F460594

General Info

Members Datasets Scaffolds Average Seq Length
534 244 1068 296

Family's Representative Sequence

Representative Sequence 3300050496|nmdc:mga07m45_1848_c1|nmdc:mga07m45_1848_c1_937_1896
Length 319
Sequence VRRLQQQRDAVRPRDNTPAMPTPPASVDIVREFPDTSWADDGPTRSVERVVEDGMVLSFPRLPFVLDESERRFLDPRWTDGKAKNISVRWGPDFPGGELRGALGDAADLAALKAMIVRYSEQSEAFALRLFPHYRNHLKRGNTSFRPVNVAGRETSWRKDDTRLHIDAFPSNPMHGTRLLRVFCNVNPGGEPRRWRVGEPFEAHAQRYLAAIPRPLPGSAWLMNAVGVTKRRRTEYDHLMLQLHDRAKADAAFQSGSPQARVDFAPGTTWVVFSDQVLHAAMGGQHMMEQTFYLAPEKQHRPEASPLGILERLTGRTLR

Samples

Sample ID Description Type Environment
1 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
157 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
186 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
187 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
188 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
189 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
198 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
199 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
234 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
235 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
236 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
237 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
238 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
239 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
240 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
241 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
242 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
243 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
244 2738543032 Methylobacterium sp. GV104 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.74
Nodule 0
Rhizoplane 3.18
Rhizosphere 81.84
Stem 0
Stem Tuber 0
Unclassified 0.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga07m45_1848_c1 3300050496 Bacteria 9781
2 JGI25153J46596_10002674 3300003215 Bacteria 10176
3 rootH2_10193289 3300003320 Bacteria 1441
4 Ga0065707_10089777 3300005295 Bacteria 4285
5 Ga0070658_10076837 3300005327 Bacteria 2739
6 Ga0070676_10003719 3300005328 Bacteria 7995
7 Ga0070676_10071478 3300005328 Bacteria 2084
8 Ga0070676_10134388 3300005328 Bacteria 1568
9 Ga0070683_100085935 3300005329 Bacteria 2950
10 Ga0070683_100317590 3300005329 Bacteria 1482
11 Ga0070690_100022385 3300005330 Bacteria 3866
12 Ga0070690_100033413 3300005330 Bacteria 3220
13 Ga0070690_100196276 3300005330 Bacteria 1402
14 Ga0070670_100003543 3300005331 Bacteria 12981
15 Ga0070670_100018231 3300005331 Bacteria 6023
16 Ga0070670_100023516 3300005331 Bacteria 5305
17 Ga0070670_100118642 3300005331 Bacteria 2282
18 Ga0068869_100001372 3300005334 Bacteria 14439
19 Ga0068869_100006007 3300005334 Bacteria 7679
20 Ga0068869_100017329 3300005334 Bacteria 4880
21 Ga0068869_100049448 3300005334 Bacteria 3044
22 Ga0068868_100007721 3300005338 Bacteria 7675
23 Ga0068868_100019237 3300005338 Bacteria 5116
24 Ga0068868_100082771 3300005338 Bacteria 2575
25 Ga0070660_100036584 3300005339 Bacteria 3718
26 Ga0070660_100067881 3300005339 Bacteria 2778
27 Ga0070660_100170162 3300005339 Bacteria 1759
28 Ga0070689_100035179 3300005340 Bacteria 3826
29 Ga0070689_100103426 3300005340 Bacteria 2257
30 Ga0070689_100161416 3300005340 Bacteria 1812
31 Ga0070687_100016996 3300005343 Bacteria 3335
32 Ga0070692_10253705 3300005345 Bacteria 1054
33 Ga0070668_100031574 3300005347 Bacteria 4030
34 Ga0070668_100082857 3300005347 Bacteria 2516
35 Ga0070668_100112259 3300005347 Bacteria 2170
36 Ga0070669_100003484 3300005353 Bacteria 11344
37 Ga0070669_100052233 3300005353 Bacteria 2989
38 Ga0070675_100001397 3300005354 Bacteria 17704
39 Ga0070675_100384071 3300005354 Bacteria 1250
40 Ga0070671_100054064 3300005355 Bacteria 3338
41 Ga0070671_100122851 3300005355 Bacteria 2185
42 Ga0070671_100180348 3300005355 Bacteria 1788
43 Ga0070671_100207120 3300005355 Bacteria 1663
44 Ga0070671_100283407 3300005355 Bacteria 1409
45 Ga0070671_100386701 3300005355 Bacteria 1196
46 Ga0070674_100054663 3300005356 Bacteria 2762
47 Ga0070674_100148292 3300005356 Bacteria 1768
48 Ga0070674_100187525 3300005356 Bacteria 1588
49 Ga0070674_100194295 3300005356 Bacteria 1563
50 Ga0070673_100030456 3300005364 Bacteria 4038
51 Ga0070673_100104514 3300005364 Bacteria 2339
52 Ga0070673_100316722 3300005364 Bacteria 1377
53 Ga0070688_100176418 3300005365 Bacteria 1479
54 Ga0070659_100033110 3300005366 Bacteria 4012
55 Ga0070659_100047636 3300005366 Bacteria 3363
56 Ga0070667_100000702 3300005367 Bacteria 32315
57 Ga0070667_100011227 3300005367 Bacteria 7411
58 Ga0070667_100030960 3300005367 Bacteria 4462
59 Ga0070667_100112786 3300005367 Bacteria 2359
60 Ga0070667_100119317 3300005367 Bacteria 2293
61 Ga0070667_100147310 3300005367 Bacteria 2066
62 Ga0070667_100448669 3300005367 Bacteria 1179
63 Ga0070700_100010478 3300005441 Bacteria 5121
64 Ga0070700_100049504 3300005441 Bacteria 2609
65 Ga0070708_100172869 3300005445 Bacteria 2018
66 Ga0070663_100000205 3300005455 Bacteria 29517
67 Ga0070663_100008570 3300005455 Bacteria 6299
68 Ga0070663_100010855 3300005455 Bacteria 5691
69 Ga0070663_100048554 3300005455 Bacteria 3010
70 Ga0070663_100180925 3300005455 Bacteria 1635
71 Ga0070678_100188547 3300005456 Unclassified 1694
72 Ga0070662_100009364 3300005457 Bacteria 6403
73 Ga0070662_100050562 3300005457 Bacteria 2998
74 Ga0070662_100063518 3300005457 Bacteria 2701
75 Ga0070662_100103940 3300005457 Bacteria 2155
76 Ga0070662_100274718 3300005457 Bacteria 1362
77 Ga0070681_10025504 3300005458 Bacteria 5946
78 Ga0068867_100000173 3300005459 Bacteria 42222
79 Ga0068867_100000215 3300005459 Bacteria 38520
80 Ga0068867_100002735 3300005459 Bacteria 12433
81 Ga0068867_100066704 3300005459 Bacteria 2681
82 Ga0068867_100152826 3300005459 Bacteria 1815
83 Ga0068867_100318790 3300005459 Bacteria 1287
84 Ga0070706_100000671 3300005467 Bacteria 38797
85 Ga0070707_100069391 3300005468 Bacteria 3394
86 Ga0070679_100140746 3300005530 Bacteria 2392
87 Ga0070684_100005851 3300005535 Bacteria 9461
88 Ga0068853_100102248 3300005539 Bacteria 2535
89 Ga0068853_100150913 3300005539 Bacteria 2092
90 Ga0068853_100444875 3300005539 Bacteria 1218
91 Ga0070672_100009845 3300005543 Bacteria 6607
92 Ga0070672_100041971 3300005543 Bacteria 3520
93 Ga0070672_100043506 3300005543 Bacteria 3464
94 Ga0070672_100145899 3300005543 Bacteria 1955
95 Ga0070672_100199074 3300005543 Bacteria 1675
96 Ga0070672_100251894 3300005543 Bacteria 1487
97 Ga0070672_100418037 3300005543 Bacteria 1151
98 Ga0070665_100198158 3300005548 Bacteria 2009
99 Ga0068855_100164421 3300005563 Bacteria 2517
100 Ga0070664_100068144 3300005564 Bacteria 3042
101 Ga0070664_100133768 3300005564 Bacteria 2179
102 Ga0070664_100442248 3300005564 Bacteria 1193
103 Ga0070664_100447420 3300005564 Bacteria 1186
104 Ga0068857_100076461 3300005577 Bacteria 2986
105 Ga0068854_100053040 3300005578 Bacteria 2910
106 Ga0068854_100072085 3300005578 Bacteria 2529
107 Ga0068856_100035044 3300005614 Bacteria 4918
108 Ga0068856_100051006 3300005614 Bacteria 4080
109 Ga0068852_100002747 3300005616 Bacteria 12183
110 Ga0068852_100067991 3300005616 Bacteria 3116
111 Ga0068859_100018481 3300005617 Bacteria 7006
112 Ga0068859_100062658 3300005617 Bacteria 3749
113 Ga0068859_100083008 3300005617 Bacteria 3246
114 Ga0068864_100001205 3300005618 Bacteria 21463
115 Ga0068864_100028175 3300005618 Bacteria 4746
116 Ga0068864_100068406 3300005618 Bacteria 3085
117 Ga0068864_100122394 3300005618 Bacteria 2328
118 Ga0068864_100485404 3300005618 Unclassified 1186
119 Ga0068866_10007828 3300005718 Bacteria 4484
120 Ga0068866_10011399 3300005718 Bacteria 3845
121 Ga0068861_100001372 3300005719 Bacteria 15283
122 Ga0068861_100011312 3300005719 Bacteria 6197
123 Ga0068861_100027064 3300005719 Bacteria 4173
124 Ga0068851_10170294 3300005834 Bacteria 1201
125 Ga0068870_10213214 3300005840 Bacteria 1177
126 Ga0068863_100022622 3300005841 Bacteria 6004
127 Ga0068863_100317650 3300005841 Bacteria 1512
128 Ga0068858_100001910 3300005842 Bacteria 21265
129 Ga0068858_100132865 3300005842 Bacteria 2334
130 Ga0068858_100227752 3300005842 Bacteria 1767
131 Ga0068860_100001625 3300005843 Bacteria 24111
132 Ga0068860_100048974 3300005843 Bacteria 4027
133 Ga0068860_100059559 3300005843 Bacteria 3629
134 Ga0075365_10028914 3300006038 Bacteria 3537
135 Ga0075368_10038054 3300006042 Bacteria 1883
136 Ga0075363_100013438 3300006048 Bacteria 3969
137 Ga0075362_10003562 3300006177 Bacteria 5467
138 Ga0075362_10005956 3300006177 Bacteria 4506
139 Ga0075362_10018945 3300006177 Bacteria 2856
140 Ga0075367_10013871 3300006178 Bacteria 4347
141 Ga0075367_10060621 3300006178 Bacteria 2256
142 Ga0075367_10107082 3300006178 Bacteria 1713
143 Ga0075369_10001253 3300006186 Bacteria 8632
144 Ga0075369_10047195 3300006186 Bacteria 1857
145 Ga0075366_10002337 3300006195 Bacteria 9703
146 Ga0075366_10035081 3300006195 Bacteria 2957
147 Ga0075366_10094221 3300006195 Bacteria 1795
148 Ga0097621_100010078 3300006237 Bacteria 6892
149 Ga0097621_100099154 3300006237 Bacteria 2449
150 Ga0097621_100107480 3300006237 Bacteria 2354
151 Ga0075370_10000149 3300006353 Bacteria 23819
152 Ga0075370_10004405 3300006353 Bacteria 6835
153 Ga0075370_10005359 3300006353 Bacteria 6364
154 Ga0075370_10014548 3300006353 Bacteria 4200
155 Ga0075370_10015017 3300006353 Bacteria 4138
156 Ga0075370_10039325 3300006353 Bacteria 2664
157 Ga0075370_10057047 3300006353 Bacteria 2219
158 Ga0068871_100012789 3300006358 Bacteria 6209
159 Ga0068871_100027375 3300006358 Bacteria 4458
160 Ga0068871_100033259 3300006358 Bacteria 4082
161 Ga0068871_100131768 3300006358 Bacteria 2120
162 Ga0068871_100226748 3300006358 Bacteria 1620
163 Ga0068865_100018214 3300006881 Bacteria 4530
164 Ga0068865_100060989 3300006881 Bacteria 2642
165 Ga0068865_100154161 3300006881 Bacteria 1746
166 Ga0068865_100231493 3300006881 Bacteria 1450
167 Ga0097620_100018481 3300006931 Bacteria 7006
168 Ga0097620_100062662 3300006931 Bacteria 3749
169 Ga0097620_100083004 3300006931 Bacteria 3246
170 Ga0111539_10321797 3300009094 Bacteria 1800
171 Ga0105245_10019973 3300009098 Bacteria 5873
172 Ga0105245_10051556 3300009098 Bacteria 3689
173 Ga0105245_10170061 3300009098 Bacteria 2075
174 Ga0105245_10335089 3300009098 Bacteria 1494
175 Ga0105243_10004078 3300009148 Bacteria 11636
176 Ga0105243_10005286 3300009148 Bacteria 10096
177 Ga0105243_10195289 3300009148 Bacteria 1771
178 Ga0105241_10230240 3300009174 Bacteria 1562
179 Ga0105242_10008041 3300009176 Bacteria 8120
180 Ga0105242_10070057 3300009176 Bacteria 2906
181 Ga0105242_10120032 3300009176 Bacteria 2254
182 Ga0105248_10008298 3300009177 Bacteria 11411
183 Ga0105248_10079967 3300009177 Bacteria 3674
184 Ga0105248_10097814 3300009177 Bacteria 3306
185 Ga0105248_10100943 3300009177 Bacteria 3252
186 Ga0105248_10193813 3300009177 Bacteria 2289
187 Ga0105237_10011185 3300009545 Bacteria 9510
188 Ga0105237_10230956 3300009545 Bacteria 1851
189 Ga0105238_10019205 3300009551 Bacteria 6961
190 Ga0105238_10083902 3300009551 Bacteria 3175
191 Ga0105249_10053536 3300009553 Bacteria 3689
192 Ga0105249_10079446 3300009553 Bacteria 3045
193 Ga0105249_10463465 3300009553 Bacteria 1308
194 Ga0105249_10585250 3300009553 Bacteria 1169
195 Ga0105239_10016520 3300010375 Bacteria 8162
196 Ga0105239_10113290 3300010375 Bacteria 3008
197 Ga0157371_10069599 3300013102 Bacteria 2492
198 Ga0157371_10269139 3300013102 Bacteria 1229
199 Ga0157374_10009336 3300013296 Bacteria 8414
200 Ga0157374_10030478 3300013296 Bacteria 4898
201 Ga0157374_10049627 3300013296 Bacteria 3898
202 Ga0157374_10108716 3300013296 Bacteria 2665
203 Ga0157378_10018683 3300013297 Bacteria 6094
204 Ga0163162_10000655 3300013306 Bacteria 32037
205 Ga0163162_10008965 3300013306 Bacteria 9727
206 Ga0163162_10064935 3300013306 Bacteria 3696
207 Ga0163162_10140466 3300013306 Bacteria 2528
208 Ga0163162_10270110 3300013306 Bacteria 1832
209 Ga0163162_10380164 3300013306 Bacteria 1545
210 Ga0157375_10009952 3300013308 Bacteria 8362
211 Ga0157375_10069267 3300013308 Bacteria 3533
212 Ga0157375_10093964 3300013308 Bacteria 3066
213 Ga0157375_10099740 3300013308 Bacteria 2983
214 Ga0157375_10117635 3300013308 Bacteria 2763
215 Ga0157375_10126194 3300013308 Bacteria 2674
216 Ga0157375_10217825 3300013308 Bacteria 2067
217 Ga0157375_10491156 3300013308 Bacteria 1392
218 Ga0163163_10088817 3300014325 Bacteria 3102
219 Ga0163163_10104452 3300014325 Bacteria 2858
220 Ga0163163_10175452 3300014325 Bacteria 2190
221 Ga0163163_10547564 3300014325 Bacteria 1220
222 Ga0157380_10006664 3300014326 Bacteria 8150
223 Ga0157380_10095285 3300014326 Bacteria 2465
224 Ga0157377_10000039 3300014745 Bacteria 112711
225 Ga0157377_10009171 3300014745 Bacteria 4846
226 Ga0157377_10063883 3300014745 Bacteria 2110
227 Ga0157379_10022730 3300014968 Bacteria 5556
228 Ga0157379_10033445 3300014968 Bacteria 4585
229 Ga0157379_10033775 3300014968 Bacteria 4563
230 Ga0157379_10065411 3300014968 Bacteria 3250
231 Ga0157376_10027813 3300014969 Bacteria 4487
232 Ga0157376_10041438 3300014969 Bacteria 3769
233 Ga0157376_10219549 3300014969 Bacteria 1760
234 Ga0157376_10445870 3300014969 Bacteria 1261
235 Ga0163161_10033616 3300017792 Bacteria 3664
236 Ga0213876_10055224 3300021384 Bacteria 2097
237 Ga0209758_1000032 3300025297 Bacteria 481623
238 Ga0209257_1056387 3300025304 Bacteria 1085
239 Ga0207656_10056994 3300025321 Bacteria 1704
240 Ga0207656_10071293 3300025321 Bacteria 1544
241 Ga0207656_10101402 3300025321 Bacteria 1320
242 Ga0207656_10119338 3300025321 Bacteria 1226
243 Ga0207682_10047552 3300025893 Bacteria 1767
244 Ga0207642_10005797 3300025899 Bacteria 4061
245 Ga0207642_10031423 3300025899 Bacteria 2224
246 Ga0207642_10150034 3300025899 Bacteria 1240
247 Ga0207680_10021771 3300025903 Bacteria 3474
248 Ga0207680_10037876 3300025903 Bacteria 2788
249 Ga0207645_10001208 3300025907 Bacteria 21313
250 Ga0207645_10005293 3300025907 Bacteria 9396
251 Ga0207645_10043136 3300025907 Bacteria 2886
252 Ga0207645_10056616 3300025907 Bacteria 2503
253 Ga0207645_10108414 3300025907 Bacteria 1796
254 Ga0207643_10096554 3300025908 Bacteria 1728
255 Ga0207643_10154180 3300025908 Bacteria 1379
256 Ga0207705_10069576 3300025909 Bacteria 2550
257 Ga0207684_10000939 3300025910 Bacteria 32889
258 Ga0207684_10129270 3300025910 Bacteria 2168
259 Ga0207671_10030403 3300025914 Bacteria 4028
260 Ga0207671_10175964 3300025914 Bacteria 1663
261 Ga0207660_10015865 3300025917 Bacteria 4978
262 Ga0207657_10018692 3300025919 Bacteria 6604
263 Ga0207657_10085817 3300025919 Bacteria 2636
264 Ga0207649_10040706 3300025920 Bacteria 2826
265 Ga0207649_10050506 3300025920 Bacteria 2572
266 Ga0207649_10177959 3300025920 Bacteria 1487
267 Ga0207649_10246551 3300025920 Bacteria 1285
268 Ga0207652_10171305 3300025921 Bacteria 1948
269 Ga0207646_10018879 3300025922 Bacteria 6421
270 Ga0207681_10004286 3300025923 Bacteria 8806
271 Ga0207681_10036975 3300025923 Bacteria 3224
272 Ga0207681_10081259 3300025923 Bacteria 2288
273 Ga0207681_10146503 3300025923 Bacteria 1765
274 Ga0207650_10003912 3300025925 Bacteria 10186
275 Ga0207650_10016290 3300025925 Bacteria 5193
276 Ga0207650_10028606 3300025925 Bacteria 3998
277 Ga0207650_10107115 3300025925 Bacteria 2159
278 Ga0207659_10000758 3300025926 Bacteria 19158
279 Ga0207659_10006396 3300025926 Bacteria 7214
280 Ga0207659_10060450 3300025926 Bacteria 2727
281 Ga0207659_10070093 3300025926 Bacteria 2556
282 Ga0207659_10096040 3300025926 Bacteria 2224
283 Ga0207687_10018115 3300025927 Bacteria 4646
284 Ga0207644_10030824 3300025931 Bacteria 3733
285 Ga0207644_10036926 3300025931 Bacteria 3432
286 Ga0207644_10038336 3300025931 Bacteria 3375
287 Ga0207644_10123008 3300025931 Bacteria 1978
288 Ga0207644_10193012 3300025931 Bacteria 1602
289 Ga0207690_10022484 3300025932 Bacteria 3924
290 Ga0207690_10113774 3300025932 Bacteria 1953
291 Ga0207706_10019326 3300025933 Bacteria 6128
292 Ga0207706_10037631 3300025933 Bacteria 4295
293 Ga0207706_10040533 3300025933 Bacteria 4127
294 Ga0207706_10088637 3300025933 Bacteria 2720
295 Ga0207706_10102528 3300025933 Bacteria 2517
296 Ga0207686_10045441 3300025934 Bacteria 2702
297 Ga0207686_10195022 3300025934 Bacteria 1446
298 Ga0207709_10002451 3300025935 Bacteria 11650
299 Ga0207709_10003263 3300025935 Bacteria 9728
300 Ga0207669_10033408 3300025937 Bacteria 2903
301 Ga0207669_10048561 3300025937 Bacteria 2522
302 Ga0207669_10068338 3300025937 Bacteria 2218
303 Ga0207669_10068699 3300025937 Bacteria 2214
304 Ga0207704_10002779 3300025938 Bacteria 7897
305 Ga0207704_10011131 3300025938 Bacteria 4416
306 Ga0207704_10037057 3300025938 Bacteria 2813
307 Ga0207704_10205567 3300025938 Bacteria 1445
308 Ga0207691_10012045 3300025940 Bacteria 8295
309 Ga0207691_10032772 3300025940 Bacteria 4842
310 Ga0207691_10070797 3300025940 Bacteria 3149
311 Ga0207691_10094768 3300025940 Bacteria 2670
312 Ga0207691_10127318 3300025940 Bacteria 2252
313 Ga0207691_10182702 3300025940 Bacteria 1832
314 Ga0207711_10019600 3300025941 Bacteria 5631
315 Ga0207711_10066889 3300025941 Bacteria 3109
316 Ga0207711_10121820 3300025941 Bacteria 2329
317 Ga0207711_10142063 3300025941 Bacteria 2161
318 Ga0207711_10398117 3300025941 Bacteria 1279
319 Ga0207689_10000563 3300025942 Bacteria 35456
320 Ga0207689_10001646 3300025942 Bacteria 21167
321 Ga0207689_10009157 3300025942 Bacteria 8566
322 Ga0207689_10011714 3300025942 Bacteria 7515
323 Ga0207689_10017421 3300025942 Bacteria 6078
324 Ga0207689_10039855 3300025942 Bacteria 3889
325 Ga0207689_10237493 3300025942 Bacteria 1506
326 Ga0207679_10108493 3300025945 Bacteria 2186
327 Ga0207651_10096479 3300025960 Bacteria 2180
328 Ga0207651_10099615 3300025960 Bacteria 2153
329 Ga0207712_10073521 3300025961 Bacteria 2466
330 Ga0207712_10305637 3300025961 Bacteria 1307
331 Ga0207712_10393239 3300025961 Bacteria 1163
332 Ga0207712_10398443 3300025961 Bacteria 1156
333 Ga0207668_10015032 3300025972 Bacteria 4803
334 Ga0207668_10046754 3300025972 Bacteria 2959
335 Ga0207640_10079033 3300025981 Bacteria 2241
336 Ga0207640_10084404 3300025981 Bacteria 2181
337 Ga0207640_10112278 3300025981 Bacteria 1935
338 Ga0207658_10001317 3300025986 Bacteria 19462
339 Ga0207658_10007200 3300025986 Bacteria 7584
340 Ga0207658_10144479 3300025986 Bacteria 1930
341 Ga0207677_10004181 3300026023 Bacteria 7724
342 Ga0207677_10028243 3300026023 Bacteria 3544
343 Ga0207677_10033719 3300026023 Bacteria 3307
344 Ga0207703_10003150 3300026035 Bacteria 13916
345 Ga0207703_10015310 3300026035 Bacteria 5983
346 Ga0207703_10018688 3300026035 Bacteria 5413
347 Ga0207703_10167193 3300026035 Bacteria 1931
348 Ga0207639_10147727 3300026041 Bacteria 1966
349 Ga0207639_10366413 3300026041 Bacteria 1291
350 Ga0207678_10000617 3300026067 Bacteria 32594
351 Ga0207678_10012730 3300026067 Bacteria 7387
352 Ga0207678_10051662 3300026067 Bacteria 3548
353 Ga0207678_10097637 3300026067 Bacteria 2510
354 Ga0207708_10007997 3300026075 Bacteria 7834
355 Ga0207702_10025574 3300026078 Bacteria 4901
356 Ga0207641_10009552 3300026088 Bacteria 7990
357 Ga0207641_10022676 3300026088 Bacteria 5168
358 Ga0207641_10213622 3300026088 Bacteria 1785
359 Ga0207641_10338976 3300026088 Bacteria 1430
360 Ga0207648_10000053 3300026089 Bacteria 107516
361 Ga0207648_10007705 3300026089 Bacteria 10531
362 Ga0207648_10008629 3300026089 Bacteria 9849
363 Ga0207648_10010090 3300026089 Bacteria 8980
364 Ga0207648_10031445 3300026089 Bacteria 4693
365 Ga0207648_10092041 3300026089 Bacteria 2651
366 Ga0207648_10137569 3300026089 Bacteria 2152
367 Ga0207648_10364677 3300026089 Bacteria 1304
368 Ga0207676_10000216 3300026095 Bacteria 49875
369 Ga0207676_10012066 3300026095 Bacteria 6183
370 Ga0207676_10078623 3300026095 Bacteria 2672
371 Ga0207674_10023414 3300026116 Bacteria 6616
372 Ga0207674_10040061 3300026116 Bacteria 4855
373 Ga0207674_10058832 3300026116 Bacteria 3891
374 Ga0207675_100001426 3300026118 Bacteria 23961
375 Ga0207675_100001767 3300026118 Bacteria 21608
376 Ga0207675_100018059 3300026118 Bacteria 6578
377 Ga0207683_10054358 3300026121 Bacteria 3512
378 Ga0207683_10251719 3300026121 Unclassified 1612
379 Ga0207698_10097548 3300026142 Bacteria 2426
380 Ga0207698_10106698 3300026142 Bacteria 2337
381 Ga0207698_10215894 3300026142 Bacteria 1729
382 Ga0268266_10212834 3300028379 Bacteria 1773
383 Ga0268265_10011049 3300028380 Bacteria 6099
384 Ga0268265_10053953 3300028380 Bacteria 3047
385 Ga0268265_10099609 3300028380 Bacteria 2343
386 Ga0268264_10050286 3300028381 Bacteria 3470
387 Ga0307517_10001591 3300028786 Bacteria 37812
388 Ga0307517_10143684 3300028786 Bacteria 1664
389 Ga0307515_10015505 3300028794 Bacteria 14032
390 Ga0307515_10124391 3300028794 Bacteria 2894
391 Ga0307512_10028873 3300030522 Bacteria 4853
392 Ga0307513_10049991 3300031456 Bacteria 4524
393 Ga0307509_10002193 3300031507 Bacteria 32050
394 Ga0307509_10006731 3300031507 Bacteria 15313
395 Ga0307509_10021452 3300031507 Bacteria 7300
396 Ga0307509_10083128 3300031507 Bacteria 3301
397 Ga0307408_100023259 3300031548 Bacteria 4219
398 Ga0307508_10002730 3300031616 Bacteria 18451
399 Ga0307508_10031339 3300031616 Bacteria 4805
400 Ga0307516_10026114 3300031730 Bacteria 5937
401 Ga0307405_10009192 3300031731 Bacteria 5053
402 Ga0307405_10021907 3300031731 Bacteria 3602
403 Ga0307413_10001776 3300031824 Bacteria 8441
404 Ga0307406_10001929 3300031901 Bacteria 11311
405 Ga0307409_100013606 3300031995 Bacteria 5248
406 Ga0307416_100046558 3300032002 Bacteria 3424
407 Ga0307411_10000606 3300032005 Bacteria 12875
408 Ga0307507_10101299 3300033179 Bacteria 2409
409 Ga0307510_10000290 3300033180 Bacteria 46315
410 Ga0307510_10016475 3300033180 Bacteria 8723
411 Ga0307510_10075765 3300033180 Bacteria 3314
412 Ga0307510_10174878 3300033180 Bacteria 1719
413 Ga0373944_0086891 3300035089 Bacteria 1040
414 Ga0373941_0010160 3300035115 Bacteria 2394
415 Ga0373943_0161840 3300035170 Bacteria 1219
416 Ga0373946_0067848 3300035171 Bacteria 1533
417 Ga0373924_0082059 3300035410 Bacteria 1372
418 Ga0373931_0030273 3300035691 Bacteria 2785
419 Ga0373931_0048521 3300035691 Bacteria 2251
420 Ga0373935_0256199 3300035692 Bacteria 1226
421 Ga0373927_0012970 3300035695 Bacteria 5543
422 Ga0373927_0219323 3300035695 Bacteria 1249
423 Ga0373947_0140065 3300035725 Bacteria 1551
424 Ga0373947_0170306 3300035725 Bacteria 1413
425 Ga0373925_0013565 3300037068 Bacteria 5899
426 Ga0373925_0031268 3300037068 Bacteria 3911
427 Ga0373925_0072782 3300037068 Bacteria 2600
428 Ga0395900_0000131 3300037418 Bacteria 125554
429 Ga0395898_0001532 3300037466 Bacteria 31823
430 Ga0436364_0030440 3300037853 Bacteria 1170
431 Ga0436365_1305172 3300039437 Bacteria 4855
432 Ga0436363_1703321 3300039450 Bacteria 2183
433 Ga0466969_0000017 3300044656 Bacteria 103792
434 Ga0466965_0095598 3300044683 Bacteria 1515
435 Ga0466965_0109564 3300044683 Bacteria 1418
436 Ga0466965_0119417 3300044683 Bacteria 1360
437 Ga0466966_0017527 3300044684 Bacteria 4731
438 Ga0466966_0038341 3300044684 Bacteria 3088
439 Ga0466966_0048420 3300044684 Bacteria 2707
440 Ga0466961_0019753 3300044693 Bacteria 4335
441 Ga0466963_0026033 3300044694 Bacteria 3738
442 Ga0466964_0075571 3300044706 Bacteria 1434
443 Ga0466970_0029242 3300044765 Bacteria 2900
444 Ga0466970_0060422 3300044765 Bacteria 2030
445 Ga0466960_0036471 3300044901 Bacteria 2302
446 Ga0466959_0047826 3300045049 Bacteria 3145
447 Ga0466959_0047834 3300045049 Bacteria 3145
448 Ga0466959_0097191 3300045049 Bacteria 2110
449 Ga0466958_0042569 3300045836 Bacteria 2734
450 Ga0466967_0011852 3300045976 Bacteria 6632
451 Ga0495592_0000213 3300046454 Bacteria 49631
452 Ga0495638_0049546 3300046460 Bacteria 2626
453 Ga0495638_0118904 3300046460 Bacteria 1563
454 Ga0495664_0237401 3300046477 Bacteria 1103
455 Ga0495610_0045348 3300046512 Bacteria 2176
456 Ga0495620_0049587 3300046515 Bacteria 1796
457 Ga0495632_0082731 3300046519 Bacteria 1529
458 Ga0495648_0093001 3300046524 Bacteria 1683
459 Ga0495621_0024775 3300046539 Bacteria 2008
460 Ga0495645_0010618 3300046543 Bacteria 6465
461 Ga0495633_0127865 3300046558 Bacteria 1176
462 Ga0495625_0026151 3300046660 Bacteria 4413
463 Ga0495647_0088293 3300046681 Bacteria 1267
464 Ga0495647_0092778 3300046681 Bacteria 1240
465 Ga0495658_0005092 3300046683 Bacteria 6457
466 Ga0495658_0065622 3300046683 Bacteria 2094
467 Ga0495613_0028064 3300046689 Bacteria 4188
468 Ga0495624_0054942 3300046690 Bacteria 2510
469 Ga0495649_0004161 3300046694 Bacteria 9493
470 Ga0495636_0091210 3300047318 Bacteria 1323
471 Ga0495687_002581 3300047443 Bacteria 14284
472 Ga0495686_0000641 3300047472 Bacteria 48207
473 Ga0495626_0047755 3300048091 Unclassified 1989
474 Ga0496100_0089901 3300048903 Bacteria 2093
475 Ga0496101_0148274 3300048904 Bacteria 1793
476 Ga0496102_0025738 3300048905 Bacteria 5240
477 Ga0496104_0115428 3300048907 Bacteria 2576
478 Ga0496104_0300241 3300048907 Bacteria 1518
479 Ga0496105_0014939 3300048908 Bacteria 6181
480 Ga0496105_0368968 3300048908 Bacteria 1144
481 Ga0496106_0086847 3300048909 Bacteria 2410
482 Ga0496108_0090387 3300048911 Bacteria 2603
483 Ga0496108_0165474 3300048911 Bacteria 1912
484 Ga0496109_0048683 3300048912 Bacteria 3856
485 Ga0496109_0069171 3300048912 Bacteria 3237
486 Ga0496110_0145644 3300048913 Bacteria 2142
487 Ga0496111_0119341 3300048914 Bacteria 1948
488 Ga0496112_0096361 3300048915 Bacteria 2929
489 Ga0496114_0432491 3300048917 Bacteria 1166
490 Ga0496115_0051329 3300048918 Bacteria 3307
491 Ga0496121_0024896 3300048924 Bacteria 5705
492 Ga0496124_0000605 3300048927 Bacteria 60259
493 Ga0501032_0068170 3300049569 Bacteria 2376
494 Ga0501043_0000009 3300049579 Bacteria 214823
495 Ga0501046_0000022 3300049580 Bacteria 215451
496 Ga0501047_0000021 3300049581 Bacteria 254841
497 Ga0501048_0001661 3300049582 Bacteria 16948
498 Ga0501045_0009763 3300049824 Bacteria 6711
499 nmdc:mga03n38_33762_c1 3300050490 Bacteria 2180
500 nmdc:mga0yw44_54303_c1 3300050492 Bacteria 2434
501 nmdc:mga0k408_10394_c1 3300050493 Bacteria 5034
502 nmdc:mga0k408_15683_c1 3300050493 Bacteria 4194
503 nmdc:mga0k408_19272_c1 3300050493 Bacteria 3811
504 nmdc:mga0k408_201906_c1 3300050493 Bacteria 1187
505 nmdc:mga0k408_2209_c1 3300050493 Bacteria 10430
506 nmdc:mga0k408_29750_c1 3300050493 Bacteria 3111
507 nmdc:mga0k408_5664_c1 3300050493 Bacteria 6639
508 nmdc:mga0k408_72209_c1 3300050493 Bacteria 2015
509 nmdc:mga06z11_23057_c1 3300050494 Bacteria 2918
510 nmdc:mga04h51_105837_c1 3300050495 Bacteria 1031
511 nmdc:mga07m45_13822_c1 3300050496 Bacteria 4289
512 nmdc:mga07m45_1712_c1 3300050496 Bacteria 10106
513 nmdc:mga07m45_24654_c1 3300050496 Bacteria 3297
514 nmdc:mga07m45_48914_c1 3300050496 Bacteria 2379
515 nmdc:mga07m45_63465_c1 3300050496 Bacteria 2095
516 nmdc:mga08y16_279741_c1 3300050511 Bacteria 1721
517 nmdc:mga0sz30_107312_c1 3300050516 Bacteria 1222
518 nmdc:mga0sz30_14572_c1 3300050516 Bacteria 3097
519 Ga0495601_0039823 3300053077 Bacteria 2943
520 Ga0495595_0160552 3300053084 Bacteria 1109
521 Ga0495619_0067037 3300053085 Bacteria 2396
522 Ga0500644_0009503 3300053088 Bacteria 2603
523 Ga0500583_0043748 3300053092 Bacteria 2047
524 Ga0500658_0040711 3300053134 Bacteria 1861
525 Ga0500559_0000126 3300053136 Bacteria 59577
526 Ga0500590_017763 3300053148 Bacteria 3678
527 Ga0500622_0004116 3300053156 Bacteria 9311
528 Ga0500624_017373 3300053157 Bacteria 1122
529 Ga0500645_005783 3300053730 Bacteria 4499
530 Ga0466962_0005485 3300061719 Bacteria 6097
531 Ga0466962_0096657 3300061719 Bacteria 1416
532 2644302765 2643221654 Bacteria 5273570
533 2738746474 2738541281 Bacteria 5112672
534 2739355704 2738543032 Bacteria 5115625
535 nmdc:mga07m45_1848_c1
536 JGI25153J46596_10002674
537 rootH2_10193289
538 Ga0065707_10089777
539 Ga0070658_10076837
540 Ga0070676_10003719
541 Ga0070676_10071478
542 Ga0070676_10134388
543 Ga0070683_100085935
544 Ga0070683_100317590
545 Ga0070690_100022385
546 Ga0070690_100033413
547 Ga0070690_100196276
548 Ga0070670_100003543
549 Ga0070670_100018231
550 Ga0070670_100023516
551 Ga0070670_100118642
552 Ga0068869_100001372
553 Ga0068869_100006007
554 Ga0068869_100017329
555 Ga0068869_100049448
556 Ga0068868_100007721
557 Ga0068868_100019237
558 Ga0068868_100082771
559 Ga0070660_100036584
560 Ga0070660_100067881
561 Ga0070660_100170162
562 Ga0070689_100035179
563 Ga0070689_100103426
564 Ga0070689_100161416
565 Ga0070687_100016996
566 Ga0070692_10253705
567 Ga0070668_100031574
568 Ga0070668_100082857
569 Ga0070668_100112259
570 Ga0070669_100003484
571 Ga0070669_100052233
572 Ga0070675_100001397
573 Ga0070675_100384071
574 Ga0070671_100054064
575 Ga0070671_100122851
576 Ga0070671_100180348
577 Ga0070671_100207120
578 Ga0070671_100283407
579 Ga0070671_100386701
580 Ga0070674_100054663
581 Ga0070674_100148292
582 Ga0070674_100187525
583 Ga0070674_100194295
584 Ga0070673_100030456
585 Ga0070673_100104514
586 Ga0070673_100316722
587 Ga0070688_100176418
588 Ga0070659_100033110
589 Ga0070659_100047636
590 Ga0070667_100000702
591 Ga0070667_100011227
592 Ga0070667_100030960
593 Ga0070667_100112786
594 Ga0070667_100119317
595 Ga0070667_100147310
596 Ga0070667_100448669
597 Ga0070700_100010478
598 Ga0070700_100049504
599 Ga0070708_100172869
600 Ga0070663_100000205
601 Ga0070663_100008570
602 Ga0070663_100010855
603 Ga0070663_100048554
604 Ga0070663_100180925
605 Ga0070678_100188547
606 Ga0070662_100009364
607 Ga0070662_100050562
608 Ga0070662_100063518
609 Ga0070662_100103940
610 Ga0070662_100274718
611 Ga0070681_10025504
612 Ga0068867_100000173
613 Ga0068867_100000215
614 Ga0068867_100002735
615 Ga0068867_100066704
616 Ga0068867_100152826
617 Ga0068867_100318790
618 Ga0070706_100000671
619 Ga0070707_100069391
620 Ga0070679_100140746
621 Ga0070684_100005851
622 Ga0068853_100102248
623 Ga0068853_100150913
624 Ga0068853_100444875
625 Ga0070672_100009845
626 Ga0070672_100041971
627 Ga0070672_100043506
628 Ga0070672_100145899
629 Ga0070672_100199074
630 Ga0070672_100251894
631 Ga0070672_100418037
632 Ga0070665_100198158
633 Ga0068855_100164421
634 Ga0070664_100068144
635 Ga0070664_100133768
636 Ga0070664_100442248
637 Ga0070664_100447420
638 Ga0068857_100076461
639 Ga0068854_100053040
640 Ga0068854_100072085
641 Ga0068856_100035044
642 Ga0068856_100051006
643 Ga0068852_100002747
644 Ga0068852_100067991
645 Ga0068859_100018481
646 Ga0068859_100062658
647 Ga0068859_100083008
648 Ga0068864_100001205
649 Ga0068864_100028175
650 Ga0068864_100068406
651 Ga0068864_100122394
652 Ga0068864_100485404
653 Ga0068866_10007828
654 Ga0068866_10011399
655 Ga0068861_100001372
656 Ga0068861_100011312
657 Ga0068861_100027064
658 Ga0068851_10170294
659 Ga0068870_10213214
660 Ga0068863_100022622
661 Ga0068863_100317650
662 Ga0068858_100001910
663 Ga0068858_100132865
664 Ga0068858_100227752
665 Ga0068860_100001625
666 Ga0068860_100048974
667 Ga0068860_100059559
668 Ga0075365_10028914
669 Ga0075368_10038054
670 Ga0075363_100013438
671 Ga0075362_10003562
672 Ga0075362_10005956
673 Ga0075362_10018945
674 Ga0075367_10013871
675 Ga0075367_10060621
676 Ga0075367_10107082
677 Ga0075369_10001253
678 Ga0075369_10047195
679 Ga0075366_10002337
680 Ga0075366_10035081
681 Ga0075366_10094221
682 Ga0097621_100010078
683 Ga0097621_100099154
684 Ga0097621_100107480
685 Ga0075370_10000149
686 Ga0075370_10004405
687 Ga0075370_10005359
688 Ga0075370_10014548
689 Ga0075370_10015017
690 Ga0075370_10039325
691 Ga0075370_10057047
692 Ga0068871_100012789
693 Ga0068871_100027375
694 Ga0068871_100033259
695 Ga0068871_100131768
696 Ga0068871_100226748
697 Ga0068865_100018214
698 Ga0068865_100060989
699 Ga0068865_100154161
700 Ga0068865_100231493
701 Ga0097620_100018481
702 Ga0097620_100062662
703 Ga0097620_100083004
704 Ga0111539_10321797
705 Ga0105245_10019973
706 Ga0105245_10051556
707 Ga0105245_10170061
708 Ga0105245_10335089
709 Ga0105243_10004078
710 Ga0105243_10005286
711 Ga0105243_10195289
712 Ga0105241_10230240
713 Ga0105242_10008041
714 Ga0105242_10070057
715 Ga0105242_10120032
716 Ga0105248_10008298
717 Ga0105248_10079967
718 Ga0105248_10097814
719 Ga0105248_10100943
720 Ga0105248_10193813
721 Ga0105237_10011185
722 Ga0105237_10230956
723 Ga0105238_10019205
724 Ga0105238_10083902
725 Ga0105249_10053536
726 Ga0105249_10079446
727 Ga0105249_10463465
728 Ga0105249_10585250
729 Ga0105239_10016520
730 Ga0105239_10113290
731 Ga0157371_10069599
732 Ga0157371_10269139
733 Ga0157374_10009336
734 Ga0157374_10030478
735 Ga0157374_10049627
736 Ga0157374_10108716
737 Ga0157378_10018683
738 Ga0163162_10000655
739 Ga0163162_10008965
740 Ga0163162_10064935
741 Ga0163162_10140466
742 Ga0163162_10270110
743 Ga0163162_10380164
744 Ga0157375_10009952
745 Ga0157375_10069267
746 Ga0157375_10093964
747 Ga0157375_10099740
748 Ga0157375_10117635
749 Ga0157375_10126194
750 Ga0157375_10217825
751 Ga0157375_10491156
752 Ga0163163_10088817
753 Ga0163163_10104452
754 Ga0163163_10175452
755 Ga0163163_10547564
756 Ga0157380_10006664
757 Ga0157380_10095285
758 Ga0157377_10000039
759 Ga0157377_10009171
760 Ga0157377_10063883
761 Ga0157379_10022730
762 Ga0157379_10033445
763 Ga0157379_10033775
764 Ga0157379_10065411
765 Ga0157376_10027813
766 Ga0157376_10041438
767 Ga0157376_10219549
768 Ga0157376_10445870
769 Ga0163161_10033616
770 Ga0213876_10055224
771 Ga0209758_1000032
772 Ga0209257_1056387
773 Ga0207656_10056994
774 Ga0207656_10071293
775 Ga0207656_10101402
776 Ga0207656_10119338
777 Ga0207682_10047552
778 Ga0207642_10005797
779 Ga0207642_10031423
780 Ga0207642_10150034
781 Ga0207680_10021771
782 Ga0207680_10037876
783 Ga0207645_10001208
784 Ga0207645_10005293
785 Ga0207645_10043136
786 Ga0207645_10056616
787 Ga0207645_10108414
788 Ga0207643_10096554
789 Ga0207643_10154180
790 Ga0207705_10069576
791 Ga0207684_10000939
792 Ga0207684_10129270
793 Ga0207671_10030403
794 Ga0207671_10175964
795 Ga0207660_10015865
796 Ga0207657_10018692
797 Ga0207657_10085817
798 Ga0207649_10040706
799 Ga0207649_10050506
800 Ga0207649_10177959
801 Ga0207649_10246551
802 Ga0207652_10171305
803 Ga0207646_10018879
804 Ga0207681_10004286
805 Ga0207681_10036975
806 Ga0207681_10081259
807 Ga0207681_10146503
808 Ga0207650_10003912
809 Ga0207650_10016290
810 Ga0207650_10028606
811 Ga0207650_10107115
812 Ga0207659_10000758
813 Ga0207659_10006396
814 Ga0207659_10060450
815 Ga0207659_10070093
816 Ga0207659_10096040
817 Ga0207687_10018115
818 Ga0207644_10030824
819 Ga0207644_10036926
820 Ga0207644_10038336
821 Ga0207644_10123008
822 Ga0207644_10193012
823 Ga0207690_10022484
824 Ga0207690_10113774
825 Ga0207706_10019326
826 Ga0207706_10037631
827 Ga0207706_10040533
828 Ga0207706_10088637
829 Ga0207706_10102528
830 Ga0207686_10045441
831 Ga0207686_10195022
832 Ga0207709_10002451
833 Ga0207709_10003263
834 Ga0207669_10033408
835 Ga0207669_10048561
836 Ga0207669_10068338
837 Ga0207669_10068699
838 Ga0207704_10002779
839 Ga0207704_10011131
840 Ga0207704_10037057
841 Ga0207704_10205567
842 Ga0207691_10012045
843 Ga0207691_10032772
844 Ga0207691_10070797
845 Ga0207691_10094768
846 Ga0207691_10127318
847 Ga0207691_10182702
848 Ga0207711_10019600
849 Ga0207711_10066889
850 Ga0207711_10121820
851 Ga0207711_10142063
852 Ga0207711_10398117
853 Ga0207689_10000563
854 Ga0207689_10001646
855 Ga0207689_10009157
856 Ga0207689_10011714
857 Ga0207689_10017421
858 Ga0207689_10039855
859 Ga0207689_10237493
860 Ga0207679_10108493
861 Ga0207651_10096479
862 Ga0207651_10099615
863 Ga0207712_10073521
864 Ga0207712_10305637
865 Ga0207712_10393239
866 Ga0207712_10398443
867 Ga0207668_10015032
868 Ga0207668_10046754
869 Ga0207640_10079033
870 Ga0207640_10084404
871 Ga0207640_10112278
872 Ga0207658_10001317
873 Ga0207658_10007200
874 Ga0207658_10144479
875 Ga0207677_10004181
876 Ga0207677_10028243
877 Ga0207677_10033719
878 Ga0207703_10003150
879 Ga0207703_10015310
880 Ga0207703_10018688
881 Ga0207703_10167193
882 Ga0207639_10147727
883 Ga0207639_10366413
884 Ga0207678_10000617
885 Ga0207678_10012730
886 Ga0207678_10051662
887 Ga0207678_10097637
888 Ga0207708_10007997
889 Ga0207702_10025574
890 Ga0207641_10009552
891 Ga0207641_10022676
892 Ga0207641_10213622
893 Ga0207641_10338976
894 Ga0207648_10000053
895 Ga0207648_10007705
896 Ga0207648_10008629
897 Ga0207648_10010090
898 Ga0207648_10031445
899 Ga0207648_10092041
900 Ga0207648_10137569
901 Ga0207648_10364677
902 Ga0207676_10000216
903 Ga0207676_10012066
904 Ga0207676_10078623
905 Ga0207674_10023414
906 Ga0207674_10040061
907 Ga0207674_10058832
908 Ga0207675_100001426
909 Ga0207675_100001767
910 Ga0207675_100018059
911 Ga0207683_10054358
912 Ga0207683_10251719
913 Ga0207698_10097548
914 Ga0207698_10106698
915 Ga0207698_10215894
916 Ga0268266_10212834
917 Ga0268265_10011049
918 Ga0268265_10053953
919 Ga0268265_10099609
920 Ga0268264_10050286
921 Ga0307517_10001591
922 Ga0307517_10143684
923 Ga0307515_10015505
924 Ga0307515_10124391
925 Ga0307512_10028873
926 Ga0307513_10049991
927 Ga0307509_10002193
928 Ga0307509_10006731
929 Ga0307509_10021452
930 Ga0307509_10083128
931 Ga0307408_100023259
932 Ga0307508_10002730
933 Ga0307508_10031339
934 Ga0307516_10026114
935 Ga0307405_10009192
936 Ga0307405_10021907
937 Ga0307413_10001776
938 Ga0307406_10001929
939 Ga0307409_100013606
940 Ga0307416_100046558
941 Ga0307411_10000606
942 Ga0307507_10101299
943 Ga0307510_10000290
944 Ga0307510_10016475
945 Ga0307510_10075765
946 Ga0307510_10174878
947 Ga0373944_0086891
948 Ga0373941_0010160
949 Ga0373943_0161840
950 Ga0373946_0067848
951 Ga0373924_0082059
952 Ga0373931_0030273
953 Ga0373931_0048521
954 Ga0373935_0256199
955 Ga0373927_0012970
956 Ga0373927_0219323
957 Ga0373947_0140065
958 Ga0373947_0170306
959 Ga0373925_0013565
960 Ga0373925_0031268
961 Ga0373925_0072782
962 Ga0395900_0000131
963 Ga0395898_0001532
964 Ga0436364_0030440
965 Ga0436365_1305172
966 Ga0436363_1703321
967 Ga0466969_0000017
968 Ga0466965_0095598
969 Ga0466965_0109564
970 Ga0466965_0119417
971 Ga0466966_0017527
972 Ga0466966_0038341
973 Ga0466966_0048420
974 Ga0466961_0019753
975 Ga0466963_0026033
976 Ga0466964_0075571
977 Ga0466970_0029242
978 Ga0466970_0060422
979 Ga0466960_0036471
980 Ga0466959_0047826
981 Ga0466959_0047834
982 Ga0466959_0097191
983 Ga0466958_0042569
984 Ga0466967_0011852
985 Ga0495592_0000213
986 Ga0495638_0049546
987 Ga0495638_0118904
988 Ga0495664_0237401
989 Ga0495610_0045348
990 Ga0495620_0049587
991 Ga0495632_0082731
992 Ga0495648_0093001
993 Ga0495621_0024775
994 Ga0495645_0010618
995 Ga0495633_0127865
996 Ga0495625_0026151
997 Ga0495647_0088293
998 Ga0495647_0092778
999 Ga0495658_0005092
1000 Ga0495658_0065622
1001 Ga0495613_0028064
1002 Ga0495624_0054942
1003 Ga0495649_0004161
1004 Ga0495636_0091210
1005 Ga0495687_002581
1006 Ga0495686_0000641
1007 Ga0495626_0047755
1008 Ga0496100_0089901
1009 Ga0496101_0148274
1010 Ga0496102_0025738
1011 Ga0496104_0115428
1012 Ga0496104_0300241
1013 Ga0496105_0014939
1014 Ga0496105_0368968
1015 Ga0496106_0086847
1016 Ga0496108_0090387
1017 Ga0496108_0165474
1018 Ga0496109_0048683
1019 Ga0496109_0069171
1020 Ga0496110_0145644
1021 Ga0496111_0119341
1022 Ga0496112_0096361
1023 Ga0496114_0432491
1024 Ga0496115_0051329
1025 Ga0496121_0024896
1026 Ga0496124_0000605
1027 Ga0501032_0068170
1028 Ga0501043_0000009
1029 Ga0501046_0000022
1030 Ga0501047_0000021
1031 Ga0501048_0001661
1032 Ga0501045_0009763
1033 nmdc:mga03n38_33762_c1
1034 nmdc:mga0yw44_54303_c1
1035 nmdc:mga0k408_10394_c1
1036 nmdc:mga0k408_15683_c1
1037 nmdc:mga0k408_19272_c1
1038 nmdc:mga0k408_201906_c1
1039 nmdc:mga0k408_2209_c1
1040 nmdc:mga0k408_29750_c1
1041 nmdc:mga0k408_5664_c1
1042 nmdc:mga0k408_72209_c1
1043 nmdc:mga06z11_23057_c1
1044 nmdc:mga04h51_105837_c1
1045 nmdc:mga07m45_13822_c1
1046 nmdc:mga07m45_1712_c1
1047 nmdc:mga07m45_24654_c1
1048 nmdc:mga07m45_48914_c1
1049 nmdc:mga07m45_63465_c1
1050 nmdc:mga08y16_279741_c1
1051 nmdc:mga0sz30_107312_c1
1052 nmdc:mga0sz30_14572_c1
1053 Ga0495601_0039823
1054 Ga0495595_0160552
1055 Ga0495619_0067037
1056 Ga0500644_0009503
1057 Ga0500583_0043748
1058 Ga0500658_0040711
1059 Ga0500559_0000126
1060 Ga0500590_017763
1061 Ga0500622_0004116
1062 Ga0500624_017373
1063 Ga0500645_005783
1064 Ga0466962_0005485
1065 Ga0466962_0096657
1066 2644302765
1067 2738746474
1068 2739355704

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11004

Kdo_hydroxy

3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) hydroxylase

40

318

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yka-assembly1.cif.gz_A crystal structure of the kdo hydroxylase kdoo, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with cobalt(ii) 0.9694 2 287
6a2e-assembly1.cif.gz_A apo structure of the kdo hydroxylase kdoo, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase 0.9665 2 287
5yvz-assembly1.cif.gz_A crystal structure of the kdo hydroxylase kdoo, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with alphaketoglutarate and fe(iii) 0.966 2 288
5yw0-assembly1.cif.gz_A crystal structure of the kdo hydroxylase kdoo, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with succinate and fe(iii) 0.9632 2 287
5yka-assembly1.cif.gz_A crystal structure of the kdo hydroxylase kdoo, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with cobalt(ii) 0.9595 2 287
ID Description Score Start End Superfamily
1x8mA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.5911 148 260 2.60.120.10
af_A4HSZ8_83_261_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.567 31 260 2.60.120.590
af_Q14V35_1_243_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.5637 132 264 2.60.120.650
3dl3I00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.5623 106 267 2.60.120.10
3ouiA00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.5521 16 264 2.60.120.620
ID Description Score Start End GO Terms
AF-G2JAV8-F1-model_v4 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) hydroxylase 0.9934 151 288
AF-A0A1Q3J3G1-F1-model_v4 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) hydroxylase 0.9924 37 288
AF-A0A5C7VEE7-F1-model_v4 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) hydroxylase 0.9849 151 288
AF-A0A1Q3J3G1-F1-model_v4 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) hydroxylase 0.9846 37 288
AF-A0A351KTZ2-F1-model_v4 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) hydroxylase 0.9833 114 287

Map