F460610

General Info

Members Datasets Scaffolds Average Seq Length
535 180 1070 173

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10203775|rootH1_102037751
Length 170
Sequence MRAVGLIAFGMLCVVASAAGAQCRLCEQPTTERPTDTPQGDVELRIETSLNFDRLILNGAGPGTVTIRPDGSNSAAGSVTDVGPRAMVGTVLVHGDAGRQVRVELPHRIELYSLVGSGRITLDDVSSDLPAMPRLDAAGNLTFRFGGRLVVTGDADGQYRGDLPITVEYL

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
149 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
150 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
151 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
152 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
165 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 3.18
Rhizosphere 95.89
Stem 0
Stem Tuber 0
Unclassified 15.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10203775 3300003323 Bacteria 2328
2 JGI24740J21852_10008028 3300001979 Bacteria 4241
3 JGI24737J22298_10001782 3300001990 Bacteria 7706
4 JGI24737J22298_10002581 3300001990 Bacteria 6426
5 JGI24737J22298_10002638 3300001990 Bacteria 6342
6 JGI24743J22301_10059877 3300001991 Bacteria 783
7 JGI24034J26672_10060657 3300002239 Bacteria 664
8 rootL2_10209363 3300003322 Unclassified 1338
9 Ga0070658_10000256 3300005327 Bacteria 46854
10 Ga0070658_10232154 3300005327 Bacteria 1562
11 Ga0070658_11002453 3300005327 Unclassified 726
12 Ga0070676_10860974 3300005328 Bacteria 672
13 Ga0070683_100002147 3300005329 Bacteria 15585
14 Ga0070683_100403642 3300005329 Bacteria 1303
15 Ga0070690_100176644 3300005330 Bacteria 1473
16 Ga0070670_100007879 3300005331 Bacteria 9060
17 Ga0070670_100219975 3300005331 Unclassified 1652
18 Ga0070670_100272225 3300005331 Bacteria 1478
19 Ga0070677_10007273 3300005333 Bacteria 3692
20 Ga0068869_100643297 3300005334 Bacteria 899
21 Ga0070666_10000283 3300005335 Bacteria 33586
22 Ga0070680_100000105 3300005336 Bacteria 48515
23 Ga0070680_100351989 3300005336 Bacteria 1252
24 Ga0070680_100398148 3300005336 Unclassified 1173
25 Ga0070682_100015056 3300005337 Bacteria 4478
26 Ga0070682_100146273 3300005337 Bacteria 1617
27 Ga0068868_100128395 3300005338 Bacteria 2073
28 Ga0068868_100159273 3300005338 Bacteria 1863
29 Ga0068868_100865172 3300005338 Unclassified 819
30 Ga0068868_100865173 3300005338 Bacteria 819
31 Ga0070660_100000064 3300005339 Bacteria 62554
32 Ga0070660_100016252 3300005339 Bacteria 5398
33 Ga0070660_100021173 3300005339 Bacteria 4791
34 Ga0070660_100035473 3300005339 Bacteria 3775
35 Ga0070660_100038177 3300005339 Bacteria 3644
36 Ga0070660_100039736 3300005339 Bacteria 3577
37 Ga0070691_10070490 3300005341 Bacteria 1696
38 Ga0070661_100007299 3300005344 Bacteria 7622
39 Ga0070661_100024716 3300005344 Bacteria 4310
40 Ga0070661_100030038 3300005344 Bacteria 3924
41 Ga0070661_100032801 3300005344 Bacteria 3761
42 Ga0070661_100098297 3300005344 Bacteria 2174
43 Ga0070661_100131426 3300005344 Bacteria 1881
44 Ga0070661_100185535 3300005344 Bacteria 1584
45 Ga0070661_100251963 3300005344 Bacteria 1363
46 Ga0070661_100317878 3300005344 Bacteria 1215
47 Ga0070661_100416498 3300005344 Unclassified 1064
48 Ga0070661_100710623 3300005344 Bacteria 819
49 Ga0070668_100168274 3300005347 Bacteria 1783
50 Ga0070668_101288461 3300005347 Unclassified 664
51 Ga0070675_100054604 3300005354 Bacteria 3287
52 Ga0070675_100538783 3300005354 Bacteria 1055
53 Ga0070671_100000254 3300005355 Bacteria 35845
54 Ga0070671_100005160 3300005355 Bacteria 10397
55 Ga0070671_100007895 3300005355 Bacteria 8508
56 Ga0070674_100021218 3300005356 Bacteria 4165
57 Ga0070674_100027037 3300005356 Bacteria 3755
58 Ga0070674_100040013 3300005356 Bacteria 3169
59 Ga0070674_100221100 3300005356 Bacteria 1473
60 Ga0070674_100303364 3300005356 Bacteria 1274
61 Ga0070673_100000376 3300005364 Bacteria 23364
62 Ga0070673_100022699 3300005364 Bacteria 4571
63 Ga0070673_100758856 3300005364 Unclassified 894
64 Ga0070673_100771182 3300005364 Bacteria 886
65 Ga0070659_100022328 3300005366 Bacteria 4830
66 Ga0070659_100138679 3300005366 Bacteria 1979
67 Ga0070659_100209688 3300005366 Unclassified 1606
68 Ga0070659_100645273 3300005366 Unclassified 912
69 Ga0070659_100892748 3300005366 Bacteria 776
70 Ga0070667_100005308 3300005367 Bacteria 10765
71 Ga0070714_100019430 3300005435 Bacteria 5536
72 Ga0070714_100049680 3300005435 Bacteria 3571
73 Ga0070714_100254540 3300005435 Unclassified 1625
74 Ga0070714_100397852 3300005435 Unclassified 1301
75 Ga0070663_100000033 3300005455 Bacteria 71453
76 Ga0070663_100020226 3300005455 Bacteria 4404
77 Ga0070663_100071785 3300005455 Bacteria 2520
78 Ga0070663_100350709 3300005455 Bacteria 1195
79 Ga0070663_100830360 3300005455 Bacteria 794
80 Ga0070678_100000919 3300005456 Bacteria 15133
81 Ga0070678_100011837 3300005456 Bacteria 5397
82 Ga0070678_100161377 3300005456 Bacteria 1816
83 Ga0070678_100491948 3300005456 Bacteria 1081
84 Ga0070662_100001749 3300005457 Bacteria 13373
85 Ga0070662_100002947 3300005457 Bacteria 10584
86 Ga0070662_100007901 3300005457 Bacteria 6916
87 Ga0070662_100031925 3300005457 Bacteria 3699
88 Ga0070662_100079474 3300005457 Unclassified 2439
89 Ga0070662_100142453 3300005457 Unclassified 1859
90 Ga0070662_100145559 3300005457 Bacteria 1840
91 Ga0070662_100573293 3300005457 Bacteria 947
92 Ga0070681_10330537 3300005458 Bacteria 1434
93 Ga0070681_10343543 3300005458 Unclassified 1402
94 Ga0068867_100069025 3300005459 Bacteria 2639
95 Ga0068867_100118453 3300005459 Bacteria 2043
96 Ga0070679_100000125 3300005530 Bacteria 61348
97 Ga0070679_100073544 3300005530 Bacteria 3409
98 Ga0070679_100075427 3300005530 Bacteria 3362
99 Ga0070679_100123835 3300005530 Bacteria 2568
100 Ga0070679_100453482 3300005530 Bacteria 1227
101 Ga0070679_100753757 3300005530 Unclassified 916
102 Ga0070684_100062964 3300005535 Bacteria 3250
103 Ga0070684_100336867 3300005535 Bacteria 1387
104 Ga0070684_100637946 3300005535 Bacteria 991
105 Ga0070684_100673483 3300005535 Bacteria 964
106 Ga0070684_101071341 3300005535 Bacteria 757
107 Ga0068853_100060729 3300005539 Bacteria 3267
108 Ga0068853_100107684 3300005539 Bacteria 2471
109 Ga0068853_100212160 3300005539 Bacteria 1765
110 Ga0068853_100392628 3300005539 Bacteria 1297
111 Ga0068853_100497347 3300005539 Bacteria 1151
112 Ga0068853_100629359 3300005539 Bacteria 1020
113 Ga0068853_100889198 3300005539 Unclassified 855
114 Ga0068853_101342841 3300005539 Bacteria 691
115 Ga0070672_100001101 3300005543 Bacteria 16486
116 Ga0070672_100072914 3300005543 Bacteria 2735
117 Ga0070672_100086601 3300005543 Bacteria 2519
118 Ga0070672_100119674 3300005543 Bacteria 2154
119 Ga0070686_100155472 3300005544 Bacteria 1605
120 Ga0070693_100084478 3300005547 Bacteria 1900
121 Ga0070693_100305841 3300005547 Bacteria 1073
122 Ga0070665_100005491 3300005548 Bacteria 13062
123 Ga0068855_100003759 3300005563 Bacteria 18557
124 Ga0068855_100064613 3300005563 Bacteria 4268
125 Ga0068855_100863409 3300005563 Unclassified 958
126 Ga0068855_100948483 3300005563 Bacteria 906
127 Ga0068855_101353638 3300005563 Bacteria 735
128 Ga0070664_100005544 3300005564 Bacteria 10133
129 Ga0070664_100007877 3300005564 Bacteria 8605
130 Ga0070664_100023796 3300005564 Bacteria 5060
131 Ga0070664_100318138 3300005564 Bacteria 1409
132 Ga0070664_100797041 3300005564 Unclassified 883
133 Ga0068857_100014657 3300005577 Bacteria 6837
134 Ga0068857_100122595 3300005577 Bacteria 2341
135 Ga0068857_100568926 3300005577 Archaea 1069
136 Ga0068854_100015748 3300005578 Bacteria 5020
137 Ga0068854_100019507 3300005578 Bacteria 4571
138 Ga0068854_100022666 3300005578 Bacteria 4284
139 Ga0068854_100081577 3300005578 Unclassified 2389
140 Ga0068854_100130736 3300005578 Bacteria 1917
141 Ga0068856_100001220 3300005614 Bacteria 26928
142 Ga0068856_100032252 3300005614 Bacteria 5128
143 Ga0068856_100161695 3300005614 Bacteria 2250
144 Ga0068856_100181053 3300005614 Bacteria 2120
145 Ga0068856_100932971 3300005614 Bacteria 887
146 Ga0068852_100060096 3300005616 Bacteria 3299
147 Ga0068852_100127749 3300005616 Bacteria 2337
148 Ga0068852_100188814 3300005616 Bacteria 1943
149 Ga0068852_100234299 3300005616 Bacteria 1751
150 Ga0068852_100270630 3300005616 Unclassified 1634
151 Ga0068852_100387316 3300005616 Bacteria 1372
152 Ga0068852_100482185 3300005616 Bacteria 1232
153 Ga0068852_101121112 3300005616 Unclassified 807
154 Ga0068852_101425877 3300005616 Bacteria 715
155 Ga0068859_100350970 3300005617 Bacteria 1570
156 Ga0068864_100000872 3300005618 Bacteria 25408
157 Ga0068864_100051204 3300005618 Bacteria 3556
158 Ga0068864_100070717 3300005618 Bacteria 3037
159 Ga0068864_100954667 3300005618 Unclassified 849
160 Ga0068866_10008487 3300005718 Bacteria 4333
161 Ga0068866_10415565 3300005718 Bacteria 871
162 Ga0068861_100413583 3300005719 Unclassified 1200
163 Ga0068851_10171591 3300005834 Bacteria 1197
164 Ga0068851_10360018 3300005834 Bacteria 848
165 Ga0068870_10054163 3300005840 Bacteria 2133
166 Ga0068870_10272761 3300005840 Bacteria 1057
167 Ga0068863_100008708 3300005841 Bacteria 9912
168 Ga0068863_100014126 3300005841 Bacteria 7692
169 Ga0068858_100003129 3300005842 Bacteria 16562
170 Ga0068858_101275017 3300005842 Bacteria 723
171 Ga0081539_10009912 3300005985 Bacteria 7857
172 Ga0081539_10014483 3300005985 Bacteria 5829
173 Ga0097621_100003808 3300006237 Bacteria 10448
174 Ga0097621_100166664 3300006237 Bacteria 1897
175 Ga0097621_100288301 3300006237 Bacteria 1447
176 Ga0068871_100003766 3300006358 Bacteria 10443
177 Ga0068871_100306189 3300006358 Bacteria 1396
178 Ga0068871_100333626 3300006358 Bacteria 1338
179 Ga0068871_101108154 3300006358 Bacteria 740
180 Ga0068865_100054947 3300006881 Bacteria 2770
181 Ga0068865_100065378 3300006881 Unclassified 2562
182 Ga0068865_100125923 3300006881 Bacteria 1912
183 Ga0097620_100350963 3300006931 Bacteria 1570
184 Ga0105240_10061209 3300009093 Bacteria 4692
185 Ga0105245_10226908 3300009098 Bacteria 1805
186 Ga0105247_10247024 3300009101 Bacteria 1218
187 Ga0105241_10126918 3300009174 Bacteria 2061
188 Ga0105241_10198329 3300009174 Bacteria 1675
189 Ga0105241_10407069 3300009174 Bacteria 1194
190 Ga0105241_11088062 3300009174 Bacteria 752
191 Ga0105242_10081070 3300009176 Bacteria 2713
192 Ga0105242_10600631 3300009176 Bacteria 1063
193 Ga0105248_10001388 3300009177 Bacteria 26986
194 Ga0105248_10006386 3300009177 Bacteria 12938
195 Ga0105248_10075266 3300009177 Bacteria 3794
196 Ga0105248_10136112 3300009177 Bacteria 2771
197 Ga0105248_10664926 3300009177 Unclassified 1175
198 Ga0105237_10040560 3300009545 Bacteria 4694
199 Ga0105238_10007978 3300009551 Bacteria 10591
200 Ga0105238_10213573 3300009551 Bacteria 1906
201 Ga0105238_10993153 3300009551 Archaea 860
202 Ga0105239_11312899 3300010375 Unclassified 835
203 Ga0105246_10025059 3300011119 Bacteria 3886
204 Ga0157373_10008483 3300013100 Bacteria 7633
205 Ga0157373_10019114 3300013100 Bacteria 4987
206 Ga0157373_10046604 3300013100 Unclassified 3094
207 Ga0157373_10101239 3300013100 Bacteria 2027
208 Ga0157373_10110424 3300013100 Bacteria 1933
209 Ga0157373_10369195 3300013100 Unclassified 1025
210 Ga0157371_10020207 3300013102 Bacteria 4901
211 Ga0157371_10098773 3300013102 Bacteria 2070
212 Ga0157371_10384000 3300013102 Bacteria 1026
213 Ga0157371_10430863 3300013102 Bacteria 968
214 Ga0157371_10976203 3300013102 Unclassified 645
215 Ga0157370_10013496 3300013104 Bacteria 8413
216 Ga0157370_10019834 3300013104 Bacteria 6728
217 Ga0157370_10058240 3300013104 Bacteria 3672
218 Ga0157370_10093569 3300013104 Bacteria 2821
219 Ga0157370_10113889 3300013104 Bacteria 2527
220 Ga0157370_10167628 3300013104 Bacteria 2042
221 Ga0157370_10462515 3300013104 Bacteria 1166
222 Ga0157370_10719209 3300013104 Bacteria 911
223 Ga0157369_10015684 3300013105 Bacteria 8538
224 Ga0157369_10042401 3300013105 Bacteria 4964
225 Ga0157369_10346398 3300013105 Bacteria 1543
226 Ga0157369_10351051 3300013105 Bacteria 1532
227 Ga0157369_10385325 3300013105 Bacteria 1455
228 Ga0157369_10437782 3300013105 Bacteria 1354
229 Ga0157369_10611088 3300013105 Bacteria 1125
230 Ga0157374_10002141 3300013296 Bacteria 16638
231 Ga0157374_10075550 3300013296 Bacteria 3183
232 Ga0157374_10299993 3300013296 Bacteria 1589
233 Ga0157378_10007549 3300013297 Bacteria 9494
234 Ga0163162_10002668 3300013306 Bacteria 16918
235 Ga0163162_10177961 3300013306 Unclassified 2253
236 Ga0157372_10625607 3300013307 Bacteria 1254
237 Ga0157372_10730279 3300013307 Bacteria 1152
238 Ga0157375_10000709 3300013308 Bacteria 29414
239 Ga0157375_10216074 3300013308 Bacteria 2075
240 Ga0157375_10441594 3300013308 Bacteria 1467
241 Ga0163163_10025429 3300014325 Bacteria 5643
242 Ga0163163_10641259 3300014325 Bacteria 1126
243 Ga0157380_11076503 3300014326 Bacteria 842
244 Ga0157379_11588817 3300014968 Bacteria 638
245 Ga0163161_10070517 3300017792 Bacteria 2555
246 Ga0206356_11383162 3300020070 Bacteria 1831
247 Ga0206354_10066929 3300020081 Unclassified 907
248 Ga0213876_10086453 3300021384 Bacteria 1659
249 Ga0207697_10008677 3300025315 Bacteria 4432
250 Ga0207697_10041796 3300025315 Bacteria 1882
251 Ga0207656_10153093 3300025321 Bacteria 1093
252 Ga0207682_10002868 3300025893 Bacteria 7612
253 Ga0207642_10033352 3300025899 Bacteria 2178
254 Ga0207688_10019334 3300025901 Bacteria 3709
255 Ga0207688_10057703 3300025901 Bacteria 2183
256 Ga0207680_10116345 3300025903 Unclassified 1742
257 Ga0207647_10001741 3300025904 Bacteria 16680
258 Ga0207647_10011845 3300025904 Bacteria 6095
259 Ga0207647_10012218 3300025904 Bacteria 5985
260 Ga0207647_10013910 3300025904 Bacteria 5570
261 Ga0207647_10017712 3300025904 Bacteria 4838
262 Ga0207647_10037599 3300025904 Bacteria 3068
263 Ga0207647_10049958 3300025904 Bacteria 2592
264 Ga0207647_10052488 3300025904 Bacteria 2516
265 Ga0207645_10040502 3300025907 Bacteria 2983
266 Ga0207645_10058080 3300025907 Bacteria 2470
267 Ga0207643_10061231 3300025908 Bacteria 2149
268 Ga0207705_10000067 3300025909 Bacteria 136004
269 Ga0207705_10007927 3300025909 Bacteria 7795
270 Ga0207705_10021065 3300025909 Bacteria 4650
271 Ga0207705_10137805 3300025909 Bacteria 1820
272 Ga0207705_10155522 3300025909 Unclassified 1715
273 Ga0207705_10423227 3300025909 Bacteria 1031
274 Ga0207654_10173404 3300025911 Bacteria 1402
275 Ga0207707_10089385 3300025912 Bacteria 2692
276 Ga0207707_10458712 3300025912 Bacteria 1090
277 Ga0207707_10705859 3300025912 Bacteria 847
278 Ga0207695_10025391 3300025913 Bacteria 6633
279 Ga0207660_10000379 3300025917 Bacteria 29073
280 Ga0207657_10000552 3300025919 Bacteria 39920
281 Ga0207657_10010503 3300025919 Bacteria 9236
282 Ga0207657_10020368 3300025919 Bacteria 6268
283 Ga0207657_10021170 3300025919 Bacteria 6126
284 Ga0207657_10027173 3300025919 Bacteria 5245
285 Ga0207657_10028662 3300025919 Bacteria 5074
286 Ga0207657_10044316 3300025919 Bacteria 3911
287 Ga0207657_10049374 3300025919 Bacteria 3667
288 Ga0207657_10065715 3300025919 Bacteria 3091
289 Ga0207657_10193906 3300025919 Bacteria 1637
290 Ga0207657_10261998 3300025919 Unclassified 1376
291 Ga0207649_10022690 3300025920 Bacteria 3627
292 Ga0207649_10032485 3300025920 Bacteria 3112
293 Ga0207649_10092022 3300025920 Bacteria 1987
294 Ga0207649_10336323 3300025920 Unclassified 1114
295 Ga0207649_10423090 3300025920 Bacteria 1001
296 Ga0207652_10000058 3300025921 Bacteria 113620
297 Ga0207652_10038048 3300025921 Bacteria 4075
298 Ga0207652_10046238 3300025921 Bacteria 3713
299 Ga0207652_10519393 3300025921 Unclassified 1071
300 Ga0207681_10246439 3300025923 Bacteria 1393
301 Ga0207694_10146782 3300025924 Bacteria 1899
302 Ga0207694_10248373 3300025924 Unclassified 1455
303 Ga0207650_10004140 3300025925 Bacteria 9915
304 Ga0207659_10042929 3300025926 Bacteria 3173
305 Ga0207664_10288287 3300025929 Bacteria 1442
306 Ga0207644_10000433 3300025931 Bacteria 27154
307 Ga0207644_10009936 3300025931 Bacteria 6261
308 Ga0207644_10020631 3300025931 Bacteria 4484
309 Ga0207644_10162114 3300025931 Bacteria 1739
310 Ga0207644_10315457 3300025931 Bacteria 1263
311 Ga0207690_10004596 3300025932 Bacteria 8161
312 Ga0207690_10032994 3300025932 Bacteria 3326
313 Ga0207690_10059687 3300025932 Bacteria 2585
314 Ga0207690_10119855 3300025932 Bacteria 1909
315 Ga0207706_10001018 3300025933 Bacteria 28609
316 Ga0207706_10003258 3300025933 Bacteria 15548
317 Ga0207706_10011636 3300025933 Bacteria 8019
318 Ga0207706_10014436 3300025933 Bacteria 7159
319 Ga0207706_10030757 3300025933 Bacteria 4788
320 Ga0207706_10107721 3300025933 Unclassified 2452
321 Ga0207706_10119423 3300025933 Unclassified 2318
322 Ga0207706_10159760 3300025933 Unclassified 1981
323 Ga0207706_10424083 3300025933 Bacteria 1152
324 Ga0207706_10773460 3300025933 Bacteria 817
325 Ga0207709_10248468 3300025935 Bacteria 1298
326 Ga0207669_10009179 3300025937 Bacteria 4693
327 Ga0207669_10042328 3300025937 Bacteria 2658
328 Ga0207669_10057308 3300025937 Bacteria 2371
329 Ga0207669_10460378 3300025937 Bacteria 1010
330 Ga0207704_10013614 3300025938 Bacteria 4078
331 Ga0207704_10016479 3300025938 Bacteria 3799
332 Ga0207691_10002752 3300025940 Bacteria 17143
333 Ga0207691_10090795 3300025940 Bacteria 2737
334 Ga0207711_10001101 3300025941 Bacteria 25793
335 Ga0207711_10061788 3300025941 Bacteria 3230
336 Ga0207711_10685685 3300025941 Unclassified 956
337 Ga0207711_10749684 3300025941 Bacteria 910
338 Ga0207689_10080395 3300025942 Bacteria 2679
339 Ga0207661_10011579 3300025944 Bacteria 6398
340 Ga0207661_10152598 3300025944 Unclassified 1998
341 Ga0207661_10335182 3300025944 Unclassified 1362
342 Ga0207679_10066245 3300025945 Bacteria 2706
343 Ga0207679_10090351 3300025945 Bacteria 2367
344 Ga0207679_10416225 3300025945 Bacteria 1185
345 Ga0207679_10597403 3300025945 Bacteria 994
346 Ga0207679_10790331 3300025945 Unclassified 865
347 Ga0207667_10000828 3300025949 Bacteria 39983
348 Ga0207667_10030711 3300025949 Bacteria 5807
349 Ga0207667_10253201 3300025949 Bacteria 1801
350 Ga0207667_10284538 3300025949 Bacteria 1689
351 Ga0207667_10422500 3300025949 Bacteria 1356
352 Ga0207667_10759080 3300025949 Bacteria 969
353 Ga0207651_10002567 3300025960 Bacteria 8680
354 Ga0207668_10476390 3300025972 Bacteria 1070
355 Ga0207668_10477081 3300025972 Bacteria 1069
356 Ga0207640_10016992 3300025981 Bacteria 4247
357 Ga0207640_10066213 3300025981 Bacteria 2413
358 Ga0207640_10222065 3300025981 Bacteria 1447
359 Ga0207640_10238293 3300025981 Unclassified 1404
360 Ga0207640_10876183 3300025981 Unclassified 783
361 Ga0207658_10005897 3300025986 Bacteria 8370
362 Ga0207658_10373819 3300025986 Unclassified 1247
363 Ga0207658_10810823 3300025986 Bacteria 850
364 Ga0207703_10004673 3300026035 Bacteria 11183
365 Ga0207639_10093261 3300026041 Bacteria 2414
366 Ga0207639_10231450 3300026041 Bacteria 1602
367 Ga0207639_10249272 3300026041 Bacteria 1548
368 Ga0207639_10343892 3300026041 Bacteria 1330
369 Ga0207639_10420070 3300026041 Unclassified 1209
370 Ga0207639_10493687 3300026041 Bacteria 1117
371 Ga0207678_10000278 3300026067 Bacteria 46335
372 Ga0207678_10003532 3300026067 Bacteria 14064
373 Ga0207678_10021032 3300026067 Bacteria 5719
374 Ga0207678_10032015 3300026067 Bacteria 4584
375 Ga0207678_10034240 3300026067 Bacteria 4424
376 Ga0207678_10036934 3300026067 Bacteria 4253
377 Ga0207678_10037939 3300026067 Bacteria 4189
378 Ga0207678_10046226 3300026067 Bacteria 3764
379 Ga0207678_10086908 3300026067 Bacteria 2672
380 Ga0207702_10001153 3300026078 Bacteria 27012
381 Ga0207702_10014617 3300026078 Bacteria 6515
382 Ga0207641_10012153 3300026088 Bacteria 7065
383 Ga0207648_10013069 3300026089 Bacteria 7741
384 Ga0207648_10142999 3300026089 Bacteria 2109
385 Ga0207648_10241381 3300026089 Bacteria 1609
386 Ga0207676_10004340 3300026095 Bacteria 10033
387 Ga0207676_10022029 3300026095 Bacteria 4683
388 Ga0207676_10120717 3300026095 Bacteria 2210
389 Ga0207674_10005354 3300026116 Bacteria 15262
390 Ga0207674_10015427 3300026116 Bacteria 8393
391 Ga0207674_10027609 3300026116 Bacteria 6001
392 Ga0207674_10053689 3300026116 Bacteria 4106
393 Ga0207683_10002199 3300026121 Bacteria 17148
394 Ga0207683_10013142 3300026121 Bacteria 7064
395 Ga0207683_10022212 3300026121 Bacteria 5445
396 Ga0207683_10234671 3300026121 Bacteria 1673
397 Ga0207683_10426071 3300026121 Bacteria 1222
398 Ga0207698_10057804 3300026142 Bacteria 3003
399 Ga0207698_10094089 3300026142 Bacteria 2463
400 Ga0207698_10105911 3300026142 Bacteria 2344
401 Ga0207698_10288080 3300026142 Bacteria 1522
402 Ga0268266_10271420 3300028379 Unclassified 1574
403 Ga0307410_11096359 3300031852 Unclassified 690
404 Ga0307414_10015116 3300032004 Bacteria 4652
405 Ga0307411_10009203 3300032005 Bacteria 5176
406 Ga0307415_100703358 3300032126 Unclassified 912
407 Ga0373945_0131069 3300035116 Bacteria 1004
408 Ga0373943_0003958 3300035170 Bacteria 6742
409 Ga0373947_0071856 3300035725 Bacteria 2123
410 Ga0395899_0001975 3300037312 Bacteria 16871
411 Ga0395899_0002294 3300037312 Bacteria 15602
412 Ga0395899_0070941 3300037312 Bacteria 2550
413 Ga0395899_0088400 3300037312 Bacteria 2248
414 Ga0395899_0094082 3300037312 Unclassified 2169
415 Ga0395899_0150015 3300037312 Bacteria 1653
416 Ga0395899_0183004 3300037312 Unclassified 1470
417 Ga0395899_0329670 3300037312 Bacteria 1026
418 Ga0395899_0406590 3300037312 Unclassified 899
419 Ga0395899_0448283 3300037312 Bacteria 845
420 Ga0395900_0002103 3300037418 Bacteria 22302
421 Ga0395900_0027825 3300037418 Bacteria 5792
422 Ga0395900_0041584 3300037418 Bacteria 4738
423 Ga0395900_0042230 3300037418 Bacteria 4698
424 Ga0395900_0122908 3300037418 Bacteria 2662
425 Ga0395900_0157105 3300037418 Bacteria 2322
426 Ga0395900_0169773 3300037418 Bacteria 2221
427 Ga0395900_0180780 3300037418 Bacteria 2143
428 Ga0395900_0192102 3300037418 Bacteria 2070
429 Ga0395900_0248681 3300037418 Bacteria 1780
430 Ga0395900_0371551 3300037418 Bacteria 1399
431 Ga0395900_0525023 3300037418 Unclassified 1131
432 Ga0395900_0614273 3300037418 Bacteria 1026
433 Ga0395900_0617412 3300037418 Unclassified 1023
434 Ga0395900_0738201 3300037418 Unclassified 916
435 Ga0395900_0779502 3300037418 Unclassified 885
436 Ga0395900_1171205 3300037418 Unclassified 684
437 Ga0395898_0010610 3300037466 Bacteria 9620
438 Ga0395898_0012499 3300037466 Bacteria 8778
439 Ga0395898_0040101 3300037466 Bacteria 4632
440 Ga0395898_0082253 3300037466 Bacteria 3104
441 Ga0395898_0256246 3300037466 Bacteria 1668
442 Ga0395898_0399800 3300037466 Bacteria 1310
443 Ga0395898_0600393 3300037466 Bacteria 1043
444 Ga0395898_0652107 3300037466 Bacteria 995
445 Ga0395898_1018518 3300037466 Unclassified 763
446 Ga0395905_0000464 3300037471 Bacteria 56406
447 Ga0395905_0003538 3300037471 Bacteria 16646
448 Ga0395905_0006416 3300037471 Bacteria 11842
449 Ga0395905_0007442 3300037471 Bacteria 10890
450 Ga0395905_0007957 3300037471 Bacteria 10481
451 Ga0395905_0008169 3300037471 Bacteria 10334
452 Ga0395905_0015212 3300037471 Bacteria 7317
453 Ga0395905_0017398 3300037471 Bacteria 6825
454 Ga0395905_0024772 3300037471 Bacteria 5662
455 Ga0395905_0034915 3300037471 Bacteria 4721
456 Ga0395905_0039194 3300037471 Bacteria 4445
457 Ga0395905_0045910 3300037471 Bacteria 4097
458 Ga0395905_0053791 3300037471 Bacteria 3767
459 Ga0395905_0055945 3300037471 Bacteria 3692
460 Ga0395905_0071805 3300037471 Bacteria 3245
461 Ga0395905_0076377 3300037471 Bacteria 3139
462 Ga0395905_0100971 3300037471 Plasmid 2709
463 Ga0395905_0140361 3300037471 Unclassified 2273
464 Ga0395905_0201622 3300037471 Bacteria 1865
465 Ga0395905_0289586 3300037471 Bacteria 1524
466 Ga0395905_0536188 3300037471 Unclassified 1071
467 Ga0395905_0635712 3300037471 Unclassified 969
468 Ga0395905_0911312 3300037471 Unclassified 782
469 Ga0395901_0002916 3300038443 Bacteria 17264
470 Ga0395901_0006236 3300038443 Bacteria 12089
471 Ga0395901_0010407 3300038443 Bacteria 9422
472 Ga0395901_0013874 3300038443 Bacteria 8197
473 Ga0395901_0021067 3300038443 Bacteria 6678
474 Ga0395901_0039189 3300038443 Bacteria 4903
475 Ga0395901_0041165 3300038443 Bacteria 4787
476 Ga0395901_0044251 3300038443 Bacteria 4617
477 Ga0395901_0128267 3300038443 Bacteria 2666
478 Ga0395901_0132711 3300038443 Bacteria 2617
479 Ga0395901_0185714 3300038443 Bacteria 2180
480 Ga0395901_0361559 3300038443 Unclassified 1496
481 Ga0395901_0436916 3300038443 Bacteria 1340
482 Ga0395901_0497056 3300038443 Bacteria 1242
483 Ga0395901_0737507 3300038443 Unclassified 979
484 Ga0395901_0833999 3300038443 Bacteria 908
485 Ga0395901_1085984 3300038443 Unclassified 771
486 Ga0436365_0240589 3300039437 Bacteria 6189
487 Ga0451802_0089661 3300041460 Unclassified 566
488 Ga0439448_0000593 3300042005 Bacteria 8516
489 Ga0439458_0000023 3300042157 Bacteria 23385
490 Ga0439458_0000066 3300042157 Bacteria 18748
491 Ga0466969_0031128 3300044656 Bacteria 2717
492 Ga0466969_0117179 3300044656 Unclassified 1242
493 Ga0466965_0278856 3300044683 Unclassified 902
494 Ga0466966_0027144 3300044684 Bacteria 3733
495 Ga0466966_0102435 3300044684 Bacteria 1769
496 Ga0466966_0102616 3300044684 Unclassified 1768
497 Ga0466961_0017772 3300044693 Unclassified 4569
498 Ga0466961_0143512 3300044693 Bacteria 1494
499 Ga0466963_0012892 3300044694 Bacteria 5122
500 Ga0466963_0055681 3300044694 Bacteria 2630
501 Ga0466963_0093463 3300044694 Unclassified 2050
502 Ga0466963_0341962 3300044694 Unclassified 1053
503 Ga0466971_0004390 3300044719 Bacteria 6085
504 Ga0466970_0584719 3300044765 Unclassified 647
505 Ga0466957_0097139 3300044842 Unclassified 1852
506 Ga0466957_0239693 3300044842 Bacteria 1203
507 Ga0466959_0103609 3300045049 Unclassified 2035
508 Ga0466959_0112351 3300045049 Bacteria 1943
509 Ga0466958_0025601 3300045836 Bacteria 3480
510 Ga0466967_0030923 3300045976 Bacteria 4499
511 Ga0466967_0140221 3300045976 Unclassified 2251
512 Ga0466967_0153775 3300045976 Bacteria 2153
513 Ga0495643_0206069 3300046522 Bacteria 941
514 Ga0495668_0036194 3300046616 Bacteria 2766
515 Ga0495669_0011529 3300046684 Bacteria 3754
516 Ga0495677_0005664 3300047445 Bacteria 4733
517 Ga0496100_0257238 3300048903 Bacteria 1293
518 Ga0496101_0074132 3300048904 Bacteria 2502
519 Ga0496102_0139841 3300048905 Bacteria 2270
520 Ga0496102_0340933 3300048905 Bacteria 1411
521 Ga0496103_0745365 3300048906 Bacteria 619
522 Ga0496106_0219872 3300048909 Bacteria 1515
523 Ga0496107_0035483 3300048910 Bacteria 3575
524 Ga0496108_0003462 3300048911 Bacteria 12662
525 Ga0496109_0152672 3300048912 Bacteria 2162
526 Ga0496111_0001883 3300048914 Bacteria 12409
527 Ga0496112_0023556 3300048915 Bacteria 5883
528 Ga0496112_0073862 3300048915 Bacteria 3371
529 Ga0496113_0002116 3300048916 Bacteria 11451
530 Ga0496113_0911735 3300048916 Unclassified 695
531 Ga0496114_0054943 3300048917 Bacteria 3320
532 Ga0496115_0067829 3300048918 Bacteria 2886
533 nmdc:mga0k408_133073_c1 3300050493 Bacteria 1476
534 Ga0466962_0055629 3300061719 Unclassified 1890
535 Ga0466962_0150255 3300061719 Unclassified 1130
536 rootH1_10203775
537 JGI24740J21852_10008028
538 JGI24737J22298_10001782
539 JGI24737J22298_10002581
540 JGI24737J22298_10002638
541 JGI24743J22301_10059877
542 JGI24034J26672_10060657
543 rootL2_10209363
544 Ga0070658_10000256
545 Ga0070658_10232154
546 Ga0070658_11002453
547 Ga0070676_10860974
548 Ga0070683_100002147
549 Ga0070683_100403642
550 Ga0070690_100176644
551 Ga0070670_100007879
552 Ga0070670_100219975
553 Ga0070670_100272225
554 Ga0070677_10007273
555 Ga0068869_100643297
556 Ga0070666_10000283
557 Ga0070680_100000105
558 Ga0070680_100351989
559 Ga0070680_100398148
560 Ga0070682_100015056
561 Ga0070682_100146273
562 Ga0068868_100128395
563 Ga0068868_100159273
564 Ga0068868_100865172
565 Ga0068868_100865173
566 Ga0070660_100000064
567 Ga0070660_100016252
568 Ga0070660_100021173
569 Ga0070660_100035473
570 Ga0070660_100038177
571 Ga0070660_100039736
572 Ga0070691_10070490
573 Ga0070661_100007299
574 Ga0070661_100024716
575 Ga0070661_100030038
576 Ga0070661_100032801
577 Ga0070661_100098297
578 Ga0070661_100131426
579 Ga0070661_100185535
580 Ga0070661_100251963
581 Ga0070661_100317878
582 Ga0070661_100416498
583 Ga0070661_100710623
584 Ga0070668_100168274
585 Ga0070668_101288461
586 Ga0070675_100054604
587 Ga0070675_100538783
588 Ga0070671_100000254
589 Ga0070671_100005160
590 Ga0070671_100007895
591 Ga0070674_100021218
592 Ga0070674_100027037
593 Ga0070674_100040013
594 Ga0070674_100221100
595 Ga0070674_100303364
596 Ga0070673_100000376
597 Ga0070673_100022699
598 Ga0070673_100758856
599 Ga0070673_100771182
600 Ga0070659_100022328
601 Ga0070659_100138679
602 Ga0070659_100209688
603 Ga0070659_100645273
604 Ga0070659_100892748
605 Ga0070667_100005308
606 Ga0070714_100019430
607 Ga0070714_100049680
608 Ga0070714_100254540
609 Ga0070714_100397852
610 Ga0070663_100000033
611 Ga0070663_100020226
612 Ga0070663_100071785
613 Ga0070663_100350709
614 Ga0070663_100830360
615 Ga0070678_100000919
616 Ga0070678_100011837
617 Ga0070678_100161377
618 Ga0070678_100491948
619 Ga0070662_100001749
620 Ga0070662_100002947
621 Ga0070662_100007901
622 Ga0070662_100031925
623 Ga0070662_100079474
624 Ga0070662_100142453
625 Ga0070662_100145559
626 Ga0070662_100573293
627 Ga0070681_10330537
628 Ga0070681_10343543
629 Ga0068867_100069025
630 Ga0068867_100118453
631 Ga0070679_100000125
632 Ga0070679_100073544
633 Ga0070679_100075427
634 Ga0070679_100123835
635 Ga0070679_100453482
636 Ga0070679_100753757
637 Ga0070684_100062964
638 Ga0070684_100336867
639 Ga0070684_100637946
640 Ga0070684_100673483
641 Ga0070684_101071341
642 Ga0068853_100060729
643 Ga0068853_100107684
644 Ga0068853_100212160
645 Ga0068853_100392628
646 Ga0068853_100497347
647 Ga0068853_100629359
648 Ga0068853_100889198
649 Ga0068853_101342841
650 Ga0070672_100001101
651 Ga0070672_100072914
652 Ga0070672_100086601
653 Ga0070672_100119674
654 Ga0070686_100155472
655 Ga0070693_100084478
656 Ga0070693_100305841
657 Ga0070665_100005491
658 Ga0068855_100003759
659 Ga0068855_100064613
660 Ga0068855_100863409
661 Ga0068855_100948483
662 Ga0068855_101353638
663 Ga0070664_100005544
664 Ga0070664_100007877
665 Ga0070664_100023796
666 Ga0070664_100318138
667 Ga0070664_100797041
668 Ga0068857_100014657
669 Ga0068857_100122595
670 Ga0068857_100568926
671 Ga0068854_100015748
672 Ga0068854_100019507
673 Ga0068854_100022666
674 Ga0068854_100081577
675 Ga0068854_100130736
676 Ga0068856_100001220
677 Ga0068856_100032252
678 Ga0068856_100161695
679 Ga0068856_100181053
680 Ga0068856_100932971
681 Ga0068852_100060096
682 Ga0068852_100127749
683 Ga0068852_100188814
684 Ga0068852_100234299
685 Ga0068852_100270630
686 Ga0068852_100387316
687 Ga0068852_100482185
688 Ga0068852_101121112
689 Ga0068852_101425877
690 Ga0068859_100350970
691 Ga0068864_100000872
692 Ga0068864_100051204
693 Ga0068864_100070717
694 Ga0068864_100954667
695 Ga0068866_10008487
696 Ga0068866_10415565
697 Ga0068861_100413583
698 Ga0068851_10171591
699 Ga0068851_10360018
700 Ga0068870_10054163
701 Ga0068870_10272761
702 Ga0068863_100008708
703 Ga0068863_100014126
704 Ga0068858_100003129
705 Ga0068858_101275017
706 Ga0081539_10009912
707 Ga0081539_10014483
708 Ga0097621_100003808
709 Ga0097621_100166664
710 Ga0097621_100288301
711 Ga0068871_100003766
712 Ga0068871_100306189
713 Ga0068871_100333626
714 Ga0068871_101108154
715 Ga0068865_100054947
716 Ga0068865_100065378
717 Ga0068865_100125923
718 Ga0097620_100350963
719 Ga0105240_10061209
720 Ga0105245_10226908
721 Ga0105247_10247024
722 Ga0105241_10126918
723 Ga0105241_10198329
724 Ga0105241_10407069
725 Ga0105241_11088062
726 Ga0105242_10081070
727 Ga0105242_10600631
728 Ga0105248_10001388
729 Ga0105248_10006386
730 Ga0105248_10075266
731 Ga0105248_10136112
732 Ga0105248_10664926
733 Ga0105237_10040560
734 Ga0105238_10007978
735 Ga0105238_10213573
736 Ga0105238_10993153
737 Ga0105239_11312899
738 Ga0105246_10025059
739 Ga0157373_10008483
740 Ga0157373_10019114
741 Ga0157373_10046604
742 Ga0157373_10101239
743 Ga0157373_10110424
744 Ga0157373_10369195
745 Ga0157371_10020207
746 Ga0157371_10098773
747 Ga0157371_10384000
748 Ga0157371_10430863
749 Ga0157371_10976203
750 Ga0157370_10013496
751 Ga0157370_10019834
752 Ga0157370_10058240
753 Ga0157370_10093569
754 Ga0157370_10113889
755 Ga0157370_10167628
756 Ga0157370_10462515
757 Ga0157370_10719209
758 Ga0157369_10015684
759 Ga0157369_10042401
760 Ga0157369_10346398
761 Ga0157369_10351051
762 Ga0157369_10385325
763 Ga0157369_10437782
764 Ga0157369_10611088
765 Ga0157374_10002141
766 Ga0157374_10075550
767 Ga0157374_10299993
768 Ga0157378_10007549
769 Ga0163162_10002668
770 Ga0163162_10177961
771 Ga0157372_10625607
772 Ga0157372_10730279
773 Ga0157375_10000709
774 Ga0157375_10216074
775 Ga0157375_10441594
776 Ga0163163_10025429
777 Ga0163163_10641259
778 Ga0157380_11076503
779 Ga0157379_11588817
780 Ga0163161_10070517
781 Ga0206356_11383162
782 Ga0206354_10066929
783 Ga0213876_10086453
784 Ga0207697_10008677
785 Ga0207697_10041796
786 Ga0207656_10153093
787 Ga0207682_10002868
788 Ga0207642_10033352
789 Ga0207688_10019334
790 Ga0207688_10057703
791 Ga0207680_10116345
792 Ga0207647_10001741
793 Ga0207647_10011845
794 Ga0207647_10012218
795 Ga0207647_10013910
796 Ga0207647_10017712
797 Ga0207647_10037599
798 Ga0207647_10049958
799 Ga0207647_10052488
800 Ga0207645_10040502
801 Ga0207645_10058080
802 Ga0207643_10061231
803 Ga0207705_10000067
804 Ga0207705_10007927
805 Ga0207705_10021065
806 Ga0207705_10137805
807 Ga0207705_10155522
808 Ga0207705_10423227
809 Ga0207654_10173404
810 Ga0207707_10089385
811 Ga0207707_10458712
812 Ga0207707_10705859
813 Ga0207695_10025391
814 Ga0207660_10000379
815 Ga0207657_10000552
816 Ga0207657_10010503
817 Ga0207657_10020368
818 Ga0207657_10021170
819 Ga0207657_10027173
820 Ga0207657_10028662
821 Ga0207657_10044316
822 Ga0207657_10049374
823 Ga0207657_10065715
824 Ga0207657_10193906
825 Ga0207657_10261998
826 Ga0207649_10022690
827 Ga0207649_10032485
828 Ga0207649_10092022
829 Ga0207649_10336323
830 Ga0207649_10423090
831 Ga0207652_10000058
832 Ga0207652_10038048
833 Ga0207652_10046238
834 Ga0207652_10519393
835 Ga0207681_10246439
836 Ga0207694_10146782
837 Ga0207694_10248373
838 Ga0207650_10004140
839 Ga0207659_10042929
840 Ga0207664_10288287
841 Ga0207644_10000433
842 Ga0207644_10009936
843 Ga0207644_10020631
844 Ga0207644_10162114
845 Ga0207644_10315457
846 Ga0207690_10004596
847 Ga0207690_10032994
848 Ga0207690_10059687
849 Ga0207690_10119855
850 Ga0207706_10001018
851 Ga0207706_10003258
852 Ga0207706_10011636
853 Ga0207706_10014436
854 Ga0207706_10030757
855 Ga0207706_10107721
856 Ga0207706_10119423
857 Ga0207706_10159760
858 Ga0207706_10424083
859 Ga0207706_10773460
860 Ga0207709_10248468
861 Ga0207669_10009179
862 Ga0207669_10042328
863 Ga0207669_10057308
864 Ga0207669_10460378
865 Ga0207704_10013614
866 Ga0207704_10016479
867 Ga0207691_10002752
868 Ga0207691_10090795
869 Ga0207711_10001101
870 Ga0207711_10061788
871 Ga0207711_10685685
872 Ga0207711_10749684
873 Ga0207689_10080395
874 Ga0207661_10011579
875 Ga0207661_10152598
876 Ga0207661_10335182
877 Ga0207679_10066245
878 Ga0207679_10090351
879 Ga0207679_10416225
880 Ga0207679_10597403
881 Ga0207679_10790331
882 Ga0207667_10000828
883 Ga0207667_10030711
884 Ga0207667_10253201
885 Ga0207667_10284538
886 Ga0207667_10422500
887 Ga0207667_10759080
888 Ga0207651_10002567
889 Ga0207668_10476390
890 Ga0207668_10477081
891 Ga0207640_10016992
892 Ga0207640_10066213
893 Ga0207640_10222065
894 Ga0207640_10238293
895 Ga0207640_10876183
896 Ga0207658_10005897
897 Ga0207658_10373819
898 Ga0207658_10810823
899 Ga0207703_10004673
900 Ga0207639_10093261
901 Ga0207639_10231450
902 Ga0207639_10249272
903 Ga0207639_10343892
904 Ga0207639_10420070
905 Ga0207639_10493687
906 Ga0207678_10000278
907 Ga0207678_10003532
908 Ga0207678_10021032
909 Ga0207678_10032015
910 Ga0207678_10034240
911 Ga0207678_10036934
912 Ga0207678_10037939
913 Ga0207678_10046226
914 Ga0207678_10086908
915 Ga0207702_10001153
916 Ga0207702_10014617
917 Ga0207641_10012153
918 Ga0207648_10013069
919 Ga0207648_10142999
920 Ga0207648_10241381
921 Ga0207676_10004340
922 Ga0207676_10022029
923 Ga0207676_10120717
924 Ga0207674_10005354
925 Ga0207674_10015427
926 Ga0207674_10027609
927 Ga0207674_10053689
928 Ga0207683_10002199
929 Ga0207683_10013142
930 Ga0207683_10022212
931 Ga0207683_10234671
932 Ga0207683_10426071
933 Ga0207698_10057804
934 Ga0207698_10094089
935 Ga0207698_10105911
936 Ga0207698_10288080
937 Ga0268266_10271420
938 Ga0307410_11096359
939 Ga0307414_10015116
940 Ga0307411_10009203
941 Ga0307415_100703358
942 Ga0373945_0131069
943 Ga0373943_0003958
944 Ga0373947_0071856
945 Ga0395899_0001975
946 Ga0395899_0002294
947 Ga0395899_0070941
948 Ga0395899_0088400
949 Ga0395899_0094082
950 Ga0395899_0150015
951 Ga0395899_0183004
952 Ga0395899_0329670
953 Ga0395899_0406590
954 Ga0395899_0448283
955 Ga0395900_0002103
956 Ga0395900_0027825
957 Ga0395900_0041584
958 Ga0395900_0042230
959 Ga0395900_0122908
960 Ga0395900_0157105
961 Ga0395900_0169773
962 Ga0395900_0180780
963 Ga0395900_0192102
964 Ga0395900_0248681
965 Ga0395900_0371551
966 Ga0395900_0525023
967 Ga0395900_0614273
968 Ga0395900_0617412
969 Ga0395900_0738201
970 Ga0395900_0779502
971 Ga0395900_1171205
972 Ga0395898_0010610
973 Ga0395898_0012499
974 Ga0395898_0040101
975 Ga0395898_0082253
976 Ga0395898_0256246
977 Ga0395898_0399800
978 Ga0395898_0600393
979 Ga0395898_0652107
980 Ga0395898_1018518
981 Ga0395905_0000464
982 Ga0395905_0003538
983 Ga0395905_0006416
984 Ga0395905_0007442
985 Ga0395905_0007957
986 Ga0395905_0008169
987 Ga0395905_0015212
988 Ga0395905_0017398
989 Ga0395905_0024772
990 Ga0395905_0034915
991 Ga0395905_0039194
992 Ga0395905_0045910
993 Ga0395905_0053791
994 Ga0395905_0055945
995 Ga0395905_0071805
996 Ga0395905_0076377
997 Ga0395905_0100971
998 Ga0395905_0140361
999 Ga0395905_0201622
1000 Ga0395905_0289586
1001 Ga0395905_0536188
1002 Ga0395905_0635712
1003 Ga0395905_0911312
1004 Ga0395901_0002916
1005 Ga0395901_0006236
1006 Ga0395901_0010407
1007 Ga0395901_0013874
1008 Ga0395901_0021067
1009 Ga0395901_0039189
1010 Ga0395901_0041165
1011 Ga0395901_0044251
1012 Ga0395901_0128267
1013 Ga0395901_0132711
1014 Ga0395901_0185714
1015 Ga0395901_0361559
1016 Ga0395901_0436916
1017 Ga0395901_0497056
1018 Ga0395901_0737507
1019 Ga0395901_0833999
1020 Ga0395901_1085984
1021 Ga0436365_0240589
1022 Ga0451802_0089661
1023 Ga0439448_0000593
1024 Ga0439458_0000023
1025 Ga0439458_0000066
1026 Ga0466969_0031128
1027 Ga0466969_0117179
1028 Ga0466965_0278856
1029 Ga0466966_0027144
1030 Ga0466966_0102435
1031 Ga0466966_0102616
1032 Ga0466961_0017772
1033 Ga0466961_0143512
1034 Ga0466963_0012892
1035 Ga0466963_0055681
1036 Ga0466963_0093463
1037 Ga0466963_0341962
1038 Ga0466971_0004390
1039 Ga0466970_0584719
1040 Ga0466957_0097139
1041 Ga0466957_0239693
1042 Ga0466959_0103609
1043 Ga0466959_0112351
1044 Ga0466958_0025601
1045 Ga0466967_0030923
1046 Ga0466967_0140221
1047 Ga0466967_0153775
1048 Ga0495643_0206069
1049 Ga0495668_0036194
1050 Ga0495669_0011529
1051 Ga0495677_0005664
1052 Ga0496100_0257238
1053 Ga0496101_0074132
1054 Ga0496102_0139841
1055 Ga0496102_0340933
1056 Ga0496103_0745365
1057 Ga0496106_0219872
1058 Ga0496107_0035483
1059 Ga0496108_0003462
1060 Ga0496109_0152672
1061 Ga0496111_0001883
1062 Ga0496112_0023556
1063 Ga0496112_0073862
1064 Ga0496113_0002116
1065 Ga0496113_0911735
1066 Ga0496114_0054943
1067 Ga0496115_0067829
1068 nmdc:mga0k408_133073_c1
1069 Ga0466962_0055629
1070 Ga0466962_0150255

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14352

DUF4402

Domain of unknown function (DUF4402)

43

169

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dsn-assembly2.cif.gz_E crystal structure of the complex of the caf1m chaperone with the mini-fiber of two caf1 subunits (caf1:caf1), carrying the thr7phe mutation in the gd donor strand 0.4948 38 172
3dsn-assembly2.cif.gz_E crystal structure of the complex of the caf1m chaperone with the mini-fiber of two caf1 subunits (caf1:caf1), carrying the thr7phe mutation in the gd donor strand 0.4576 38 172
5y9g-assembly1.cif.gz_A crystal structure of salmonella safd adhesin 0.4397 45 171
6cd2-assembly1.cif.gz_B crystal structure of the papc usher bound to the chaperone-adhesin papd-papg 0.4309 93 172
5y9g-assembly1.cif.gz_A crystal structure of salmonella safd adhesin 0.3906 45 171
ID Description Score Start End Superfamily
af_A4ID76_449_697_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.4901 93 172 2.60.40.10
af_Q65XS0_164_295_2.60.40.1470 Mainly Beta;Sandwich;Immunoglobulin-like;ApaG domain 0.4718 29 171 2.60.40.1470
af_A0A1D6LEA8_2_119_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.464 44 170 2.60.40.10
af_Q6IE37_301_383_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.454 93 172 2.60.40.10
af_A0A1D6LEA8_2_119_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.4526 44 170 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A1L3JE52-F1-model_v4 DUF4402 domain-containing protein 0.9013 93 172
AF-A0A0S7ZXG9-F1-model_v4 DUF4402 domain-containing protein 0.7924 93 172
AF-A0A0Q6XQP1-F1-model_v4 DUF4402 domain-containing protein 0.7757 44 172
AF-A0A7X5LLT0-F1-model_v4 DUF4402 domain-containing protein 0.7741 40 170
AF-A0A2Z2NWV1-F1-model_v4 DUF4402 domain-containing protein 0.7661 45 171

Map