga0068865_100238096 3300006881 Bacteria 1431
207 Ga0075436_100000160 3300006914 Bacteria 41885
208 Ga0075436_100025174 3300006914 Unclassified 4092
209 Ga0075436_100040486 3300006914 Bacteria 3216
210 Ga0075436_100070751 3300006914 Bacteria 2412
211 Ga0075436_100143750 3300006914 Bacteria 1677
212 Ga0075436_100351871 3300006914 Unclassified 1062
213 Ga0075436_100518396 3300006914 Bacteria 873
214 Ga0075436_100846519 3300006914 Bacteria 682
215 Ga0075436_101001839 3300006914 Bacteria 627
216 Ga0075436_101157355 3300006914 Bacteria 583
217 Ga0097620_100029840 3300006931 Bacteria 5471
218 Ga0097620_100242034 3300006931 Unclassified 1894
219 Ga0097620_101324792 3300006931 Unclassified 794
220 Ga0075435_100000041 3300007076 Bacteria 66202
221 Ga0075435_100010613 3300007076 Bacteria 6741
222 Ga0075435_100016607 3300007076 Bacteria 5552
223 Ga0075435_100023759 3300007076 Bacteria 4747
224 Ga0075435_100100722 3300007076 Bacteria 2393
225 Ga0075435_100224459 3300007076 Bacteria 1596
226 Ga0075435_100356724 3300007076 Bacteria 1254
227 Ga0075435_100374410 3300007076 Bacteria 1223
228 Ga0075435_101956469 3300007076 Bacteria 515
229 Ga0105240_10446128 3300009093 Unclassified 1449
230 Ga0111539_10001016 3300009094 Bacteria 36780
231 Ga0111539_10023995 3300009094 Bacteria 7492
232 Ga0111539_10026772 3300009094 Bacteria 7046
233 Ga0111539_10147513 3300009094 Bacteria 2754
234 Ga0111539_10267194 3300009094 Bacteria 1991
235 Ga0111539_10389439 3300009094 Unclassified 1623
236 Ga0111539_10428091 3300009094 Bacteria 1541
237 Ga0111539_10582882 3300009094 Bacteria 1303
238 Ga0111539_13003010 3300009094 Bacteria 545
239 Ga0105245_10160398 3300009098 Bacteria 2133
240 Ga0114129_10000965 3300009147 Bacteria 37582
241 Ga0114129_10001059 3300009147 Bacteria 36098
242 Ga0114129_10017195 3300009147 Bacteria 10301
243 Ga0114129_10024000 3300009147 Bacteria 8643
244 Ga0114129_10041322 3300009147 Bacteria 6499
245 Ga0114129_10044215 3300009147 Bacteria 6265
246 Ga0114129_10047485 3300009147 Bacteria 6032
247 Ga0114129_10057343 3300009147 Bacteria 5451
248 Ga0114129_10060403 3300009147 Bacteria 5300
249 Ga0114129_10063052 3300009147 Bacteria 5177
250 Ga0114129_10123896 3300009147 Unclassified 3554
251 Ga0114129_10128995 3300009147 Bacteria 3475
252 Ga0114129_10133103 3300009147 Bacteria 3413
253 Ga0114129_10138210 3300009147 Unclassified 3342
254 Ga0114129_10254099 3300009147 Unclassified 2358
255 Ga0114129_10346989 3300009147 Bacteria 1967
256 Ga0114129_10473318 3300009147 Unclassified 1640
257 Ga0114129_10622441 3300009147 Bacteria 1396
258 Ga0114129_10947018 3300009147 Unclassified 1088
259 Ga0114129_11181570 3300009147 Bacteria 954
260 Ga0114129_11878065 3300009147 Bacteria 727
261 Ga0114129_11985210 3300009147 Unclassified 704
262 Ga0105243_10003634 3300009148 Bacteria 12415
263 Ga0105243_10059764 3300009148 Bacteria 3043
264 Ga0105243_12373182 3300009148 Bacteria 568
265 Ga0105242_10200563 3300009176 Bacteria 1772
266 Ga0105242_10245474 3300009176 Unclassified 1611
267 Ga0105242_11078974 3300009176 Bacteria 816
268 Ga0105242_11394769 3300009176 Bacteria 728
269 Ga0105248_10009548 3300009177 Bacteria 10677
270 Ga0105248_10033567 3300009177 Bacteria 5733
271 Ga0105248_10041463 3300009177 Bacteria 5160
272 Ga0105248_10272366 3300009177 Bacteria 1906
273 Ga0105248_12478134 3300009177 Bacteria 591
274 Ga0105249_10414650 3300009553 Bacteria 1379
275 Ga0105249_10608724 3300009553 Bacteria 1148
276 Ga0105249_10722112 3300009553 Bacteria 1057
277 Ga0105249_11409546 3300009553 Unclassified 769
278 Ga0105249_12671400 3300009553 Unclassified 571
279 Ga0105246_12158497 3300011119 Unclassified 541
280 Ga0157320_1034668 3300012481 Unclassified 524
281 Ga0157337_1036345 3300012483 Bacteria 526
282 Ga0157378_10226805 3300013297 Bacteria 1778
283 Ga0157378_11437019 3300013297 Bacteria 733
284 Ga0163162_10028563 3300013306 Bacteria 5520
285 Ga0163162_12820027 3300013306 Bacteria 559
286 Ga0163162_12839913 3300013306 Unclassified 557
287 Ga0157375_10022054 3300013308 Bacteria 5856
288 Ga0157375_10112596 3300013308 Bacteria 2822
289 Ga0157375_10408231 3300013308 Bacteria 1525
290 Ga0157375_11547973 3300013308 Bacteria 783
291 Ga0157380_10104210 3300014326 Bacteria 2368
292 Ga0157380_10533149 3300014326 Bacteria 1148
293 Ga0157380_12126700 3300014326 Bacteria 624
294 Ga0157380_12413165 3300014326 Bacteria 591
295 Ga0157380_12715618 3300014326 Bacteria 562
296 Ga0157380_13037446 3300014326 Unclassified 535
297 Ga0157377_10127967 3300014745 Unclassified 1547
298 Ga0157377_10820367 3300014745 Bacteria 688
299 Ga0157377_11684249 3300014745 Unclassified 511
300 Ga0157379_10066811 3300014968 Unclassified 3215
301 Ga0157379_10575648 3300014968 Bacteria 1049
302 Ga0157379_10590227 3300014968 Bacteria 1036
303 Ga0157376_10990436 3300014969 Unclassified 863
304 Ga0157376_11697128 3300014969 Unclassified 667
305 Ga0163161_10415575 3300017792 Bacteria 1081
306 Ga0163161_10553325 3300017792 Viruses 943
307 Ga0163161_10773430 3300017792 Bacteria 805
308 Ga0207697_10051091 3300025315 Bacteria 1708
309 Ga0207682_10458524 3300025893 Unclassified 604
310 Ga0207642_10070765 3300025899 Bacteria 1659
311 Ga0207642_10551943 3300025899 Bacteria 712
312 Ga0207688_10321820 3300025901 Unclassified 949
313 Ga0207680_10486524 3300025903 Unclassified 878
314 Ga0207685_10684427 3300025905 Bacteria 557
315 Ga0207685_10766973 3300025905 Bacteria 529
316 Ga0207645_10005233 3300025907 Bacteria 9455
317 Ga0207645_10648825 3300025907 Bacteria 717
318 Ga0207684_10418564 3300025910 Bacteria 1151
319 Ga0207707_10472741 3300025912 Bacteria 1071
320 Ga0207663_10187174 3300025916 Bacteria 1484
321 Ga0207663_10455320 3300025916 Bacteria 987
322 Ga0207662_10097600 3300025918 Bacteria 1816
323 Ga0207662_10666224 3300025918 Unclassified 728
324 Ga0207662_10767011 3300025918 Unclassified 679
325 Ga0207662_11383892 3300025918 Unclassified 500
326 Ga0207646_10230794 3300025922 Bacteria 1672
327 Ga0207646_10345574 3300025922 Bacteria 1344
328 Ga0207646_11663900 3300025922 Bacteria 549
329 Ga0207681_10023323 3300025923 Unclassified 3957
330 Ga0207681_10093297 3300025923 Bacteria 2154
331 Ga0207681_11421051 3300025923 Unclassified 582
332 Ga0207659_10000495 3300025926 Bacteria 23739
333 Ga0207644_10065813 3300025931 Unclassified 2636
334 Ga0207644_10385100 3300025931 Unclassified 1144
335 Ga0207706_10080214 3300025933 Unclassified 2870
336 Ga0207706_10114338 3300025933 Bacteria 2374
337 Ga0207686_10228627 3300025934 Bacteria 1347
338 Ga0207686_10270774 3300025934 Bacteria 1249
339 Ga0207686_10794730 3300025934 Bacteria 758
340 Ga0207686_11535425 3300025934 Bacteria 549
341 Ga0207709_10020844 3300025935 Bacteria 3703
342 Ga0207709_10376701 3300025935 Bacteria 1079
343 Ga0207670_10122892 3300025936 Unclassified 1890
344 Ga0207670_10136155 3300025936 Unclassified 1806
345 Ga0207670_11077931 3300025936 Bacteria 678
346 Ga0207669_11342474 3300025937 Unclassified 608
347 Ga0207704_10572999 3300025938 Bacteria 920
348 Ga0207704_11242564 3300025938 Bacteria 636
349 Ga0207665_10770615 3300025939 Bacteria 759
350 Ga0207665_11337579 3300025939 Bacteria 571
351 Ga0207691_10043737 3300025940 Bacteria 4126
352 Ga0207691_10130197 3300025940 Bacteria 2223
353 Ga0207691_10217307 3300025940 Unclassified 1658
354 Ga0207711_10057510 3300025941 Bacteria 3343
355 Ga0207689_10367132 3300025942 Bacteria 1197
356 Ga0207667_10831220 3300025949 Bacteria 919
357 Ga0207651_10066353 3300025960 Bacteria 2535
358 Ga0207651_10337360 3300025960 Viruses 1265
359 Ga0207651_10937474 3300025960 Unclassified 772
360 Ga0207651_11410473 3300025960 Unclassified 627
361 Ga0207712_11668747 3300025961 Unclassified 571
362 Ga0207668_10159013 3300025972 Bacteria 1758
363 Ga0207668_10291304 3300025972 Unclassified 1343
364 Ga0207640_10885553 3300025981 Bacteria 779
365 Ga0207640_11881864 3300025981 Bacteria 541
366 Ga0207658_10309744 3300025986 Unclassified 1363
367 Ga0207658_10429554 3300025986 Bacteria 1166
368 Ga0207658_10840228 3300025986 Bacteria 835
369 Ga0207677_10591544 3300026023 Unclassified 973
370 Ga0207703_10118932 3300026035 Bacteria 2266
371 Ga0207703_10181810 3300026035 Unclassified 1856
372 Ga0207703_10980259 3300026035 Bacteria 811
373 Ga0207678_10474691 3300026067 Bacteria 1089
374 Ga0207708_10016967 3300026075 Bacteria 5482
375 Ga0207708_10053971 3300026075 Bacteria 3063
376 Ga0207708_10248168 3300026075 Unclassified 1433
377 Ga0207708_10665067 3300026075 Unclassified 888
378 Ga0207708_10884270 3300026075 Viruses 772
379 Ga0207708_11090986 3300026075 Bacteria 696
380 Ga0207641_10001068 3300026088 Bacteria 27583
381 Ga0207648_10013498 3300026089 Bacteria 7598
382 Ga0207648_10071277 3300026089 Bacteria 3028
383 Ga0207648_10126326 3300026089 Bacteria 2250
384 Ga0207648_11503334 3300026089 Bacteria 633
385 Ga0207676_10497714 3300026095 Bacteria 1157
386 Ga0207676_10499186 3300026095 Bacteria 1155
387 Ga0207676_11670920 3300026095 Bacteria 635
388 Ga0207675_100001265 3300026118 Bacteria 25256
389 Ga0207675_100012547 3300026118 Bacteria 7917
390 Ga0207675_100025187 3300026118 Bacteria 5536
391 Ga0207675_100048509 3300026118 Bacteria 3964
392 Ga0207675_100329527 3300026118 Viruses 1492
393 Ga0207675_100735519 3300026118 Bacteria 997
394 Ga0207675_101113530 3300026118 Bacteria 809
395 Ga0207683_10613507 3300026121 Unclassified 1007
396 Ga0207428_10000329 3300027907 Bacteria 61608
397 Ga0207428_10126618 3300027907 Unclassified 1956
398 Ga0207428_10388958 3300027907 Bacteria 1022
399 Ga0207428_10490343 3300027907 Bacteria 893
400 Ga0268265_10025655 3300028380 Bacteria 4187
401 Ga0268265_10209468 3300028380 Bacteria 1697
402 Ga0268265_10546104 3300028380 Bacteria 1099
403 Ga0268265_11021877 3300028380 Bacteria 817
404 Ga0268265_11072099 3300028380 Unclassified 799
405 Ga0268265_11182670 3300028380 Bacteria 762
406 Ga0268265_12698350 3300028380 Unclassified 502
407 Ga0268264_10085840 3300028381 Unclassified 2703
408 Ga0268264_10169678 3300028381 Unclassified 1972
409 Ga0268264_10330046 3300028381 Bacteria 1445
410 Ga0268264_10441851 3300028381 Bacteria 1258
411 Ga0268264_10818059 3300028381 Bacteria 931
412 Ga0307416_102570724 3300032002 Bacteria 607
413 Ga0373948_0183730 3300034817 Bacteria 538
414 Ga0373928_0056252 3300035084 Bacteria 941
415 Ga0373940_0362015 3300035088 Bacteria 511
416 Ga0373949_0048497 3300035090 Bacteria 1064
417 Ga0373951_0030687 3300035091 Bacteria 1266
418 Ga0373952_0013989 3300035092 Bacteria 1600
419 Ga0373932_0013191 3300035112 Bacteria 2050
420 Ga0373962_0027086 3300035242 Bacteria 1549
421 Ga0373931_0473344 3300035691 Bacteria 804
422 Ga0373935_0552152 3300035692 Bacteria 840
423 Ga0395905_1432156 3300037471 Unclassified 595
424 Ga0439441_087781 3300042001 Bacteria 684
425 Ga0439435_0101031 3300042436 Unclassified 886
426 Ga0451576_0275561 3300045051 Bacteria 1759
427 Ga0451576_0276729 3300045051 Unclassified 1755
428 Ga0451576_0545161 3300045051 Bacteria 1219
429 Ga0495580_0694800 3300046472 Bacteria 666
430 Ga0495663_0383799 3300046525 Unclassified 515
431 Ga0495642_0135597 3300046528 Bacteria 1061
432 Ga0495659_0283947 3300046664 Bacteria 696
433 Ga0495669_0421264 3300046684 Unclassified 648
434 Ga0495684_0249526 3300047471 Bacteria 1292
435 Ga0496104_0881609 3300048907 Bacteria 800
436 Ga0496108_0694048 3300048911 Unclassified 883
437 Ga0496109_0284451 3300048912 Bacteria 1559
438 Ga0496109_1000907 3300048912 Unclassified 773
439 Ga0496110_1030322 3300048913 Bacteria 731
440 Ga0496112_0267589 3300048915 Bacteria 1658
441 Ga0496112_0294338 3300048915 Bacteria 1569
442 Ga0501080_1087822 3300049742 Unclassified 691
443 Ga0501081_0998996 3300049743 Bacteria 632
444 nmdc:mga03683_94596_c1 3300050489 Bacteria 1306
445 nmdc:mga00v17_194999_c1 3300050491 Bacteria 1309
446 nmdc:mga00v17_22662_c1 3300050491 Bacteria 3626
447 nmdc:mga0yw44_321935_c1 3300050492 Bacteria 1038
448 nmdc:mga0k408_332898_c1 3300050493 Unclassified 906
449 nmdc:mga06z11_54504_c1 3300050494 Bacteria 2061
450 nmdc:mga04h51_67703_c1 3300050495 Unclassified 1239
451 nmdc:mga05p37_10221_c1 3300050507 Bacteria 11145
452 nmdc:mga05p37_1131487_c1 3300050507 Unclassified 816
453 nmdc:mga05p37_121245_c1 3300050507 Bacteria 3212
454 nmdc:mga05p37_138905_c1 3300050507 Bacteria 2978
455 nmdc:mga05p37_214281_c1 3300050507 Bacteria 2327
456 nmdc:mga05p37_2391_c1 3300050507 Bacteria 21817
457 nmdc:mga05p37_30433_c1 3300050507 Bacteria 6586
458 nmdc:mga05p37_382669_c1 3300050507 Unclassified 1648
459 nmdc:mga05p37_401240_c1 3300050507 Bacteria 1601
460 nmdc:mga05p37_41448_c1 3300050507 Bacteria 5652
461 nmdc:mga05p37_425122_c1 3300050507 Bacteria 1545
462 nmdc:mga05p37_4292_c1 3300050507 Bacteria 16647
463 nmdc:mga05p37_43495_c1 3300050507 Bacteria 5526
464 nmdc:mga05p37_45780_c1 3300050507 Bacteria 5380
465 nmdc:mga05p37_541773_c1 3300050507 Bacteria 1327
466 nmdc:mga05p37_57509_c1 3300050507 Unclassified 4790
467 nmdc:mga05p37_595939_c1 3300050507 Bacteria 1248
468 nmdc:mga05p37_90185_c1 3300050507 Bacteria 3778
469 nmdc:mga05p37_903707_c1 3300050507 Unclassified 952
470 nmdc:mga09592_1315749_c1 3300050508 Unclassified 593
471 nmdc:mga09592_134908_c1 3300050508 Bacteria 2126
472 nmdc:mga09592_221453_c1 3300050508 Bacteria 1639
473 nmdc:mga09592_452605_c1 3300050508 Bacteria 1107
474 nmdc:mga0qj67_482172_c1 3300050509 Unclassified 998
475 nmdc:mga06r32_140230_c1 3300050510 Bacteria 2393
476 nmdc:mga06r32_19741_c1 3300050510 Bacteria 6193
477 nmdc:mga06r32_53236_c1 3300050510 Bacteria 3877
478 nmdc:mga06r32_82164_c1 3300050510 Bacteria 3138
479 nmdc:mga08y16_1145108_c1 3300050511 Bacteria 751
480 nmdc:mga08y16_1196084_c1 3300050511 Unclassified 731
481 nmdc:mga08y16_13267_c1 3300050511 Bacteria 8665
482 nmdc:mga08y16_167692_c1 3300050511 Bacteria 2281
483 nmdc:mga08y16_24790_c1 3300050511 Bacteria 6330
484 nmdc:mga08y16_48373_c1 3300050511 Bacteria 4451
485 nmdc:mga08y16_573693_c1 3300050511 Bacteria 1140
486 nmdc:mga08y16_6292_c1 3300050511 Bacteria 12450
487 nmdc:mga0n895_1260058_c1 3300050512 Unclassified 711
488 nmdc:mga0n895_1311467_c1 3300050512 Bacteria 694
489 nmdc:mga0n895_146400_c1 3300050512 Unclassified 2392
490 nmdc:mga0n895_162851_c1 3300050512 Bacteria 2262
491 nmdc:mga0n895_1760401_c1 3300050512 Bacteria 581
492 nmdc:mga0n895_1879860_c1 3300050512 Bacteria 558
493 nmdc:mga0n895_242804_c1 3300050512 Bacteria 1828
494 nmdc:mga0n895_352682_c1 3300050512 Bacteria 1490
495 nmdc:mga0n895_398566_c1 3300050512 Unclassified 1392
496 nmdc:mga0n895_62928_c1 3300050512 Bacteria 3669
497 nmdc:mga0n895_668987_c1 3300050512 Unclassified 1036
498 nmdc:mga0n895_744832_c1 3300050512 Unclassified 973
499 nmdc:mga0n895_810003_c1 3300050512 Bacteria 926
500 nmdc:mga0n895_81_c1 3300050512 Bacteria 54736
501 nmdc:mga0rr50_1080770_c1 3300050513 Bacteria 683
502 nmdc:mga0rr50_126894_c1 3300050513 Bacteria 2038
503 nmdc:mga0rr50_1341067_c1 3300050513 Bacteria 606
504 nmdc:mga0rr50_1341071_c1 3300050513 Unclassified 606
505 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
506 nmdc:mga0rr50_363642_c1 3300050513 Bacteria 1218
507 nmdc:mga0rr50_38547_c1 3300050513 Bacteria 1962
508 nmdc:mga0rr50_49780_c1 3300050513 Bacteria 3103
509 nmdc:mga0rr50_56499_c1 3300050513 Bacteria 2933
510 nmdc:mga0rr50_88254_c1 3300050513 Bacteria 2409
511 nmdc:mga08x19_100729_c1 3300050514 Bacteria 1916
512 nmdc:mga08x19_141324_c1 3300050514 Bacteria 1626
513 nmdc:mga08x19_165520_c1 3300050514 Bacteria 1503
514 nmdc:mga08x19_197932_c1 3300050514 Bacteria 1377
515 nmdc:mga08x19_265_c1 3300050514 Bacteria 39740
516 nmdc:mga08x19_63086_c1 3300050514 Bacteria 2404
517 nmdc:mga08x19_642883_c1 3300050514 Unclassified 752
518 nmdc:mga08x19_90544_c1 3300050514 Bacteria 824
519 nmdc:mga08x19_976562_c1 3300050514 Bacteria 602
520 nmdc:mga08x19_983382_c1 3300050514 Bacteria 599
521 nmdc:mga0a205_1258225_c1 3300050515 Bacteria 588
522 nmdc:mga0a205_285898_c1 3300050515 Bacteria 1524
523 nmdc:mga0a205_345975_c1 3300050515 Bacteria 1355
524 nmdc:mga0a205_371106_c1 3300050515 Bacteria 1297
525 nmdc:mga0a205_38509_c1 3300050515 Bacteria 4600
526 nmdc:mga0a205_403032_c1 3300050515 Bacteria 1231
527 nmdc:mga0a205_4415_c1 3300050515 Bacteria 12621
528 nmdc:mga0a205_506698_c1 3300050515 Bacteria 1064
529 nmdc:mga0a205_618715_c1 3300050515 Bacteria 935
530 nmdc:mga0a205_65243_c1 3300050515 Bacteria 3517
531 nmdc:mga0a205_656878_c1 3300050515 Bacteria 900
532 nmdc:mga0a205_76831_c1 3300050515 Unclassified 3227
533 nmdc:mga0a205_89486_c1 3300050515 Bacteria 2975
534 nmdc:mga0a205_896503_c1 3300050515 Bacteria 734
535 Ga0501082_0826209 3300060353 Bacteria 811
536 Ga0075433_10724513
537 JGI25406J46586_10170271
538 Ga0065707_10430398
539 Ga0070676_10006898
540 Ga0070690_100066619
541 Ga0070690_101111122
542 Ga0070690_101319237
543 Ga0070670_100931550
544 Ga0070677_10424322
545 Ga0068869_101020241
546 Ga0070666_11096250
547 Ga0070680_100982605
548 Ga0068868_100504311
549 Ga0070689_100159270
550 Ga0070689_100410801
551 Ga0070689_101280522
552 Ga0070689_102139075
553 Ga0070691_10011485
554 Ga0070691_11026482
555 Ga0070687_100135313
556 Ga0070687_100210250
557 Ga0070687_100507540
558 Ga0070692_10267097
559 Ga0070692_10560379
560 Ga0070668_100077057
561 Ga0070668_100185242
562 Ga0070668_100352076
563 Ga0070668_102213622
564 Ga0070669_100034521
565 Ga0070669_100141465
566 Ga0070669_100144099
567 Ga0070669_100285384
568 Ga0070669_101417395
569 Ga0070669_101908559
570 Ga0070675_100000646
571 Ga0070675_100081901
572 Ga0070675_101815037
573 Ga0070671_100015464
574 Ga0070671_100447957
575 Ga0070674_100004867
576 Ga0070674_102174044
577 Ga0070673_100074787
578 Ga0070673_100091360
579 Ga0070673_100490811
580 Ga0070673_100920833
581 Ga0070673_101090296
582 Ga0070688_100015804
583 Ga0070688_100110995
584 Ga0070688_100213833
585 Ga0070667_100012313
586 Ga0070667_100029780
587 Ga0070703_10060664
588 Ga0070703_10563330
589 Ga0070709_10957934
590 Ga0070701_10005444
591 Ga0070701_10504925
592 Ga0070701_10874118
593 Ga0070711_100191527
594 Ga0070711_100507900
595 Ga0070705_100010012
596 Ga0070705_100593129
597 Ga0070700_100011240
598 Ga0070700_100316502
599 Ga0070700_100411264
600 Ga0070700_101245952
601 Ga0070700_101304852
602 Ga0070700_101992072
603 Ga0070694_100056791
604 Ga0070694_100069496
605 Ga0070708_100147169
606 Ga0070708_100319385
607 Ga0070708_100696262
608 Ga0070708_101934781
609 Ga0070678_100964897
610 Ga0070678_101268182
611 Ga0070662_100240086
612 Ga0070662_100434225
613 Ga0070662_101865239
614 Ga0070681_10110480
615 Ga0068867_100017168
616 Ga0068867_100295921
617 Ga0070706_100051975
618 Ga0070707_100080831
619 Ga0070707_100226206
620 Ga0070707_100498270
621 Ga0070707_100593953
622 Ga0070707_102293953
623 Ga0070698_100008414
624 Ga0070698_100648597
625 Ga0070698_100753451
626 Ga0070698_101070347
627 Ga0070698_101401563
628 Ga0070698_101456512
629 Ga0070698_101891275
630 Ga0070699_100051367
631 Ga0070699_100132462
632 Ga0070699_100165257
633 Ga0070699_100180948
634 Ga0070699_100847233
635 Ga0070697_100095334
636 Ga0070697_100155065
637 Ga0070697_100359273
638 Ga0070672_100080196
639 Ga0070672_100250467
640 Ga0070672_100495935
641 Ga0070695_100002747
642 Ga0070695_100010637
643 Ga0070695_100303704
644 Ga0070696_100011794
645 Ga0070696_100028451
646 Ga0070696_100079691
647 Ga0070696_100415725
648 Ga0070696_101113922
649 Ga0070696_102018769
650 Ga0070704_100001732
651 Ga0070704_100007654
652 Ga0070704_102226537
653 Ga0068854_100808633
654 Ga0070702_100015694
655 Ga0068859_100029841
656 Ga0068859_100242029
657 Ga0068859_101324768
658 Ga0068864_100352787
659 Ga0068864_100968836
660 Ga0068864_102652003
661 Ga0068866_10046291
662 Ga0068861_100162485
663 Ga0068861_100163230
664 Ga0068861_100230786
665 Ga0068861_100300968
666 Ga0068861_101107728
667 Ga0068870_10375321
668 Ga0068863_100004770
669 Ga0068858_100149697
670 Ga0068858_100279544
671 Ga0068858_101474413
672 Ga0068860_100076502
673 Ga0068860_100113392
674 Ga0068860_100248085
675 Ga0068860_100486314
676 Ga0068862_100029986
677 Ga0068862_100064717
678 Ga0068862_100412640
679 Ga0068862_100876628
680 Ga0068862_101055276
681 Ga0068862_101444060
682 Ga0081455_10067248
683 Ga0081455_10502483
684 Ga0081455_10782120
685 Ga0081539_10011740
686 Ga0081539_10240015
687 Ga0075368_10056264
688 Ga0070715_10988301
689 Ga0075362_10113208
690 Ga0075367_10010560
691 Ga0075366_10018669
692 Ga0097621_100402174
693 Ga0068871_100163441
694 Ga0075428_100063403
695 Ga0075428_100146923
696 Ga0075428_100268086
697 Ga0075428_100360038
698 Ga0075428_100491328
699 Ga0075428_100638943
700 Ga0075430_100004498
701 Ga0075430_100681664
702 Ga0075430_101625851
703 Ga0075431_100057133
704 Ga0075431_100098803
705 Ga0075431_100122969
706 Ga0075431_100157580
707 Ga0075433_10076873
708 Ga0075433_10077781
709 Ga0075433_10082535
710 Ga0075433_10111945
711 Ga0075433_10238622
712 Ga0075433_10314392
713 Ga0075433_10381739
714 Ga0075433_10433969
715 Ga0075433_10480346
716 Ga0075433_10563386
717 Ga0075433_10857932
718 Ga0075433_11576496
719 Ga0075434_100000019
720 Ga0075434_100029213
721 Ga0075434_100055726
722 Ga0075434_100065084
723 Ga0075434_100143073
724 Ga0075434_100199105
725 Ga0075434_100379946
726 Ga0075434_100728301
727 Ga0075434_100888757
728 Ga0075434_100904326
729 Ga0075434_100956988
730 Ga0075434_101274192
731 Ga0075434_101291798
732 Ga0075434_101348566
733 Ga0075434_101408717
734 Ga0075434_101532279
735 Ga0075434_102102896
736 Ga0075429_100068330
737 Ga0075429_100200641
738 Ga0075429_100827300
739 Ga0075429_100971699
740 Ga0075429_101354910
741 Ga0068865_100238096
742 Ga0075436_100000160
743 Ga0075436_100025174
744 Ga0075436_100040486
745 Ga0075436_100070751
746 Ga0075436_100143750
747 Ga0075436_100351871
748 Ga0075436_100518396
749 Ga0075436_100846519
750 Ga0075436_101001839
751 Ga0075436_101157355
752 Ga0097620_100029840
753 Ga0097620_100242034
754 Ga0097620_101324792
755 Ga0075435_100000041
756 Ga0075435_100010613
757 Ga0075435_100016607
758 Ga0075435_100023759
759 Ga0075435_100100722
760 Ga0075435_100224459
761 Ga0075435_100356724
762 Ga0075435_100374410
763 Ga0075435_101956469
764 Ga0105240_10446128
765 Ga0111539_10001016
766 Ga0111539_10023995
767 Ga0111539_10026772
768 Ga0111539_10147513
769 Ga0111539_10267194
770 Ga0111539_10389439
771 Ga0111539_10428091
772 Ga0111539_10582882
773 Ga0111539_13003010
774 Ga0105245_10160398
775 Ga0114129_10000965
776 Ga0114129_10001059
777 Ga0114129_10017195
778 Ga0114129_10024000
779 Ga0114129_10041322
780 Ga0114129_10044215
781 Ga0114129_10047485
782 Ga0114129_10057343
783 Ga0114129_10060403
784 Ga0114129_10063052
785 Ga0114129_10123896
786 Ga0114129_10128995
787 Ga0114129_10133103
788 Ga0114129_10138210
789 Ga0114129_10254099
790 Ga0114129_10346989
791 Ga0114129_10473318
792 Ga0114129_10622441
793 Ga0114129_10947018
794 Ga0114129_11181570
795 Ga0114129_11878065
796 Ga0114129_11985210
797 Ga0105243_10003634
798 Ga0105243_10059764
799 Ga0105243_12373182
800 Ga0105242_10200563
801 Ga0105242_10245474
802 Ga0105242_11078974
803 Ga0105242_11394769
804 Ga0105248_10009548
805 Ga0105248_10033567
806 Ga0105248_10041463
807 Ga0105248_10272366
808 Ga0105248_12478134
809 Ga0105249_10414650
810 Ga0105249_10608724
811 Ga0105249_10722112
812 Ga0105249_11409546
813 Ga0105249_12671400
814 Ga0105246_12158497
815 Ga0157320_1034668
816 Ga0157337_1036345
817 Ga0157378_10226805
818 Ga0157378_11437019
819 Ga0163162_10028563
820 Ga0163162_12820027
821 Ga0163162_12839913
822 Ga0157375_10022054
823 Ga0157375_10112596
824 Ga0157375_10408231
825 Ga0157375_11547973
826 Ga0157380_10104210
827 Ga0157380_10533149
828 Ga0157380_12126700
829 Ga0157380_12413165
830 Ga0157380_12715618
831 Ga0157380_13037446
832 Ga0157377_10127967
833 Ga0157377_10820367
834 Ga0157377_11684249
835 Ga0157379_10066811
836 Ga0157379_10575648
837 Ga0157379_10590227
838 Ga0157376_10990436
839 Ga0157376_11697128
840 Ga0163161_10415575
841 Ga0163161_10553325
842 Ga0163161_10773430
843 Ga0207697_10051091
844 Ga0207682_10458524
845 Ga0207642_10070765
846 Ga0207642_10551943
847 Ga0207688_10321820
848 Ga0207680_10486524
849 Ga0207685_10684427
850 Ga0207685_10766973
851 Ga0207645_10005233
852 Ga0207645_10648825
853 Ga0207684_10418564
854 Ga0207707_10472741
855 Ga0207663_10187174
856 Ga0207663_10455320
857 Ga0207662_10097600
858 Ga0207662_10666224
859 Ga0207662_10767011
860 Ga0207662_11383892
861 Ga0207646_10230794
862 Ga0207646_10345574
863 Ga0207646_11663900
864 Ga0207681_10023323
865 Ga0207681_10093297
866 Ga0207681_11421051
867 Ga0207659_10000495
868 Ga0207644_10065813
869 Ga0207644_10385100
870 Ga0207706_10080214
871 Ga0207706_10114338
872 Ga0207686_10228627
873 Ga0207686_10270774
874 Ga0207686_10794730
875 Ga0207686_11535425
876 Ga0207709_10020844
877 Ga0207709_10376701
878 Ga0207670_10122892
879 Ga0207670_10136155
880 Ga0207670_11077931
881 Ga0207669_11342474
882 Ga0207704_10572999
883 Ga0207704_11242564
884 Ga0207665_10770615
885 Ga0207665_11337579
886 Ga0207691_10043737
887 Ga0207691_10130197
888 Ga0207691_10217307
889 Ga0207711_10057510
890 Ga0207689_10367132
891 Ga0207667_10831220
892 Ga0207651_10066353
893 Ga0207651_10337360
894 Ga0207651_10937474
895 Ga0207651_11410473
896 Ga0207712_11668747
897 Ga0207668_10159013
898 Ga0207668_10291304
899 Ga0207640_10885553
900 Ga0207640_11881864
901 Ga0207658_10309744
902 Ga0207658_10429554
903 Ga0207658_10840228
904 Ga0207677_10591544
905 Ga0207703_10118932
906 Ga0207703_10181810
907 Ga0207703_10980259
908 Ga0207678_10474691
909 Ga0207708_10016967
910 Ga0207708_10053971
911 Ga0207708_10248168
912 Ga0207708_10665067
913 Ga0207708_10884270
914 Ga0207708_11090986
915 Ga0207641_10001068
916 Ga0207648_10013498
917 Ga0207648_10071277
918 Ga0207648_10126326
919 Ga0207648_11503334
920 Ga0207676_10497714
921 Ga0207676_10499186
922 Ga0207676_11670920
923 Ga0207675_100001265
924 Ga0207675_100012547
925 Ga0207675_100025187
926 Ga0207675_100048509
927 Ga0207675_100329527
928 Ga0207675_100735519
929 Ga0207675_101113530
930 Ga0207683_10613507
931 Ga0207428_10000329
932 Ga0207428_10126618
933 Ga0207428_10388958
934 Ga0207428_10490343
935 Ga0268265_10025655
936 Ga0268265_10209468
937 Ga0268265_10546104
938 Ga0268265_11021877
939 Ga0268265_11072099
940 Ga0268265_11182670
941 Ga0268265_12698350
942 Ga0268264_10085840
943 Ga0268264_10169678
944 Ga0268264_10330046
945 Ga0268264_10441851
946 Ga0268264_10818059
947 Ga0307416_102570724
948 Ga0373948_0183730
949 Ga0373928_0056252
950 Ga0373940_0362015
951 Ga0373949_0048497
952 Ga0373951_0030687
953 Ga0373952_0013989
954 Ga0373932_0013191
955 Ga0373962_0027086
956 Ga0373931_0473344
957 Ga0373935_0552152
958 Ga0395905_1432156
959 Ga0439441_087781
960 Ga0439435_0101031
961 Ga0451576_0275561
962 Ga0451576_0276729
963 Ga0451576_0545161
964 Ga0495580_0694800
965 Ga0495663_0383799
966 Ga0495642_0135597
967 Ga0495659_0283947
968 Ga0495669_0421264
969 Ga0495684_0249526
970 Ga0496104_0881609
971 Ga0496108_0694048
972 Ga0496109_0284451
973 Ga0496109_1000907
974 Ga0496110_1030322
975 Ga0496112_0267589
976 Ga0496112_0294338
977 Ga0501080_1087822
978 Ga0501081_0998996
979 nmdc:mga03683_94596_c1
980 nmdc:mga00v17_194999_c1
981 nmdc:mga00v17_22662_c1
982 nmdc:mga0yw44_321935_c1
983 nmdc:mga0k408_332898_c1
984 nmdc:mga06z11_54504_c1
985 nmdc:mga04h51_67703_c1
986 nmdc:mga05p37_10221_c1
987 nmdc:mga05p37_1131487_c1
988 nmdc:mga05p37_121245_c1
989 nmdc:mga05p37_138905_c1
990 nmdc:mga05p37_214281_c1
991 nmdc:mga05p37_2391_c1
992 nmdc:mga05p37_30433_c1
993 nmdc:mga05p37_382669_c1
994 nmdc:mga05p37_401240_c1
995 nmdc:mga05p37_41448_c1
996 nmdc:mga05p37_425122_c1
997 nmdc:mga05p37_4292_c1
998 nmdc:mga05p37_43495_c1
999 nmdc:mga05p37_45780_c1
1000 nmdc:mga05p37_541773_c1
1001 nmdc:mga05p37_57509_c1
1002 nmdc:mga05p37_595939_c1
1003 nmdc:mga05p37_90185_c1
1004 nmdc:mga05p37_903707_c1
1005 nmdc:mga09592_1315749_c1
1006 nmdc:mga09592_134908_c1
1007 nmdc:mga09592_221453_c1
1008 nmdc:mga09592_452605_c1
1009 nmdc:mga0qj67_482172_c1
1010 nmdc:mga06r32_140230_c1
1011 nmdc:mga06r32_19741_c1
1012 nmdc:mga06r32_53236_c1
1013 nmdc:mga06r32_82164_c1
1014 nmdc:mga08y16_1145108_c1
1015 nmdc:mga08y16_1196084_c1
1016 nmdc:mga08y16_13267_c1
1017 nmdc:mga08y16_167692_c1
1018 nmdc:mga08y16_24790_c1
1019 nmdc:mga08y16_48373_c1
1020 nmdc:mga08y16_573693_c1
1021 nmdc:mga08y16_6292_c1
1022 nmdc:mga0n895_1260058_c1
1023 nmdc:mga0n895_1311467_c1
1024 nmdc:mga0n895_146400_c1
1025 nmdc:mga0n895_162851_c1
1026 nmdc:mga0n895_1760401_c1
1027 nmdc:mga0n895_1879860_c1
1028 nmdc:mga0n895_242804_c1
1029 nmdc:mga0n895_352682_c1
1030 nmdc:mga0n895_398566_c1
1031 nmdc:mga0n895_62928_c1
1032 nmdc:mga0n895_668987_c1
1033 nmdc:mga0n895_744832_c1
1034 nmdc:mga0n895_810003_c1
1035 nmdc:mga0n895_81_c1
1036 nmdc:mga0rr50_1080770_c1
1037 nmdc:mga0rr50_126894_c1
1038 nmdc:mga0rr50_1341067_c1
1039 nmdc:mga0rr50_1341071_c1
1040 nmdc:mga0rr50_1_c1
1041 nmdc:mga0rr50_363642_c1
1042 nmdc:mga0rr50_38547_c1
1043 nmdc:mga0rr50_49780_c1
1044 nmdc:mga0rr50_56499_c1
1045 nmdc:mga0rr50_88254_c1
1046 nmdc:mga08x19_100729_c1
1047 nmdc:mga08x19_141324_c1
1048 nmdc:mga08x19_165520_c1
1049 nmdc:mga08x19_197932_c1
1050 nmdc:mga08x19_265_c1
1051 nmdc:mga08x19_63086_c1
1052 nmdc:mga08x19_642883_c1
1053 nmdc:mga08x19_90544_c1
1054 nmdc:mga08x19_976562_c1
1055 nmdc:mga08x19_983382_c1
1056 nmdc:mga0a205_1258225_c1
1057 nmdc:mga0a205_285898_c1
1058 nmdc:mga0a205_345975_c1
1059 nmdc:mga0a205_371106_c1
1060 nmdc:mga0a205_38509_c1
1061 nmdc:mga0a205_403032_c1
1062 nmdc:mga0a205_4415_c1
1063 nmdc:mga0a205_506698_c1
1064 nmdc:mga0a205_618715_c1
1065 nmdc:mga0a205_65243_c1
1066 nmdc:mga0a205_656878_c1
1067 nmdc:mga0a205_76831_c1
1068 nmdc:mga0a205_89486_c1
1069 nmdc:mga0a205_896503_c1
1070 Ga0501082_0826209

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

24

101

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8897 9 81
7cbv-assembly1.cif.gz_A-3 crystal structure of the transcriptional regulator padr from bacillus subtilis (space group h32) 0.8798 7 92
2co5-assembly1.cif.gz_A f93 from stiv, a winged-helix dna-binding protein 0.8784 6 99
5y8t-assembly2.cif.gz_B crystal structure of bacillus subtilis padr in complex with p-coumaric acid 0.8705 7 89
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.866 9 105
ID Description Score Start End Superfamily
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8897 9 81 1.10.10.10
2co5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8784 6 99 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8646 9 92 1.10.10.10
5x11A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8635 6 92 1.10.10.10
5y8tC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8627 7 92 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A5B9ED52-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9672 6 105
AF-A0A1S8SBJ7-F1-model_v4 Lineage-specific thermal regulator protein 0.9663 6 105
AF-A0A1G0IEE7-F1-model_v4 Transcription regulator PadR N-terminal domain-containing protein 0.9603 2 106
AF-A0A2M6W906-F1-model_v4 PadR family transcriptional regulator 0.9599 3 107
AF-A0A838R183-F1-model_v4 PadR family transcriptional regulator 0.9591 6 111

Map