F460561
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 534 | 219 | 534 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300042011|Ga0439454_017448|Ga0439454_017448_26_787 |
| Length | 253 |
| Sequence | MQLYKGLLLRAFCTSIAAIQQPKLAIREKFFGTKDKMSLHLLTIWLNRMVNKEKDKSTEEKILSAAKKVFVRKGMAGARMQDIADEAGINKALLHYYFRNKEKLFEVIFMEAASKLFPRINEVFTSDLPLFEKIESFCSEYITVVSENPYLPLFVLNEINQDPEYFLQKVWSGQSKPQPXXXXQQIEREVKKGTIKKISPVSLLMNLVSLTIFPFVAKPMFQKNLGLDELQFRSIMEQRKKEIPKFIIDSIRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 144 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 148 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 149 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 150 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 151 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 152 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 153 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 154 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 155 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 156 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 157 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 158 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 159 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 160 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 161 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 162 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 163 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 164 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 165 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 166 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 167 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 168 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 169 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 170 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 171 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 172 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 173 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 189 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 190 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 191 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 205 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 210 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 211 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 217 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 218 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 219 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.94 |
| Nodule | 0 |
| Rhizoplane | 0.75 |
| Rhizosphere | 98.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1025945 | 3300001915 | Bacteria | 893 |
| 2 | JGI24751J29686_10002322 | 3300002459 | Bacteria | 3841 |
| 3 | JGI24751J29686_10002413 | 3300002459 | Bacteria | 3767 |
| 4 | Ga0065712_10004787 | 3300005290 | Bacteria | 3759 |
| 5 | Ga0065712_10162696 | 3300005290 | Bacteria | 1291 |
| 6 | Ga0065712_10188549 | 3300005290 | Bacteria | 1159 |
| 7 | Ga0065715_10268983 | 3300005293 | Unclassified | 1116 |
| 8 | Ga0070658_10069542 | 3300005327 | Bacteria | 2880 |
| 9 | Ga0070658_10608070 | 3300005327 | Bacteria | 947 |
| 10 | Ga0070676_10155725 | 3300005328 | Bacteria | 1466 |
| 11 | Ga0070683_100002306 | 3300005329 | Bacteria | 15135 |
| 12 | Ga0070683_100015970 | 3300005329 | Bacteria | 6606 |
| 13 | Ga0070683_100626400 | 3300005329 | Bacteria | 1030 |
| 14 | Ga0070690_100024488 | 3300005330 | Unclassified | 3710 |
| 15 | Ga0070690_100050564 | 3300005330 | Bacteria | 2652 |
| 16 | Ga0070670_100009051 | 3300005331 | Bacteria | 8507 |
| 17 | Ga0070670_100021498 | 3300005331 | Bacteria | 5550 |
| 18 | Ga0070670_100108407 | 3300005331 | Bacteria | 2393 |
| 19 | Ga0070670_100287097 | 3300005331 | Unclassified | 1437 |
| 20 | Ga0070670_100506809 | 3300005331 | Bacteria | 1074 |
| 21 | Ga0070670_100909115 | 3300005331 | Bacteria | 798 |
| 22 | Ga0068869_100028430 | 3300005334 | Bacteria | 3907 |
| 23 | Ga0068869_100049314 | 3300005334 | Bacteria | 3047 |
| 24 | Ga0068869_100057141 | 3300005334 | Bacteria | 2848 |
| 25 | Ga0068869_100069906 | 3300005334 | Unclassified | 2597 |
| 26 | Ga0070666_10038111 | 3300005335 | Unclassified | 3198 |
| 27 | Ga0070666_10138750 | 3300005335 | Bacteria | 1693 |
| 28 | Ga0070666_10170691 | 3300005335 | Bacteria | 1523 |
| 29 | Ga0070680_100017166 | 3300005336 | Bacteria | 5703 |
| 30 | Ga0070680_100052453 | 3300005336 | Bacteria | 3329 |
| 31 | Ga0070680_100076714 | 3300005336 | Bacteria | 2751 |
| 32 | Ga0070680_100347752 | 3300005336 | Unclassified | 1260 |
| 33 | Ga0070682_100072795 | 3300005337 | Unclassified | 2203 |
| 34 | Ga0068868_100001063 | 3300005338 | Bacteria | 18804 |
| 35 | Ga0068868_100022140 | 3300005338 | Unclassified | 4793 |
| 36 | Ga0068868_100046819 | 3300005338 | Bacteria | 3385 |
| 37 | Ga0070689_100005751 | 3300005340 | Bacteria | 8503 |
| 38 | Ga0070689_100019100 | 3300005340 | Bacteria | 5062 |
| 39 | Ga0070689_100025849 | 3300005340 | Bacteria | 4414 |
| 40 | Ga0070661_100000802 | 3300005344 | Bacteria | 22567 |
| 41 | Ga0070661_100009511 | 3300005344 | Bacteria | 6733 |
| 42 | Ga0070661_100368769 | 3300005344 | Unclassified | 1130 |
| 43 | Ga0070661_100389609 | 3300005344 | Unclassified | 1100 |
| 44 | Ga0070668_100010520 | 3300005347 | Bacteria | 6878 |
| 45 | Ga0070668_100015099 | 3300005347 | Bacteria | 5770 |
| 46 | Ga0070668_100111849 | 3300005347 | Bacteria | 2174 |
| 47 | Ga0070669_100009067 | 3300005353 | Bacteria | 7094 |
| 48 | Ga0070669_100096418 | 3300005353 | Bacteria | 2225 |
| 49 | Ga0070675_100067460 | 3300005354 | Unclassified | 2960 |
| 50 | Ga0070675_100180745 | 3300005354 | Bacteria | 1824 |
| 51 | Ga0070671_100067658 | 3300005355 | Unclassified | 2978 |
| 52 | Ga0070671_100293403 | 3300005355 | Unclassified | 1384 |
| 53 | Ga0070671_100387595 | 3300005355 | Bacteria | 1194 |
| 54 | Ga0070671_100770217 | 3300005355 | Bacteria | 837 |
| 55 | Ga0070674_100056846 | 3300005356 | Bacteria | 2713 |
| 56 | Ga0070674_100434418 | 3300005356 | Bacteria | 1080 |
| 57 | Ga0070674_100556451 | 3300005356 | Bacteria | 963 |
| 58 | Ga0070673_100042077 | 3300005364 | Bacteria | 3520 |
| 59 | Ga0070688_100005900 | 3300005365 | Bacteria | 6485 |
| 60 | Ga0070688_100037062 | 3300005365 | Unclassified | 2970 |
| 61 | Ga0070688_100139119 | 3300005365 | Bacteria | 1647 |
| 62 | Ga0070688_100338672 | 3300005365 | Bacteria | 1098 |
| 63 | Ga0070659_100036423 | 3300005366 | Bacteria | 3837 |
| 64 | Ga0070659_100053443 | 3300005366 | Bacteria | 3179 |
| 65 | Ga0070667_100059799 | 3300005367 | Bacteria | 3224 |
| 66 | Ga0070667_100076041 | 3300005367 | Unclassified | 2867 |
| 67 | Ga0070667_100085594 | 3300005367 | Bacteria | 2703 |
| 68 | Ga0070667_100579431 | 3300005367 | Unclassified | 1033 |
| 69 | Ga0070667_100903978 | 3300005367 | Bacteria | 822 |
| 70 | Ga0070709_10049639 | 3300005434 | Unclassified | 2625 |
| 71 | Ga0070714_100005072 | 3300005435 | Bacteria | 10020 |
| 72 | Ga0070714_100010482 | 3300005435 | Bacteria | 7325 |
| 73 | Ga0070710_10019783 | 3300005437 | Bacteria | 3485 |
| 74 | Ga0070700_100076647 | 3300005441 | Bacteria | 2148 |
| 75 | Ga0070700_100370111 | 3300005441 | Bacteria | 1068 |
| 76 | Ga0070663_100421686 | 3300005455 | Bacteria | 1095 |
| 77 | Ga0070678_100044598 | 3300005456 | Bacteria | 3167 |
| 78 | Ga0070678_100090873 | 3300005456 | Unclassified | 2342 |
| 79 | Ga0070678_100225066 | 3300005456 | Unclassified | 1561 |
| 80 | Ga0070678_100622884 | 3300005456 | Bacteria | 965 |
| 81 | Ga0070662_100013468 | 3300005457 | Bacteria | 5444 |
| 82 | Ga0070662_100058094 | 3300005457 | Bacteria | 2814 |
| 83 | Ga0070662_100306787 | 3300005457 | Bacteria | 1291 |
| 84 | Ga0070681_10159026 | 3300005458 | Bacteria | 2183 |
| 85 | Ga0070681_10316972 | 3300005458 | Bacteria | 1469 |
| 86 | Ga0068867_100139779 | 3300005459 | Bacteria | 1892 |
| 87 | Ga0068867_100175873 | 3300005459 | Bacteria | 1698 |
| 88 | Ga0068867_100211334 | 3300005459 | Bacteria | 1558 |
| 89 | Ga0068867_100359336 | 3300005459 | Unclassified | 1218 |
| 90 | Ga0068867_100490808 | 3300005459 | Bacteria | 1054 |
| 91 | Ga0068867_100703725 | 3300005459 | Bacteria | 892 |
| 92 | Ga0070685_10031385 | 3300005466 | Unclassified | 2968 |
| 93 | Ga0070685_10042854 | 3300005466 | Bacteria | 2585 |
| 94 | Ga0070685_10142639 | 3300005466 | Bacteria | 1510 |
| 95 | Ga0070698_100005585 | 3300005471 | Bacteria | 13750 |
| 96 | Ga0070698_100005948 | 3300005471 | Bacteria | 13308 |
| 97 | Ga0070698_100066526 | 3300005471 | Bacteria | 3627 |
| 98 | Ga0070679_100001469 | 3300005530 | Bacteria | 20899 |
| 99 | Ga0070679_100821684 | 3300005530 | Bacteria | 872 |
| 100 | Ga0070684_100000772 | 3300005535 | Bacteria | 22197 |
| 101 | Ga0070684_100004165 | 3300005535 | Bacteria | 10957 |
| 102 | Ga0070684_100245603 | 3300005535 | Bacteria | 1636 |
| 103 | Ga0070684_101192523 | 3300005535 | Unclassified | 716 |
| 104 | Ga0068853_100001075 | 3300005539 | Bacteria | 19291 |
| 105 | Ga0068853_100053760 | 3300005539 | Bacteria | 3468 |
| 106 | Ga0068853_100218425 | 3300005539 | Bacteria | 1740 |
| 107 | Ga0070672_100016283 | 3300005543 | Bacteria | 5320 |
| 108 | Ga0070672_100460744 | 3300005543 | Unclassified | 1096 |
| 109 | Ga0070686_100007568 | 3300005544 | Bacteria | 6065 |
| 110 | Ga0070665_100021077 | 3300005548 | Bacteria | 6553 |
| 111 | Ga0070665_100130277 | 3300005548 | Bacteria | 2517 |
| 112 | Ga0068855_100211766 | 3300005563 | Bacteria | 2177 |
| 113 | Ga0068855_100736558 | 3300005563 | Bacteria | 1052 |
| 114 | Ga0070664_100000505 | 3300005564 | Bacteria | 29592 |
| 115 | Ga0070664_100004719 | 3300005564 | Bacteria | 10933 |
| 116 | Ga0070664_100033251 | 3300005564 | Unclassified | 4318 |
| 117 | Ga0070664_100052458 | 3300005564 | Bacteria | 3455 |
| 118 | Ga0070664_100406310 | 3300005564 | Bacteria | 1246 |
| 119 | Ga0068857_100001366 | 3300005577 | Bacteria | 19225 |
| 120 | Ga0068857_100033074 | 3300005577 | Bacteria | 4572 |
| 121 | Ga0068857_100049806 | 3300005577 | Unclassified | 3716 |
| 122 | Ga0068857_100099080 | 3300005577 | Bacteria | 2614 |
| 123 | Ga0068857_100120401 | 3300005577 | Bacteria | 2363 |
| 124 | Ga0068857_100209665 | 3300005577 | Bacteria | 1778 |
| 125 | Ga0068854_100049621 | 3300005578 | Unclassified | 2999 |
| 126 | Ga0070702_100020388 | 3300005615 | Bacteria | 3472 |
| 127 | Ga0068852_100004584 | 3300005616 | Bacteria | 9786 |
| 128 | Ga0068852_100188844 | 3300005616 | Bacteria | 1943 |
| 129 | Ga0068852_100298341 | 3300005616 | Bacteria | 1559 |
| 130 | Ga0068852_101105083 | 3300005616 | Bacteria | 813 |
| 131 | Ga0068859_100027214 | 3300005617 | Bacteria | 5736 |
| 132 | Ga0068859_100083156 | 3300005617 | Bacteria | 3244 |
| 133 | Ga0068859_100088006 | 3300005617 | Bacteria | 3155 |
| 134 | Ga0068859_100286702 | 3300005617 | Unclassified | 1739 |
| 135 | Ga0068859_100985732 | 3300005617 | Bacteria | 925 |
| 136 | Ga0068859_101498420 | 3300005617 | Bacteria | 744 |
| 137 | Ga0068864_100054711 | 3300005618 | Unclassified | 3445 |
| 138 | Ga0068864_100122411 | 3300005618 | Bacteria | 2328 |
| 139 | Ga0068864_100200539 | 3300005618 | Unclassified | 1833 |
| 140 | Ga0068866_10023531 | 3300005718 | Bacteria | 2868 |
| 141 | Ga0068866_10080201 | 3300005718 | Unclassified | 1750 |
| 142 | Ga0068861_100003722 | 3300005719 | Bacteria | 10171 |
| 143 | Ga0068861_100048731 | 3300005719 | Bacteria | 3204 |
| 144 | Ga0068861_100133990 | 3300005719 | Bacteria | 2014 |
| 145 | Ga0068861_100135016 | 3300005719 | Bacteria | 2007 |
| 146 | Ga0068861_100766819 | 3300005719 | Unclassified | 902 |
| 147 | Ga0068851_10142565 | 3300005834 | Unclassified | 1304 |
| 148 | Ga0068870_10278515 | 3300005840 | Bacteria | 1048 |
| 149 | Ga0068863_100003170 | 3300005841 | Bacteria | 16256 |
| 150 | Ga0068863_100093749 | 3300005841 | Unclassified | 2849 |
| 151 | Ga0068858_100039810 | 3300005842 | Bacteria | 4357 |
| 152 | Ga0068858_100216438 | 3300005842 | Unclassified | 1813 |
| 153 | Ga0068860_100082198 | 3300005843 | Bacteria | 3063 |
| 154 | Ga0068860_100137258 | 3300005843 | Bacteria | 2349 |
| 155 | Ga0068860_100485410 | 3300005843 | Unclassified | 1232 |
| 156 | Ga0068862_100001846 | 3300005844 | Bacteria | 19205 |
| 157 | Ga0068862_100067354 | 3300005844 | Bacteria | 3087 |
| 158 | Ga0068862_100099088 | 3300005844 | Bacteria | 2547 |
| 159 | Ga0081539_10000916 | 3300005985 | Bacteria | 55685 |
| 160 | Ga0081539_10018471 | 3300005985 | Bacteria | 4837 |
| 161 | Ga0070717_10000765 | 3300006028 | Bacteria | 21027 |
| 162 | Ga0075366_10015790 | 3300006195 | Bacteria | 4334 |
| 163 | Ga0097621_100059062 | 3300006237 | Bacteria | 3139 |
| 164 | Ga0097621_100061557 | 3300006237 | Bacteria | 3079 |
| 165 | Ga0097621_100256057 | 3300006237 | Bacteria | 1534 |
| 166 | Ga0097621_100451145 | 3300006237 | Bacteria | 1159 |
| 167 | Ga0068871_100048000 | 3300006358 | Bacteria | 3444 |
| 168 | Ga0068871_100085730 | 3300006358 | Unclassified | 2616 |
| 169 | Ga0075428_100043655 | 3300006844 | Bacteria | 4929 |
| 170 | Ga0075428_100429517 | 3300006844 | Bacteria | 1415 |
| 171 | Ga0075430_100064504 | 3300006846 | Bacteria | 3077 |
| 172 | Ga0075431_100005665 | 3300006847 | Bacteria | 12346 |
| 173 | Ga0075431_100115808 | 3300006847 | Bacteria | 2767 |
| 174 | Ga0075429_100014673 | 3300006880 | Bacteria | 6793 |
| 175 | Ga0075429_100033309 | 3300006880 | Bacteria | 4476 |
| 176 | Ga0075429_100081129 | 3300006880 | Bacteria | 2828 |
| 177 | Ga0075429_100535019 | 3300006880 | Bacteria | 1027 |
| 178 | Ga0068865_100031844 | 3300006881 | Bacteria | 3519 |
| 179 | Ga0068865_100065129 | 3300006881 | Bacteria | 2566 |
| 180 | Ga0068865_100548662 | 3300006881 | Bacteria | 970 |
| 181 | Ga0097620_100027213 | 3300006931 | Bacteria | 5736 |
| 182 | Ga0097620_100083165 | 3300006931 | Bacteria | 3244 |
| 183 | Ga0097620_100088009 | 3300006931 | Bacteria | 3155 |
| 184 | Ga0097620_100286709 | 3300006931 | Unclassified | 1739 |
| 185 | Ga0097620_100985940 | 3300006931 | Bacteria | 925 |
| 186 | Ga0097620_101498471 | 3300006931 | Bacteria | 744 |
| 187 | Ga0111539_10015995 | 3300009094 | Bacteria | 9320 |
| 188 | Ga0111539_10059808 | 3300009094 | Bacteria | 4517 |
| 189 | Ga0111539_10082802 | 3300009094 | Bacteria | 3774 |
| 190 | Ga0111539_10688375 | 3300009094 | Bacteria | 1190 |
| 191 | Ga0105247_10052519 | 3300009101 | Bacteria | 2513 |
| 192 | Ga0114129_10156929 | 3300009147 | Bacteria | 3111 |
| 193 | Ga0105243_10135634 | 3300009148 | Bacteria | 2093 |
| 194 | Ga0105241_10307920 | 3300009174 | Bacteria | 1362 |
| 195 | Ga0105242_10030519 | 3300009176 | Bacteria | 4304 |
| 196 | Ga0105242_10167445 | 3300009176 | Unclassified | 1929 |
| 197 | Ga0105242_10184072 | 3300009176 | Bacteria | 1845 |
| 198 | Ga0105242_10259437 | 3300009176 | Bacteria | 1569 |
| 199 | Ga0105249_10010436 | 3300009553 | Bacteria | 8163 |
| 200 | Ga0105249_10029655 | 3300009553 | Bacteria | 4942 |
| 201 | Ga0105249_10069048 | 3300009553 | Bacteria | 3261 |
| 202 | Ga0105249_10124188 | 3300009553 | Bacteria | 2456 |
| 203 | Ga0105249_10988377 | 3300009553 | Unclassified | 910 |
| 204 | Ga0105239_10137513 | 3300010375 | Unclassified | 2720 |
| 205 | Ga0105239_11598967 | 3300010375 | Unclassified | 754 |
| 206 | Ga0105246_10020025 | 3300011119 | Bacteria | 4288 |
| 207 | Ga0105246_10046086 | 3300011119 | Unclassified | 2972 |
| 208 | Ga0157373_10030138 | 3300013100 | Bacteria | 3904 |
| 209 | Ga0157373_10031460 | 3300013100 | Bacteria | 3820 |
| 210 | Ga0157371_10014381 | 3300013102 | Bacteria | 5973 |
| 211 | Ga0157371_10028755 | 3300013102 | Bacteria | 4023 |
| 212 | Ga0157371_10037665 | 3300013102 | Unclassified | 3461 |
| 213 | Ga0157371_10037897 | 3300013102 | Bacteria | 3450 |
| 214 | Ga0157371_10095424 | 3300013102 | Bacteria | 2108 |
| 215 | Ga0157371_10125194 | 3300013102 | Unclassified | 1828 |
| 216 | Ga0157371_10197921 | 3300013102 | Unclassified | 1440 |
| 217 | Ga0157371_10326975 | 3300013102 | Bacteria | 1113 |
| 218 | Ga0157370_10000263 | 3300013104 | Bacteria | 66700 |
| 219 | Ga0157370_10043995 | 3300013104 | Bacteria | 4296 |
| 220 | Ga0157370_10779300 | 3300013104 | Bacteria | 871 |
| 221 | Ga0157369_10018964 | 3300013105 | Bacteria | 7705 |
| 222 | Ga0157369_10144839 | 3300013105 | Bacteria | 2512 |
| 223 | Ga0157369_10358010 | 3300013105 | Bacteria | 1515 |
| 224 | Ga0157369_11216357 | 3300013105 | Bacteria | 769 |
| 225 | Ga0157374_10002918 | 3300013296 | Bacteria | 14328 |
| 226 | Ga0157374_10007884 | 3300013296 | Bacteria | 9090 |
| 227 | Ga0157374_10109889 | 3300013296 | Bacteria | 2651 |
| 228 | Ga0157374_10129203 | 3300013296 | Unclassified | 2444 |
| 229 | Ga0157374_10209760 | 3300013296 | Bacteria | 1910 |
| 230 | Ga0157378_10012333 | 3300013297 | Bacteria | 7483 |
| 231 | Ga0157378_10014153 | 3300013297 | Bacteria | 6981 |
| 232 | Ga0157378_10102451 | 3300013297 | Bacteria | 2615 |
| 233 | Ga0157378_10341093 | 3300013297 | Unclassified | 1461 |
| 234 | Ga0157378_11480574 | 3300013297 | Bacteria | 723 |
| 235 | Ga0163162_10025708 | 3300013306 | Bacteria | 5821 |
| 236 | Ga0163162_10065714 | 3300013306 | Unclassified | 3675 |
| 237 | Ga0163162_10080280 | 3300013306 | Bacteria | 3330 |
| 238 | Ga0163162_10092054 | 3300013306 | Unclassified | 3115 |
| 239 | Ga0163162_10128999 | 3300013306 | Bacteria | 2637 |
| 240 | Ga0163162_10136894 | 3300013306 | Bacteria | 2560 |
| 241 | Ga0163162_10157430 | 3300013306 | Bacteria | 2392 |
| 242 | Ga0163162_10296717 | 3300013306 | Unclassified | 1748 |
| 243 | Ga0163162_10653690 | 3300013306 | Unclassified | 1175 |
| 244 | Ga0157372_10044971 | 3300013307 | Bacteria | 4894 |
| 245 | Ga0157372_10265586 | 3300013307 | Bacteria | 1993 |
| 246 | Ga0157372_10357028 | 3300013307 | Bacteria | 1703 |
| 247 | Ga0157372_10482006 | 3300013307 | Bacteria | 1446 |
| 248 | Ga0157372_10699044 | 3300013307 | Unclassified | 1180 |
| 249 | Ga0157372_10730537 | 3300013307 | Bacteria | 1151 |
| 250 | Ga0157372_11199257 | 3300013307 | Bacteria | 877 |
| 251 | Ga0157375_10011610 | 3300013308 | Bacteria | 7782 |
| 252 | Ga0157375_10141767 | 3300013308 | Bacteria | 2531 |
| 253 | Ga0157375_10155364 | 3300013308 | Bacteria | 2426 |
| 254 | Ga0163163_10008995 | 3300014325 | Bacteria | 8899 |
| 255 | Ga0163163_10093924 | 3300014325 | Unclassified | 3016 |
| 256 | Ga0163163_10154925 | 3300014325 | Bacteria | 2335 |
| 257 | Ga0163163_10376488 | 3300014325 | Bacteria | 1477 |
| 258 | Ga0163163_10560485 | 3300014325 | Bacteria | 1205 |
| 259 | Ga0157380_10020317 | 3300014326 | Bacteria | 4963 |
| 260 | Ga0157380_10043757 | 3300014326 | Bacteria | 3507 |
| 261 | Ga0157380_10253112 | 3300014326 | Bacteria | 1595 |
| 262 | Ga0157380_10265396 | 3300014326 | Unclassified | 1562 |
| 263 | Ga0157380_10505120 | 3300014326 | Bacteria | 1175 |
| 264 | Ga0157377_10003612 | 3300014745 | Bacteria | 7007 |
| 265 | Ga0157377_10006329 | 3300014745 | Bacteria | 5639 |
| 266 | Ga0157377_10052824 | 3300014745 | Unclassified | 2296 |
| 267 | Ga0157379_10021385 | 3300014968 | Bacteria | 5727 |
| 268 | Ga0157379_10024716 | 3300014968 | Bacteria | 5332 |
| 269 | Ga0157379_10043900 | 3300014968 | Bacteria | 3991 |
| 270 | Ga0157379_10071364 | 3300014968 | Bacteria | 3107 |
| 271 | Ga0157379_10796989 | 3300014968 | Bacteria | 892 |
| 272 | Ga0157376_10015885 | 3300014969 | Bacteria | 5700 |
| 273 | Ga0157376_10378283 | 3300014969 | Bacteria | 1363 |
| 274 | Ga0157376_10509298 | 3300014969 | Bacteria | 1184 |
| 275 | Ga0163161_10002549 | 3300017792 | Bacteria | 13011 |
| 276 | Ga0163161_10012223 | 3300017792 | Bacteria | 5955 |
| 277 | Ga0163161_10145664 | 3300017792 | Bacteria | 1796 |
| 278 | Ga0163161_10208540 | 3300017792 | Bacteria | 1509 |
| 279 | Ga0163161_10272871 | 3300017792 | Unclassified | 1324 |
| 280 | Ga0163161_10420719 | 3300017792 | Unclassified | 1075 |
| 281 | Ga0207697_10006128 | 3300025315 | Bacteria | 5491 |
| 282 | Ga0207697_10038761 | 3300025315 | Bacteria | 1955 |
| 283 | Ga0207697_10057560 | 3300025315 | Unclassified | 1613 |
| 284 | Ga0207682_10024567 | 3300025893 | Bacteria | 2387 |
| 285 | Ga0207642_10017992 | 3300025899 | Bacteria | 2702 |
| 286 | Ga0207642_10068913 | 3300025899 | Bacteria | 1676 |
| 287 | Ga0207642_10136903 | 3300025899 | Bacteria | 1286 |
| 288 | Ga0207688_10060838 | 3300025901 | Unclassified | 2128 |
| 289 | Ga0207680_10143608 | 3300025903 | Unclassified | 1584 |
| 290 | Ga0207680_10163231 | 3300025903 | Bacteria | 1496 |
| 291 | Ga0207680_10219551 | 3300025903 | Bacteria | 1303 |
| 292 | Ga0207699_10014775 | 3300025906 | Unclassified | 4037 |
| 293 | Ga0207699_10364920 | 3300025906 | Bacteria | 1022 |
| 294 | Ga0207645_10000354 | 3300025907 | Bacteria | 38157 |
| 295 | Ga0207645_10024656 | 3300025907 | Bacteria | 3896 |
| 296 | Ga0207645_10089634 | 3300025907 | Bacteria | 1978 |
| 297 | Ga0207643_10050573 | 3300025908 | Bacteria | 2357 |
| 298 | Ga0207705_10013458 | 3300025909 | Bacteria | 5902 |
| 299 | Ga0207654_10614520 | 3300025911 | Bacteria | 776 |
| 300 | Ga0207660_10031924 | 3300025917 | Bacteria | 3632 |
| 301 | Ga0207660_10228086 | 3300025917 | Bacteria | 1464 |
| 302 | Ga0207660_10794357 | 3300025917 | Unclassified | 772 |
| 303 | Ga0207662_10024919 | 3300025918 | Bacteria | 3444 |
| 304 | Ga0207662_10353891 | 3300025918 | Unclassified | 987 |
| 305 | Ga0207662_10411405 | 3300025918 | Bacteria | 919 |
| 306 | Ga0207657_10011684 | 3300025919 | Bacteria | 8701 |
| 307 | Ga0207657_10017212 | 3300025919 | Bacteria | 6942 |
| 308 | Ga0207657_10217611 | 3300025919 | Bacteria | 1531 |
| 309 | Ga0207649_10001160 | 3300025920 | Bacteria | 15873 |
| 310 | Ga0207649_10007972 | 3300025920 | Bacteria | 5762 |
| 311 | Ga0207652_10003426 | 3300025921 | Bacteria | 13089 |
| 312 | Ga0207652_10046045 | 3300025921 | Bacteria | 3720 |
| 313 | Ga0207681_10068857 | 3300025923 | Bacteria | 2460 |
| 314 | Ga0207681_10137467 | 3300025923 | Bacteria | 1815 |
| 315 | Ga0207681_10303615 | 3300025923 | Bacteria | 1264 |
| 316 | Ga0207650_10047341 | 3300025925 | Bacteria | 3169 |
| 317 | Ga0207650_10060964 | 3300025925 | Bacteria | 2815 |
| 318 | Ga0207650_10206926 | 3300025925 | Bacteria | 1574 |
| 319 | Ga0207650_10240182 | 3300025925 | Unclassified | 1464 |
| 320 | Ga0207650_10305498 | 3300025925 | Bacteria | 1300 |
| 321 | Ga0207650_10345323 | 3300025925 | Bacteria | 1223 |
| 322 | Ga0207659_10086078 | 3300025926 | Bacteria | 2336 |
| 323 | Ga0207700_10003696 | 3300025928 | Bacteria | 8925 |
| 324 | Ga0207700_10007957 | 3300025928 | Bacteria | 6527 |
| 325 | Ga0207664_10006880 | 3300025929 | Bacteria | 7861 |
| 326 | Ga0207664_10055997 | 3300025929 | Unclassified | 3131 |
| 327 | Ga0207644_10025302 | 3300025931 | Unclassified | 4082 |
| 328 | Ga0207644_10192645 | 3300025931 | Bacteria | 1604 |
| 329 | Ga0207644_10263790 | 3300025931 | Bacteria | 1378 |
| 330 | Ga0207644_10401329 | 3300025931 | Bacteria | 1121 |
| 331 | Ga0207690_10058342 | 3300025932 | Bacteria | 2611 |
| 332 | Ga0207706_10006556 | 3300025933 | Bacteria | 10783 |
| 333 | Ga0207706_10039716 | 3300025933 | Bacteria | 4173 |
| 334 | Ga0207706_10062224 | 3300025933 | Bacteria | 3287 |
| 335 | Ga0207706_10135521 | 3300025933 | Bacteria | 2166 |
| 336 | Ga0207686_10644657 | 3300025934 | Bacteria | 837 |
| 337 | Ga0207670_10141389 | 3300025936 | Unclassified | 1775 |
| 338 | Ga0207670_10165121 | 3300025936 | Bacteria | 1656 |
| 339 | Ga0207669_10271761 | 3300025937 | Bacteria | 1273 |
| 340 | Ga0207669_10395395 | 3300025937 | Bacteria | 1081 |
| 341 | Ga0207704_10044526 | 3300025938 | Bacteria | 2630 |
| 342 | Ga0207704_10071969 | 3300025938 | Unclassified | 2196 |
| 343 | Ga0207704_10135965 | 3300025938 | Unclassified | 1711 |
| 344 | Ga0207704_10191899 | 3300025938 | Bacteria | 1487 |
| 345 | Ga0207704_10565657 | 3300025938 | Bacteria | 926 |
| 346 | Ga0207691_10025231 | 3300025940 | Bacteria | 5582 |
| 347 | Ga0207691_10029719 | 3300025940 | Bacteria | 5110 |
| 348 | Ga0207691_10133234 | 3300025940 | Bacteria | 2194 |
| 349 | Ga0207691_10186480 | 3300025940 | Unclassified | 1811 |
| 350 | Ga0207689_10003402 | 3300025942 | Bacteria | 14529 |
| 351 | Ga0207689_10006527 | 3300025942 | Bacteria | 10294 |
| 352 | Ga0207689_10038084 | 3300025942 | Bacteria | 3984 |
| 353 | Ga0207689_10055671 | 3300025942 | Bacteria | 3255 |
| 354 | Ga0207689_10750374 | 3300025942 | Bacteria | 824 |
| 355 | Ga0207661_10000929 | 3300025944 | Bacteria | 19227 |
| 356 | Ga0207661_10006780 | 3300025944 | Bacteria | 8110 |
| 357 | Ga0207661_10229285 | 3300025944 | Bacteria | 1644 |
| 358 | Ga0207661_10371742 | 3300025944 | Bacteria | 1293 |
| 359 | Ga0207679_10000232 | 3300025945 | Bacteria | 43046 |
| 360 | Ga0207679_10006857 | 3300025945 | Bacteria | 7217 |
| 361 | Ga0207679_10033582 | 3300025945 | Bacteria | 3611 |
| 362 | Ga0207679_10108385 | 3300025945 | Unclassified | 2187 |
| 363 | Ga0207679_10133921 | 3300025945 | Bacteria | 1992 |
| 364 | Ga0207667_10033896 | 3300025949 | Bacteria | 5486 |
| 365 | Ga0207667_10773546 | 3300025949 | Bacteria | 958 |
| 366 | Ga0207651_10028121 | 3300025960 | Bacteria | 3542 |
| 367 | Ga0207651_10052142 | 3300025960 | Bacteria | 2788 |
| 368 | Ga0207651_10393964 | 3300025960 | Bacteria | 1176 |
| 369 | Ga0207712_10014046 | 3300025961 | Bacteria | 5140 |
| 370 | Ga0207712_10031639 | 3300025961 | Bacteria | 3566 |
| 371 | Ga0207712_10145468 | 3300025961 | Bacteria | 1824 |
| 372 | Ga0207712_10279807 | 3300025961 | Unclassified | 1361 |
| 373 | Ga0207712_10316010 | 3300025961 | Bacteria | 1287 |
| 374 | Ga0207712_10491190 | 3300025961 | Bacteria | 1048 |
| 375 | Ga0207668_10050700 | 3300025972 | Unclassified | 2862 |
| 376 | Ga0207668_10053711 | 3300025972 | Bacteria | 2793 |
| 377 | Ga0207668_10739588 | 3300025972 | Unclassified | 867 |
| 378 | Ga0207640_10039254 | 3300025981 | Bacteria | 2995 |
| 379 | Ga0207640_10079812 | 3300025981 | Unclassified | 2231 |
| 380 | Ga0207640_10521139 | 3300025981 | Bacteria | 993 |
| 381 | Ga0207658_10052125 | 3300025986 | Unclassified | 3019 |
| 382 | Ga0207658_10075241 | 3300025986 | Bacteria | 2569 |
| 383 | Ga0207677_10034678 | 3300026023 | Bacteria | 3270 |
| 384 | Ga0207677_10059862 | 3300026023 | Bacteria | 2629 |
| 385 | Ga0207677_10379418 | 3300026023 | Bacteria | 1193 |
| 386 | Ga0207703_10016225 | 3300026035 | Bacteria | 5805 |
| 387 | Ga0207703_10287183 | 3300026035 | Unclassified | 1496 |
| 388 | Ga0207639_10084890 | 3300026041 | Bacteria | 2517 |
| 389 | Ga0207639_10619977 | 3300026041 | Bacteria | 999 |
| 390 | Ga0207678_10451411 | 3300026067 | Bacteria | 1117 |
| 391 | Ga0207708_10219815 | 3300026075 | Unclassified | 1522 |
| 392 | Ga0207708_10466552 | 3300026075 | Bacteria | 1054 |
| 393 | Ga0207708_11064864 | 3300026075 | Bacteria | 704 |
| 394 | Ga0207641_10004439 | 3300026088 | Bacteria | 12154 |
| 395 | Ga0207641_11142859 | 3300026088 | Bacteria | 778 |
| 396 | Ga0207648_10000404 | 3300026089 | Bacteria | 48036 |
| 397 | Ga0207648_10001472 | 3300026089 | Bacteria | 25920 |
| 398 | Ga0207648_10028636 | 3300026089 | Bacteria | 4938 |
| 399 | Ga0207648_10054096 | 3300026089 | Bacteria | 3507 |
| 400 | Ga0207648_10079442 | 3300026089 | Bacteria | 2861 |
| 401 | Ga0207648_10203174 | 3300026089 | Bacteria | 1758 |
| 402 | Ga0207648_10267386 | 3300026089 | Bacteria | 1527 |
| 403 | Ga0207676_10036804 | 3300026095 | Bacteria | 3726 |
| 404 | Ga0207676_10037115 | 3300026095 | Unclassified | 3711 |
| 405 | Ga0207676_10099647 | 3300026095 | Unclassified | 2405 |
| 406 | Ga0207676_10169086 | 3300026095 | Bacteria | 1903 |
| 407 | Ga0207676_10225403 | 3300026095 | Bacteria | 1672 |
| 408 | Ga0207674_10009679 | 3300026116 | Bacteria | 10985 |
| 409 | Ga0207674_10064304 | 3300026116 | Bacteria | 3701 |
| 410 | Ga0207674_10089594 | 3300026116 | Bacteria | 3069 |
| 411 | Ga0207674_10108382 | 3300026116 | Bacteria | 2754 |
| 412 | Ga0207674_10131565 | 3300026116 | Bacteria | 2465 |
| 413 | Ga0207674_10174999 | 3300026116 | Bacteria | 2099 |
| 414 | Ga0207674_10185949 | 3300026116 | Bacteria | 2028 |
| 415 | Ga0207675_100000326 | 3300026118 | Bacteria | 45358 |
| 416 | Ga0207675_100031508 | 3300026118 | Bacteria | 4938 |
| 417 | Ga0207675_100037522 | 3300026118 | Bacteria | 4520 |
| 418 | Ga0207675_100202430 | 3300026118 | Bacteria | 1907 |
| 419 | Ga0207675_100212948 | 3300026118 | Bacteria | 1859 |
| 420 | Ga0207675_100285250 | 3300026118 | Bacteria | 1605 |
| 421 | Ga0207683_10003746 | 3300026121 | Bacteria | 13185 |
| 422 | Ga0207683_10103551 | 3300026121 | Bacteria | 2543 |
| 423 | Ga0207683_10279767 | 3300026121 | Bacteria | 1525 |
| 424 | Ga0207683_10582112 | 3300026121 | Bacteria | 1035 |
| 425 | Ga0207683_10897741 | 3300026121 | Bacteria | 823 |
| 426 | Ga0207698_10017457 | 3300026142 | Bacteria | 4870 |
| 427 | Ga0207698_10074085 | 3300026142 | Bacteria | 2714 |
| 428 | Ga0207698_10628627 | 3300026142 | Bacteria | 1061 |
| 429 | Ga0207428_10152627 | 3300027907 | Bacteria | 1757 |
| 430 | Ga0268266_10067836 | 3300028379 | Bacteria | 3088 |
| 431 | Ga0268266_10101845 | 3300028379 | Bacteria | 2532 |
| 432 | Ga0268266_10777187 | 3300028379 | Bacteria | 925 |
| 433 | Ga0268265_10379755 | 3300028380 | Bacteria | 1299 |
| 434 | Ga0268264_10057356 | 3300028381 | Bacteria | 3258 |
| 435 | Ga0268264_10083705 | 3300028381 | Bacteria | 2733 |
| 436 | Ga0268264_10520434 | 3300028381 | Bacteria | 1163 |
| 437 | Ga0265338_10245687 | 3300028800 | Bacteria | 1323 |
| 438 | Ga0265324_10068561 | 3300029957 | Bacteria | 1209 |
| 439 | Ga0307408_100101076 | 3300031548 | Bacteria | 2197 |
| 440 | Ga0307405_10002560 | 3300031731 | Bacteria | 8068 |
| 441 | Ga0307410_10058893 | 3300031852 | Bacteria | 2620 |
| 442 | Ga0307406_10163752 | 3300031901 | Bacteria | 1602 |
| 443 | Ga0307407_10006466 | 3300031903 | Bacteria | 5211 |
| 444 | Ga0307412_10003625 | 3300031911 | Bacteria | 8578 |
| 445 | Ga0307409_100001406 | 3300031995 | Bacteria | 11777 |
| 446 | Ga0307416_100032115 | 3300032002 | Bacteria | 3962 |
| 447 | Ga0307414_10007419 | 3300032004 | Bacteria | 6161 |
| 448 | Ga0307411_10015740 | 3300032005 | Bacteria | 4259 |
| 449 | Ga0307415_100026187 | 3300032126 | Bacteria | 3674 |
| 450 | Ga0373957_0082100 | 3300035120 | Bacteria | 1274 |
| 451 | Ga0373943_0186318 | 3300035170 | Bacteria | 1143 |
| 452 | Ga0373955_0013680 | 3300035172 | Bacteria | 3932 |
| 453 | Ga0373924_0071536 | 3300035410 | Bacteria | 1464 |
| 454 | Ga0373935_0278617 | 3300035692 | Bacteria | 1177 |
| 455 | Ga0373933_0115285 | 3300035724 | Bacteria | 1679 |
| 456 | Ga0395905_0547333 | 3300037471 | Bacteria | 1059 |
| 457 | Ga0439465_0044047 | 3300041413 | Bacteria | 1449 |
| 458 | Ga0439454_017448 | 3300042011 | Bacteria | 1025 |
| 459 | Ga0453683_0022168 | 3300044673 | Bacteria | 4053 |
| 460 | Ga0453683_0195686 | 3300044673 | Bacteria | 1283 |
| 461 | Ga0453684_0066771 | 3300044712 | Bacteria | 4578 |
| 462 | Ga0453684_0262131 | 3300044712 | Bacteria | 1979 |
| 463 | Ga0466958_0075447 | 3300045836 | Unclassified | 2068 |
| 464 | Ga0466958_0299184 | 3300045836 | Bacteria | 1033 |
| 465 | Ga0466967_0368932 | 3300045976 | Unclassified | 1392 |
| 466 | Ga0495638_0357469 | 3300046460 | Bacteria | 769 |
| 467 | Ga0495653_0349335 | 3300046463 | Bacteria | 951 |
| 468 | Ga0495580_0110566 | 3300046472 | Bacteria | 1909 |
| 469 | Ga0495608_0293909 | 3300046511 | Bacteria | 1007 |
| 470 | Ga0495618_0042877 | 3300046514 | Bacteria | 2854 |
| 471 | Ga0495628_0007334 | 3300046516 | Bacteria | 9549 |
| 472 | Ga0495586_0456934 | 3300046535 | Bacteria | 736 |
| 473 | Ga0495667_0094567 | 3300046559 | Bacteria | 1935 |
| 474 | Ga0495634_0069131 | 3300046642 | Bacteria | 2331 |
| 475 | Ga0495634_0154377 | 3300046642 | Bacteria | 1450 |
| 476 | Ga0495611_0139403 | 3300046648 | Bacteria | 1132 |
| 477 | Ga0495646_0306422 | 3300046680 | Bacteria | 839 |
| 478 | Ga0495658_0442592 | 3300046683 | Bacteria | 830 |
| 479 | Ga0495613_0152615 | 3300046689 | Bacteria | 1647 |
| 480 | Ga0495686_0010384 | 3300047472 | Bacteria | 6628 |
| 481 | Ga0495686_0052545 | 3300047472 | Bacteria | 2555 |
| 482 | Ga0496108_0186759 | 3300048911 | Bacteria | 1796 |
| 483 | Ga0496110_0243398 | 3300048913 | Bacteria | 1637 |
| 484 | Ga0496112_0290570 | 3300048915 | Bacteria | 1581 |
| 485 | Ga0496113_0303869 | 3300048916 | Bacteria | 1278 |
| 486 | Ga0501032_0020511 | 3300049569 | Bacteria | 4601 |
| 487 | Ga0501034_0000410 | 3300049571 | Bacteria | 72148 |
| 488 | Ga0501034_0001945 | 3300049571 | Bacteria | 26170 |
| 489 | Ga0501034_0019303 | 3300049571 | Bacteria | 6976 |
| 490 | Ga0501034_0044164 | 3300049571 | Bacteria | 4507 |
| 491 | Ga0501036_0244603 | 3300049572 | Bacteria | 1504 |
| 492 | Ga0501036_0322616 | 3300049572 | Bacteria | 1290 |
| 493 | Ga0501037_0005753 | 3300049573 | Bacteria | 9054 |
| 494 | Ga0501038_0281584 | 3300049574 | Bacteria | 1309 |
| 495 | Ga0501039_0087577 | 3300049575 | Bacteria | 2426 |
| 496 | Ga0501039_0100013 | 3300049575 | Bacteria | 2263 |
| 497 | Ga0501043_0017443 | 3300049579 | Bacteria | 5627 |
| 498 | Ga0501043_0103058 | 3300049579 | Unclassified | 2242 |
| 499 | Ga0501043_0202002 | 3300049579 | Bacteria | 1542 |
| 500 | Ga0501046_0017485 | 3300049580 | Bacteria | 5982 |
| 501 | Ga0501046_0211024 | 3300049580 | Bacteria | 1441 |
| 502 | Ga0501047_0004355 | 3300049581 | Bacteria | 13318 |
| 503 | Ga0501068_0347262 | 3300049584 | Bacteria | 953 |
| 504 | Ga0501070_0014107 | 3300049586 | Bacteria | 6727 |
| 505 | Ga0501070_0026739 | 3300049586 | Bacteria | 4840 |
| 506 | Ga0501073_0000921 | 3300049589 | Bacteria | 21203 |
| 507 | Ga0501073_0169923 | 3300049589 | Bacteria | 1509 |
| 508 | Ga0501074_0004884 | 3300049590 | Bacteria | 9613 |
| 509 | Ga0501074_0200162 | 3300049590 | Bacteria | 1423 |
| 510 | Ga0501253_059453 | 3300049683 | Bacteria | 820 |
| 511 | Ga0501080_0235331 | 3300049742 | Bacteria | 1673 |
| 512 | Ga0501080_0273625 | 3300049742 | Bacteria | 1536 |
| 513 | Ga0501083_0286170 | 3300049744 | Bacteria | 1072 |
| 514 | Ga0501035_0014708 | 3300049822 | Bacteria | 7223 |
| 515 | Ga0501035_0056449 | 3300049822 | Bacteria | 3503 |
| 516 | Ga0501044_0021107 | 3300049823 | Bacteria | 6953 |
| 517 | Ga0501044_0397333 | 3300049823 | Bacteria | 1291 |
| 518 | Ga0501284_00021 | 3300050005 | Bacteria | 89729 |
| 519 | nmdc:mga0k408_5067_c1 | 3300050493 | Bacteria | 6981 |
| 520 | nmdc:mga09592_20327_c1 | 3300050508 | Bacteria | 5458 |
| 521 | nmdc:mga09592_45558_c1 | 3300050508 | Bacteria | 3695 |
| 522 | nmdc:mga09592_570816_c1 | 3300050508 | Bacteria | 971 |
| 523 | nmdc:mga0qj67_426866_c1 | 3300050509 | Bacteria | 1068 |
| 524 | nmdc:mga0qj67_99517_c1 | 3300050509 | Bacteria | 2343 |
| 525 | nmdc:mga06r32_115302_c1 | 3300050510 | Bacteria | 2646 |
| 526 | nmdc:mga06r32_418268_c1 | 3300050510 | Bacteria | 1322 |
| 527 | nmdc:mga08y16_606717_c1 | 3300050511 | Bacteria | 1103 |
| 528 | nmdc:mga08y16_80503_c1 | 3300050511 | Unclassified | 3396 |
| 529 | nmdc:mga08y16_846821_c1 | 3300050511 | Bacteria | 904 |
| 530 | nmdc:mga0n895_615771_c1 | 3300050512 | Bacteria | 1087 |
| 531 | Ga0500641_0099617 | 3300053096 | Bacteria | 1246 |
| 532 | Ga0500568_0000236 | 3300053139 | Bacteria | 47278 |
| 533 | Ga0500611_000006 | 3300053727 | Bacteria | 226069 |
| 534 | Ga0501082_0671700 | 3300060353 | Unclassified | 907 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005435 | Ga0070714_100005072 | Ga0070714_1000050729 | 178 |
| 2 | 3300005437 | Ga0070710_10019783 | Ga0070710_100197831 | 178 |
| 3 | 3300005563 | Ga0068855_100736558 | Ga0068855_1007365582 | 178 |
| 4 | 3300013105 | Ga0157369_11216357 | Ga0157369_112163571 | 178 |
| 5 | 3300025906 | Ga0207699_10364920 | Ga0207699_103649201 | 178 |
| 6 | 3300025928 | Ga0207700_10007957 | Ga0207700_100079572 | 178 |
| 7 | 3300025929 | Ga0207664_10006880 | Ga0207664_100068809 | 178 |
| 8 | 3300025949 | Ga0207667_10773546 | Ga0207667_107735462 | 178 |
| 9 | 3300050508 | nmdc:mga09592_570816_c1 | nmdc:mga09592_570816_c1_397_933 | 178 |
| 10 | 3300013104 | Ga0157370_10779300 | Ga0157370_107793001 | 187 |
| 11 | 3300049569 | Ga0501032_0020511 | Ga0501032_0020511_3531_4145 | 187 |
| 12 | 3300049571 | Ga0501034_0001945 | Ga0501034_0001945_4098_4712 | 187 |
| 13 | 3300049573 | Ga0501037_0005753 | Ga0501037_0005753_4256_4870 | 187 |
| 14 | 3300049575 | Ga0501039_0100013 | Ga0501039_0100013_163_777 | 187 |
| 15 | 3300049579 | Ga0501043_0017443 | Ga0501043_0017443_3846_4460 | 187 |
| 16 | 3300049822 | Ga0501035_0056449 | Ga0501035_0056449_168_782 | 187 |
| 17 | 3300049823 | Ga0501044_0021107 | Ga0501044_0021107_3855_4469 | 187 |
| 18 | 3300005435 | Ga0070714_100010482 | Ga0070714_1000104825 | 188 |
| 19 | 3300006028 | Ga0070717_10000765 | Ga0070717_1000076512 | 188 |
| 20 | 3300025929 | Ga0207664_10055997 | Ga0207664_100559971 | 188 |
| 21 | 3300005434 | Ga0070709_10049639 | Ga0070709_100496392 | 189 |
| 22 | 3300025906 | Ga0207699_10014775 | Ga0207699_100147753 | 189 |
| 23 | 3300025928 | Ga0207700_10003696 | Ga0207700_100036964 | 189 |
| 24 | 3300005355 | Ga0070671_100293403 | Ga0070671_1002934031 | 191 |
| 25 | 3300005367 | Ga0070667_100076041 | Ga0070667_1000760413 | 191 |
| 26 | 3300005543 | Ga0070672_100460744 | Ga0070672_1004607441 | 191 |
| 27 | 3300005617 | Ga0068859_100286702 | Ga0068859_1002867022 | 191 |
| 28 | 3300005841 | Ga0068863_100093749 | Ga0068863_1000937492 | 191 |
| 29 | 3300005842 | Ga0068858_100216438 | Ga0068858_1002164382 | 191 |
| 30 | 3300006881 | Ga0068865_100031844 | Ga0068865_1000318442 | 191 |
| 31 | 3300006931 | Ga0097620_100286709 | Ga0097620_1002867092 | 191 |
| 32 | 3300013306 | Ga0163162_10653690 | Ga0163162_106536902 | 191 |
| 33 | 3300014968 | Ga0157379_10796989 | Ga0157379_107969892 | 191 |
| 34 | 3300017792 | Ga0163161_10272871 | Ga0163161_102728712 | 191 |
| 35 | 3300025986 | Ga0207658_10052125 | Ga0207658_100521252 | 191 |
| 36 | 3300046472 | Ga0495580_0110566 | Ga0495580_0110566_331_945 | 194 |
| 37 | 3300017792 | Ga0163161_10208540 | Ga0163161_102085402 | 195 |
| 38 | 3300035120 | Ga0373957_0082100 | Ga0373957_0082100_599_1213 | 195 |
| 39 | 3300035170 | Ga0373943_0186318 | Ga0373943_0186318_328_942 | 195 |
| 40 | 3300035172 | Ga0373955_0013680 | Ga0373955_0013680_1511_2125 | 195 |
| 41 | 3300035410 | Ga0373924_0071536 | Ga0373924_0071536_17_631 | 195 |
| 42 | 3300035692 | Ga0373935_0278617 | Ga0373935_0278617_307_921 | 195 |
| 43 | 3300035724 | Ga0373933_0115285 | Ga0373933_0115285_283_897 | 195 |
| 44 | 3300046463 | Ga0495653_0349335 | Ga0495653_0349335_289_903 | 195 |
| 45 | 3300046511 | Ga0495608_0293909 | Ga0495608_0293909_344_958 | 195 |
| 46 | 3300046514 | Ga0495618_0042877 | Ga0495618_0042877_318_932 | 195 |
| 47 | 3300046516 | Ga0495628_0007334 | Ga0495628_0007334_549_1163 | 195 |
| 48 | 3300046535 | Ga0495586_0456934 | Ga0495586_0456934_55_669 | 195 |
| 49 | 3300046559 | Ga0495667_0094567 | Ga0495667_0094567_711_1325 | 195 |
| 50 | 3300046642 | Ga0495634_0069131 | Ga0495634_0069131_1417_2031 | 195 |
| 51 | 3300046680 | Ga0495646_0306422 | Ga0495646_0306422_47_661 | 195 |
| 52 | 3300046689 | Ga0495613_0152615 | Ga0495613_0152615_929_1543 | 195 |
| 53 | 3300026121 | Ga0207683_10279767 | Ga0207683_102797672 | 196 |
| 54 | 3300009553 | Ga0105249_10124188 | Ga0105249_101241883 | 199 |
| 55 | 3300005719 | Ga0068861_100766819 | Ga0068861_1007668192 | 200 |
| 56 | 3300005841 | Ga0068863_100003170 | Ga0068863_10000317012 | 200 |
| 57 | 3300013306 | Ga0163162_10296717 | Ga0163162_102967171 | 200 |
| 58 | 3300026035 | Ga0207703_10287183 | Ga0207703_102871832 | 200 |
| 59 | 3300026088 | Ga0207641_10004439 | Ga0207641_100044393 | 200 |
| 60 | 3300006237 | Ga0097621_100256057 | Ga0097621_1002560572 | 202 |
| 61 | 3300014969 | Ga0157376_10378283 | Ga0157376_103782832 | 202 |
| 62 | 3300005331 | Ga0070670_100909115 | Ga0070670_1009091151 | 203 |
| 63 | 3300005459 | Ga0068867_100175873 | Ga0068867_1001758731 | 203 |
| 64 | 3300005616 | Ga0068852_101105083 | Ga0068852_1011050832 | 203 |
| 65 | 3300006237 | Ga0097621_100451145 | Ga0097621_1004511452 | 203 |
| 66 | 3300013102 | Ga0157371_10037665 | Ga0157371_100376652 | 203 |
| 67 | 3300013105 | Ga0157369_10358010 | Ga0157369_103580102 | 203 |
| 68 | 3300013297 | Ga0157378_10102451 | Ga0157378_101024512 | 203 |
| 69 | 3300013307 | Ga0157372_10357028 | Ga0157372_103570282 | 203 |
| 70 | 3300014325 | Ga0163163_10560485 | Ga0163163_105604852 | 203 |
| 71 | 3300026095 | Ga0207676_10036804 | Ga0207676_100368044 | 203 |
| 72 | 3300026121 | Ga0207683_10103551 | Ga0207683_101035513 | 203 |
| 73 | 3300031548 | Ga0307408_100101076 | Ga0307408_1001010762 | 203 |
| 74 | 3300031731 | Ga0307405_10002560 | Ga0307405_100025603 | 203 |
| 75 | 3300031852 | Ga0307410_10058893 | Ga0307410_100588932 | 203 |
| 76 | 3300031903 | Ga0307407_10006466 | Ga0307407_100064664 | 203 |
| 77 | 3300031911 | Ga0307412_10003625 | Ga0307412_100036257 | 203 |
| 78 | 3300031995 | Ga0307409_100001406 | Ga0307409_1000014062 | 203 |
| 79 | 3300032002 | Ga0307416_100032115 | Ga0307416_1000321152 | 203 |
| 80 | 3300032004 | Ga0307414_10007419 | Ga0307414_100074192 | 203 |
| 81 | 3300032005 | Ga0307411_10015740 | Ga0307411_100157403 | 203 |
| 82 | 3300032126 | Ga0307415_100026187 | Ga0307415_1000261873 | 203 |
| 83 | 3300037471 | Ga0395905_0547333 | Ga0395905_0547333_134_820 | 203 |
| 84 | 3300045836 | Ga0466958_0075447 | Ga0466958_0075447_679_1389 | 203 |
| 85 | 3300060353 | Ga0501082_0671700 | Ga0501082_0671700_47_715 | 203 |
| 86 | 3300002459 | JGI24751J29686_10002322 | JGI24751J29686_100023225 | 204 |
| 87 | 3300002459 | JGI24751J29686_10002413 | JGI24751J29686_100024132 | 204 |
| 88 | 3300005290 | Ga0065712_10162696 | Ga0065712_101626962 | 204 |
| 89 | 3300005290 | Ga0065712_10188549 | Ga0065712_101885491 | 204 |
| 90 | 3300005329 | Ga0070683_100002306 | Ga0070683_10000230610 | 204 |
| 91 | 3300005329 | Ga0070683_100015970 | Ga0070683_1000159702 | 204 |
| 92 | 3300005329 | Ga0070683_100626400 | Ga0070683_1006264002 | 204 |
| 93 | 3300005330 | Ga0070690_100024488 | Ga0070690_1000244882 | 204 |
| 94 | 3300005330 | Ga0070690_100050564 | Ga0070690_1000505642 | 204 |
| 95 | 3300005331 | Ga0070670_100009051 | Ga0070670_1000090512 | 204 |
| 96 | 3300005331 | Ga0070670_100021498 | Ga0070670_1000214986 | 204 |
| 97 | 3300005334 | Ga0068869_100069906 | Ga0068869_1000699062 | 204 |
| 98 | 3300005335 | Ga0070666_10038111 | Ga0070666_100381112 | 204 |
| 99 | 3300005335 | Ga0070666_10170691 | Ga0070666_101706912 | 204 |
| 100 | 3300005337 | Ga0070682_100072795 | Ga0070682_1000727952 | 204 |
| 101 | 3300005338 | Ga0068868_100001063 | Ga0068868_10000106312 | 204 |
| 102 | 3300005338 | Ga0068868_100022140 | Ga0068868_1000221402 | 204 |
| 103 | 3300005338 | Ga0068868_100046819 | Ga0068868_1000468192 | 204 |
| 104 | 3300005340 | Ga0070689_100005751 | Ga0070689_1000057512 | 204 |
| 105 | 3300005340 | Ga0070689_100025849 | Ga0070689_1000258493 | 204 |
| 106 | 3300005344 | Ga0070661_100000802 | Ga0070661_1000008027 | 204 |
| 107 | 3300005344 | Ga0070661_100009511 | Ga0070661_1000095119 | 204 |
| 108 | 3300005344 | Ga0070661_100368769 | Ga0070661_1003687691 | 204 |
| 109 | 3300005344 | Ga0070661_100389609 | Ga0070661_1003896091 | 204 |
| 110 | 3300005353 | Ga0070669_100096418 | Ga0070669_1000964182 | 204 |
| 111 | 3300005354 | Ga0070675_100180745 | Ga0070675_1001807452 | 204 |
| 112 | 3300005355 | Ga0070671_100067658 | Ga0070671_1000676583 | 204 |
| 113 | 3300005355 | Ga0070671_100387595 | Ga0070671_1003875951 | 204 |
| 114 | 3300005355 | Ga0070671_100770217 | Ga0070671_1007702171 | 204 |
| 115 | 3300005364 | Ga0070673_100042077 | Ga0070673_1000420771 | 204 |
| 116 | 3300005365 | Ga0070688_100037062 | Ga0070688_1000370622 | 204 |
| 117 | 3300005365 | Ga0070688_100139119 | Ga0070688_1001391192 | 204 |
| 118 | 3300005365 | Ga0070688_100338672 | Ga0070688_1003386722 | 204 |
| 119 | 3300005366 | Ga0070659_100036423 | Ga0070659_1000364232 | 204 |
| 120 | 3300005367 | Ga0070667_100059799 | Ga0070667_1000597992 | 204 |
| 121 | 3300005367 | Ga0070667_100579431 | Ga0070667_1005794311 | 204 |
| 122 | 3300005441 | Ga0070700_100076647 | Ga0070700_1000766472 | 204 |
| 123 | 3300005455 | Ga0070663_100421686 | Ga0070663_1004216862 | 204 |
| 124 | 3300005456 | Ga0070678_100044598 | Ga0070678_1000445983 | 204 |
| 125 | 3300005456 | Ga0070678_100090873 | Ga0070678_1000908731 | 204 |
| 126 | 3300005456 | Ga0070678_100225066 | Ga0070678_1002250662 | 204 |
| 127 | 3300005457 | Ga0070662_100058094 | Ga0070662_1000580943 | 204 |
| 128 | 3300005457 | Ga0070662_100306787 | Ga0070662_1003067872 | 204 |
| 129 | 3300005459 | Ga0068867_100139779 | Ga0068867_1001397792 | 204 |
| 130 | 3300005459 | Ga0068867_100359336 | Ga0068867_1003593362 | 204 |
| 131 | 3300005466 | Ga0070685_10031385 | Ga0070685_100313852 | 204 |
| 132 | 3300005466 | Ga0070685_10042854 | Ga0070685_100428543 | 204 |
| 133 | 3300005535 | Ga0070684_100000772 | Ga0070684_10000077215 | 204 |
| 134 | 3300005535 | Ga0070684_100004165 | Ga0070684_1000041659 | 204 |
| 135 | 3300005535 | Ga0070684_100245603 | Ga0070684_1002456032 | 204 |
| 136 | 3300005535 | Ga0070684_101192523 | Ga0070684_1011925231 | 204 |
| 137 | 3300005539 | Ga0068853_100001075 | Ga0068853_10000107513 | 204 |
| 138 | 3300005544 | Ga0070686_100007568 | Ga0070686_1000075683 | 204 |
| 139 | 3300005548 | Ga0070665_100130277 | Ga0070665_1001302772 | 204 |
| 140 | 3300005564 | Ga0070664_100000505 | Ga0070664_10000050521 | 204 |
| 141 | 3300005564 | Ga0070664_100004719 | Ga0070664_10000471916 | 204 |
| 142 | 3300005564 | Ga0070664_100033251 | Ga0070664_1000332512 | 204 |
| 143 | 3300005564 | Ga0070664_100052458 | Ga0070664_1000524582 | 204 |
| 144 | 3300005577 | Ga0068857_100001366 | Ga0068857_1000013663 | 204 |
| 145 | 3300005577 | Ga0068857_100033074 | Ga0068857_1000330746 | 204 |
| 146 | 3300005577 | Ga0068857_100049806 | Ga0068857_1000498062 | 204 |
| 147 | 3300005577 | Ga0068857_100120401 | Ga0068857_1001204012 | 204 |
| 148 | 3300005577 | Ga0068857_100209665 | Ga0068857_1002096652 | 204 |
| 149 | 3300005578 | Ga0068854_100049621 | Ga0068854_1000496213 | 204 |
| 150 | 3300005615 | Ga0070702_100020388 | Ga0070702_1000203882 | 204 |
| 151 | 3300005616 | Ga0068852_100188844 | Ga0068852_1001888442 | 204 |
| 152 | 3300005617 | Ga0068859_100083156 | Ga0068859_1000831562 | 204 |
| 153 | 3300005617 | Ga0068859_100088006 | Ga0068859_1000880062 | 204 |
| 154 | 3300005617 | Ga0068859_101498420 | Ga0068859_1014984201 | 204 |
| 155 | 3300005618 | Ga0068864_100122411 | Ga0068864_1001224112 | 204 |
| 156 | 3300005618 | Ga0068864_100200539 | Ga0068864_1002005392 | 204 |
| 157 | 3300005718 | Ga0068866_10080201 | Ga0068866_100802012 | 204 |
| 158 | 3300005719 | Ga0068861_100048731 | Ga0068861_1000487312 | 204 |
| 159 | 3300005834 | Ga0068851_10142565 | Ga0068851_101425652 | 204 |
| 160 | 3300005842 | Ga0068858_100039810 | Ga0068858_1000398103 | 204 |
| 161 | 3300005843 | Ga0068860_100485410 | Ga0068860_1004854102 | 204 |
| 162 | 3300005844 | Ga0068862_100099088 | Ga0068862_1000990883 | 204 |
| 163 | 3300005985 | Ga0081539_10000916 | Ga0081539_1000091655 | 204 |
| 164 | 3300005985 | Ga0081539_10018471 | Ga0081539_100184713 | 204 |
| 165 | 3300006237 | Ga0097621_100059062 | Ga0097621_1000590622 | 204 |
| 166 | 3300006358 | Ga0068871_100085730 | Ga0068871_1000857303 | 204 |
| 167 | 3300006847 | Ga0075431_100005665 | Ga0075431_1000056652 | 204 |
| 168 | 3300006880 | Ga0075429_100033309 | Ga0075429_1000333093 | 204 |
| 169 | 3300006880 | Ga0075429_100535019 | Ga0075429_1005350192 | 204 |
| 170 | 3300006931 | Ga0097620_100083165 | Ga0097620_1000831652 | 204 |
| 171 | 3300006931 | Ga0097620_100088009 | Ga0097620_1000880092 | 204 |
| 172 | 3300006931 | Ga0097620_101498471 | Ga0097620_1014984711 | 204 |
| 173 | 3300009094 | Ga0111539_10082802 | Ga0111539_100828023 | 204 |
| 174 | 3300009094 | Ga0111539_10688375 | Ga0111539_106883752 | 204 |
| 175 | 3300009101 | Ga0105247_10052519 | Ga0105247_100525193 | 204 |
| 176 | 3300009147 | Ga0114129_10156929 | Ga0114129_101569293 | 204 |
| 177 | 3300009174 | Ga0105241_10307920 | Ga0105241_103079202 | 204 |
| 178 | 3300009176 | Ga0105242_10167445 | Ga0105242_101674452 | 204 |
| 179 | 3300009176 | Ga0105242_10184072 | Ga0105242_101840722 | 204 |
| 180 | 3300009553 | Ga0105249_10010436 | Ga0105249_100104361 | 204 |
| 181 | 3300009553 | Ga0105249_10069048 | Ga0105249_100690482 | 204 |
| 182 | 3300009553 | Ga0105249_10988377 | Ga0105249_109883772 | 204 |
| 183 | 3300010375 | Ga0105239_10137513 | Ga0105239_101375132 | 204 |
| 184 | 3300010375 | Ga0105239_11598967 | Ga0105239_115989671 | 204 |
| 185 | 3300011119 | Ga0105246_10046086 | Ga0105246_100460862 | 204 |
| 186 | 3300013100 | Ga0157373_10031460 | Ga0157373_100314602 | 204 |
| 187 | 3300013104 | Ga0157370_10043995 | Ga0157370_100439952 | 204 |
| 188 | 3300013296 | Ga0157374_10002918 | Ga0157374_100029185 | 204 |
| 189 | 3300013296 | Ga0157374_10007884 | Ga0157374_100078848 | 204 |
| 190 | 3300013296 | Ga0157374_10129203 | Ga0157374_101292032 | 204 |
| 191 | 3300013296 | Ga0157374_10209760 | Ga0157374_102097602 | 204 |
| 192 | 3300013297 | Ga0157378_10014153 | Ga0157378_100141534 | 204 |
| 193 | 3300013297 | Ga0157378_10341093 | Ga0157378_103410932 | 204 |
| 194 | 3300013297 | Ga0157378_11480574 | Ga0157378_114805741 | 204 |
| 195 | 3300013306 | Ga0163162_10025708 | Ga0163162_100257083 | 204 |
| 196 | 3300013306 | Ga0163162_10065714 | Ga0163162_100657142 | 204 |
| 197 | 3300013306 | Ga0163162_10092054 | Ga0163162_100920543 | 204 |
| 198 | 3300013306 | Ga0163162_10128999 | Ga0163162_101289992 | 204 |
| 199 | 3300013307 | Ga0157372_10265586 | Ga0157372_102655862 | 204 |
| 200 | 3300013308 | Ga0157375_10011610 | Ga0157375_100116102 | 204 |
| 201 | 3300013308 | Ga0157375_10141767 | Ga0157375_101417672 | 204 |
| 202 | 3300014325 | Ga0163163_10008995 | Ga0163163_100089954 | 204 |
| 203 | 3300014325 | Ga0163163_10093924 | Ga0163163_100939242 | 204 |
| 204 | 3300014325 | Ga0163163_10154925 | Ga0163163_101549252 | 204 |
| 205 | 3300014325 | Ga0163163_10376488 | Ga0163163_103764882 | 204 |
| 206 | 3300014326 | Ga0157380_10043757 | Ga0157380_100437571 | 204 |
| 207 | 3300014326 | Ga0157380_10265396 | Ga0157380_102653961 | 204 |
| 208 | 3300014326 | Ga0157380_10505120 | Ga0157380_105051201 | 204 |
| 209 | 3300014745 | Ga0157377_10003612 | Ga0157377_100036121 | 204 |
| 210 | 3300014745 | Ga0157377_10006329 | Ga0157377_100063294 | 204 |
| 211 | 3300014745 | Ga0157377_10052824 | Ga0157377_100528242 | 204 |
| 212 | 3300014968 | Ga0157379_10021385 | Ga0157379_100213856 | 204 |
| 213 | 3300014968 | Ga0157379_10024716 | Ga0157379_100247164 | 204 |
| 214 | 3300014968 | Ga0157379_10043900 | Ga0157379_100439002 | 204 |
| 215 | 3300014969 | Ga0157376_10015885 | Ga0157376_100158853 | 204 |
| 216 | 3300014969 | Ga0157376_10509298 | Ga0157376_105092982 | 204 |
| 217 | 3300017792 | Ga0163161_10002549 | Ga0163161_100025494 | 204 |
| 218 | 3300017792 | Ga0163161_10145664 | Ga0163161_101456642 | 204 |
| 219 | 3300017792 | Ga0163161_10420719 | Ga0163161_104207192 | 204 |
| 220 | 3300025315 | Ga0207697_10057560 | Ga0207697_100575602 | 204 |
| 221 | 3300025899 | Ga0207642_10136903 | Ga0207642_101369031 | 204 |
| 222 | 3300025901 | Ga0207688_10060838 | Ga0207688_100608382 | 204 |
| 223 | 3300025903 | Ga0207680_10143608 | Ga0207680_101436082 | 204 |
| 224 | 3300025903 | Ga0207680_10219551 | Ga0207680_102195512 | 204 |
| 225 | 3300025907 | Ga0207645_10024656 | Ga0207645_100246564 | 204 |
| 226 | 3300025911 | Ga0207654_10614520 | Ga0207654_106145201 | 204 |
| 227 | 3300025918 | Ga0207662_10024919 | Ga0207662_100249192 | 204 |
| 228 | 3300025918 | Ga0207662_10353891 | Ga0207662_103538912 | 204 |
| 229 | 3300025918 | Ga0207662_10411405 | Ga0207662_104114052 | 204 |
| 230 | 3300025920 | Ga0207649_10001160 | Ga0207649_100011605 | 204 |
| 231 | 3300025920 | Ga0207649_10007972 | Ga0207649_100079723 | 204 |
| 232 | 3300025923 | Ga0207681_10068857 | Ga0207681_100688572 | 204 |
| 233 | 3300025923 | Ga0207681_10303615 | Ga0207681_103036152 | 204 |
| 234 | 3300025925 | Ga0207650_10047341 | Ga0207650_100473412 | 204 |
| 235 | 3300025926 | Ga0207659_10086078 | Ga0207659_100860782 | 204 |
| 236 | 3300025931 | Ga0207644_10025302 | Ga0207644_100253022 | 204 |
| 237 | 3300025931 | Ga0207644_10263790 | Ga0207644_102637902 | 204 |
| 238 | 3300025931 | Ga0207644_10401329 | Ga0207644_104013292 | 204 |
| 239 | 3300025933 | Ga0207706_10006556 | Ga0207706_1000655615 | 204 |
| 240 | 3300025933 | Ga0207706_10039716 | Ga0207706_100397164 | 204 |
| 241 | 3300025933 | Ga0207706_10062224 | Ga0207706_100622243 | 204 |
| 242 | 3300025934 | Ga0207686_10644657 | Ga0207686_106446571 | 204 |
| 243 | 3300025936 | Ga0207670_10141389 | Ga0207670_101413892 | 204 |
| 244 | 3300025938 | Ga0207704_10071969 | Ga0207704_100719692 | 204 |
| 245 | 3300025938 | Ga0207704_10135965 | Ga0207704_101359651 | 204 |
| 246 | 3300025940 | Ga0207691_10186480 | Ga0207691_101864802 | 204 |
| 247 | 3300025942 | Ga0207689_10055671 | Ga0207689_100556713 | 204 |
| 248 | 3300025944 | Ga0207661_10000929 | Ga0207661_1000092914 | 204 |
| 249 | 3300025944 | Ga0207661_10006780 | Ga0207661_100067809 | 204 |
| 250 | 3300025944 | Ga0207661_10229285 | Ga0207661_102292851 | 204 |
| 251 | 3300025945 | Ga0207679_10000232 | Ga0207679_1000023215 | 204 |
| 252 | 3300025945 | Ga0207679_10006857 | Ga0207679_100068575 | 204 |
| 253 | 3300025945 | Ga0207679_10033582 | Ga0207679_100335823 | 204 |
| 254 | 3300025945 | Ga0207679_10108385 | Ga0207679_101083851 | 204 |
| 255 | 3300025960 | Ga0207651_10028121 | Ga0207651_100281214 | 204 |
| 256 | 3300025961 | Ga0207712_10031639 | Ga0207712_100316392 | 204 |
| 257 | 3300025961 | Ga0207712_10145468 | Ga0207712_101454681 | 204 |
| 258 | 3300025961 | Ga0207712_10279807 | Ga0207712_102798071 | 204 |
| 259 | 3300025961 | Ga0207712_10491190 | Ga0207712_104911902 | 204 |
| 260 | 3300025972 | Ga0207668_10739588 | Ga0207668_107395881 | 204 |
| 261 | 3300025981 | Ga0207640_10039254 | Ga0207640_100392542 | 204 |
| 262 | 3300025981 | Ga0207640_10079812 | Ga0207640_100798122 | 204 |
| 263 | 3300026023 | Ga0207677_10034678 | Ga0207677_100346784 | 204 |
| 264 | 3300026023 | Ga0207677_10059862 | Ga0207677_100598622 | 204 |
| 265 | 3300026023 | Ga0207677_10379418 | Ga0207677_103794181 | 204 |
| 266 | 3300026035 | Ga0207703_10016225 | Ga0207703_100162252 | 204 |
| 267 | 3300026041 | Ga0207639_10084890 | Ga0207639_100848902 | 204 |
| 268 | 3300026067 | Ga0207678_10451411 | Ga0207678_104514112 | 204 |
| 269 | 3300026075 | Ga0207708_11064864 | Ga0207708_110648641 | 204 |
| 270 | 3300026089 | Ga0207648_10054096 | Ga0207648_100540963 | 204 |
| 271 | 3300026089 | Ga0207648_10079442 | Ga0207648_100794422 | 204 |
| 272 | 3300026095 | Ga0207676_10037115 | Ga0207676_100371154 | 204 |
| 273 | 3300026095 | Ga0207676_10169086 | Ga0207676_101690863 | 204 |
| 274 | 3300026095 | Ga0207676_10225403 | Ga0207676_102254032 | 204 |
| 275 | 3300026116 | Ga0207674_10009679 | Ga0207674_1000967913 | 204 |
| 276 | 3300026116 | Ga0207674_10131565 | Ga0207674_101315652 | 204 |
| 277 | 3300026116 | Ga0207674_10174999 | Ga0207674_101749991 | 204 |
| 278 | 3300026116 | Ga0207674_10185949 | Ga0207674_101859492 | 204 |
| 279 | 3300026118 | Ga0207675_100031508 | Ga0207675_1000315082 | 204 |
| 280 | 3300026118 | Ga0207675_100202430 | Ga0207675_1002024302 | 204 |
| 281 | 3300026142 | Ga0207698_10074085 | Ga0207698_100740853 | 204 |
| 282 | 3300027907 | Ga0207428_10152627 | Ga0207428_101526271 | 204 |
| 283 | 3300028379 | Ga0268266_10067836 | Ga0268266_100678362 | 204 |
| 284 | 3300028380 | Ga0268265_10379755 | Ga0268265_103797552 | 204 |
| 285 | 3300028381 | Ga0268264_10057356 | Ga0268264_100573562 | 204 |
| 286 | 3300028381 | Ga0268264_10520434 | Ga0268264_105204342 | 204 |
| 287 | 3300028800 | Ga0265338_10245687 | Ga0265338_102456872 | 204 |
| 288 | 3300029957 | Ga0265324_10068561 | Ga0265324_100685612 | 204 |
| 289 | 3300045836 | Ga0466958_0299184 | Ga0466958_0299184_213_896 | 204 |
| 290 | 3300045976 | Ga0466967_0368932 | Ga0466967_0368932_47_730 | 204 |
| 291 | 3300046642 | Ga0495634_0154377 | Ga0495634_0154377_692_1306 | 204 |
| 292 | 3300046683 | Ga0495658_0442592 | Ga0495658_0442592_155_769 | 204 |
| 293 | 3300048913 | Ga0496110_0243398 | Ga0496110_0243398_68_682 | 204 |
| 294 | 3300048915 | Ga0496112_0290570 | Ga0496112_0290570_891_1505 | 204 |
| 295 | 3300048916 | Ga0496113_0303869 | Ga0496113_0303869_190_804 | 204 |
| 296 | 3300049571 | Ga0501034_0000410 | Ga0501034_0000410_34847_35461 | 204 |
| 297 | 3300049683 | Ga0501253_059453 | Ga0501253_059453_154_768 | 204 |
| 298 | 3300050005 | Ga0501284_00021 | Ga0501284_00021_27227_27847 | 204 |
| 299 | 3300050508 | nmdc:mga09592_20327_c1 | nmdc:mga09592_20327_c1_2279_2896 | 204 |
| 300 | 3300050509 | nmdc:mga0qj67_426866_c1 | nmdc:mga0qj67_426866_c1_61_678 | 204 |
| 301 | 3300050510 | nmdc:mga06r32_115302_c1 | nmdc:mga06r32_115302_c1_1769_2386 | 204 |
| 302 | 3300050511 | nmdc:mga08y16_80503_c1 | nmdc:mga08y16_80503_c1_1691_2305 | 204 |
| 303 | 3300050512 | nmdc:mga0n895_615771_c1 | nmdc:mga0n895_615771_c1_419_1033 | 204 |
| 304 | 3300001915 | JGI24741J21665_1025945 | JGI24741J21665_10259452 | 205 |
| 305 | 3300005290 | Ga0065712_10004787 | Ga0065712_100047873 | 205 |
| 306 | 3300005293 | Ga0065715_10268983 | Ga0065715_102689832 | 205 |
| 307 | 3300005327 | Ga0070658_10069542 | Ga0070658_100695423 | 205 |
| 308 | 3300005327 | Ga0070658_10608070 | Ga0070658_106080702 | 205 |
| 309 | 3300005328 | Ga0070676_10155725 | Ga0070676_101557253 | 205 |
| 310 | 3300005331 | Ga0070670_100108407 | Ga0070670_1001084074 | 205 |
| 311 | 3300005331 | Ga0070670_100287097 | Ga0070670_1002870971 | 205 |
| 312 | 3300005331 | Ga0070670_100506809 | Ga0070670_1005068092 | 205 |
| 313 | 3300005334 | Ga0068869_100028430 | Ga0068869_1000284303 | 205 |
| 314 | 3300005334 | Ga0068869_100049314 | Ga0068869_1000493142 | 205 |
| 315 | 3300005334 | Ga0068869_100057141 | Ga0068869_1000571413 | 205 |
| 316 | 3300005335 | Ga0070666_10138750 | Ga0070666_101387502 | 205 |
| 317 | 3300005336 | Ga0070680_100017166 | Ga0070680_1000171664 | 205 |
| 318 | 3300005336 | Ga0070680_100052453 | Ga0070680_1000524534 | 205 |
| 319 | 3300005336 | Ga0070680_100076714 | Ga0070680_1000767143 | 205 |
| 320 | 3300005336 | Ga0070680_100347752 | Ga0070680_1003477522 | 205 |
| 321 | 3300005340 | Ga0070689_100019100 | Ga0070689_1000191005 | 205 |
| 322 | 3300005347 | Ga0070668_100010520 | Ga0070668_1000105205 | 205 |
| 323 | 3300005347 | Ga0070668_100015099 | Ga0070668_1000150992 | 205 |
| 324 | 3300005347 | Ga0070668_100111849 | Ga0070668_1001118492 | 205 |
| 325 | 3300005353 | Ga0070669_100009067 | Ga0070669_1000090676 | 205 |
| 326 | 3300005354 | Ga0070675_100067460 | Ga0070675_1000674602 | 205 |
| 327 | 3300005356 | Ga0070674_100056846 | Ga0070674_1000568463 | 205 |
| 328 | 3300005356 | Ga0070674_100434418 | Ga0070674_1004344181 | 205 |
| 329 | 3300005356 | Ga0070674_100556451 | Ga0070674_1005564511 | 205 |
| 330 | 3300005365 | Ga0070688_100005900 | Ga0070688_1000059009 | 205 |
| 331 | 3300005366 | Ga0070659_100053443 | Ga0070659_1000534431 | 205 |
| 332 | 3300005367 | Ga0070667_100085594 | Ga0070667_1000855942 | 205 |
| 333 | 3300005367 | Ga0070667_100903978 | Ga0070667_1009039781 | 205 |
| 334 | 3300005441 | Ga0070700_100370111 | Ga0070700_1003701113 | 205 |
| 335 | 3300005456 | Ga0070678_100622884 | Ga0070678_1006228841 | 205 |
| 336 | 3300005457 | Ga0070662_100013468 | Ga0070662_1000134682 | 205 |
| 337 | 3300005458 | Ga0070681_10159026 | Ga0070681_101590262 | 205 |
| 338 | 3300005458 | Ga0070681_10316972 | Ga0070681_103169721 | 205 |
| 339 | 3300005459 | Ga0068867_100211334 | Ga0068867_1002113342 | 205 |
| 340 | 3300005459 | Ga0068867_100490808 | Ga0068867_1004908082 | 205 |
| 341 | 3300005459 | Ga0068867_100703725 | Ga0068867_1007037251 | 205 |
| 342 | 3300005466 | Ga0070685_10142639 | Ga0070685_101426392 | 205 |
| 343 | 3300005471 | Ga0070698_100005585 | Ga0070698_10000558517 | 205 |
| 344 | 3300005471 | Ga0070698_100005948 | Ga0070698_1000059489 | 205 |
| 345 | 3300005471 | Ga0070698_100066526 | Ga0070698_1000665262 | 205 |
| 346 | 3300005530 | Ga0070679_100001469 | Ga0070679_10000146927 | 205 |
| 347 | 3300005530 | Ga0070679_100821684 | Ga0070679_1008216841 | 205 |
| 348 | 3300005539 | Ga0068853_100053760 | Ga0068853_1000537604 | 205 |
| 349 | 3300005539 | Ga0068853_100218425 | Ga0068853_1002184252 | 205 |
| 350 | 3300005543 | Ga0070672_100016283 | Ga0070672_1000162833 | 205 |
| 351 | 3300005548 | Ga0070665_100021077 | Ga0070665_1000210778 | 205 |
| 352 | 3300005563 | Ga0068855_100211766 | Ga0068855_1002117662 | 205 |
| 353 | 3300005564 | Ga0070664_100406310 | Ga0070664_1004063102 | 205 |
| 354 | 3300005577 | Ga0068857_100099080 | Ga0068857_1000990803 | 205 |
| 355 | 3300005616 | Ga0068852_100004584 | Ga0068852_1000045843 | 205 |
| 356 | 3300005616 | Ga0068852_100298341 | Ga0068852_1002983412 | 205 |
| 357 | 3300005617 | Ga0068859_100027214 | Ga0068859_1000272144 | 205 |
| 358 | 3300005617 | Ga0068859_100985732 | Ga0068859_1009857322 | 205 |
| 359 | 3300005618 | Ga0068864_100054711 | Ga0068864_1000547112 | 205 |
| 360 | 3300005718 | Ga0068866_10023531 | Ga0068866_100235315 | 205 |
| 361 | 3300005719 | Ga0068861_100003722 | Ga0068861_1000037225 | 205 |
| 362 | 3300005719 | Ga0068861_100133990 | Ga0068861_1001339902 | 205 |
| 363 | 3300005719 | Ga0068861_100135016 | Ga0068861_1001350162 | 205 |
| 364 | 3300005840 | Ga0068870_10278515 | Ga0068870_102785151 | 205 |
| 365 | 3300005843 | Ga0068860_100082198 | Ga0068860_1000821983 | 205 |
| 366 | 3300005843 | Ga0068860_100137258 | Ga0068860_1001372582 | 205 |
| 367 | 3300005844 | Ga0068862_100001846 | Ga0068862_10000184614 | 205 |
| 368 | 3300005844 | Ga0068862_100067354 | Ga0068862_1000673543 | 205 |
| 369 | 3300006195 | Ga0075366_10015790 | Ga0075366_100157902 | 205 |
| 370 | 3300006237 | Ga0097621_100061557 | Ga0097621_1000615572 | 205 |
| 371 | 3300006358 | Ga0068871_100048000 | Ga0068871_1000480002 | 205 |
| 372 | 3300006844 | Ga0075428_100043655 | Ga0075428_1000436553 | 205 |
| 373 | 3300006844 | Ga0075428_100429517 | Ga0075428_1004295172 | 205 |
| 374 | 3300006846 | Ga0075430_100064504 | Ga0075430_1000645043 | 205 |
| 375 | 3300006847 | Ga0075431_100115808 | Ga0075431_1001158082 | 205 |
| 376 | 3300006880 | Ga0075429_100014673 | Ga0075429_1000146734 | 205 |
| 377 | 3300006880 | Ga0075429_100081129 | Ga0075429_1000811293 | 205 |
| 378 | 3300006881 | Ga0068865_100065129 | Ga0068865_1000651292 | 205 |
| 379 | 3300006881 | Ga0068865_100548662 | Ga0068865_1005486621 | 205 |
| 380 | 3300006931 | Ga0097620_100027213 | Ga0097620_1000272135 | 205 |
| 381 | 3300006931 | Ga0097620_100985940 | Ga0097620_1009859402 | 205 |
| 382 | 3300009094 | Ga0111539_10015995 | Ga0111539_100159958 | 205 |
| 383 | 3300009094 | Ga0111539_10059808 | Ga0111539_100598082 | 205 |
| 384 | 3300009148 | Ga0105243_10135634 | Ga0105243_101356342 | 205 |
| 385 | 3300009176 | Ga0105242_10030519 | Ga0105242_100305193 | 205 |
| 386 | 3300009176 | Ga0105242_10259437 | Ga0105242_102594372 | 205 |
| 387 | 3300009553 | Ga0105249_10029655 | Ga0105249_100296555 | 205 |
| 388 | 3300011119 | Ga0105246_10020025 | Ga0105246_100200251 | 205 |
| 389 | 3300013100 | Ga0157373_10030138 | Ga0157373_100301382 | 205 |
| 390 | 3300013102 | Ga0157371_10014381 | Ga0157371_100143815 | 205 |
| 391 | 3300013102 | Ga0157371_10028755 | Ga0157371_100287551 | 205 |
| 392 | 3300013102 | Ga0157371_10037897 | Ga0157371_100378971 | 205 |
| 393 | 3300013102 | Ga0157371_10095424 | Ga0157371_100954241 | 205 |
| 394 | 3300013102 | Ga0157371_10125194 | Ga0157371_101251942 | 205 |
| 395 | 3300013102 | Ga0157371_10197921 | Ga0157371_101979212 | 205 |
| 396 | 3300013102 | Ga0157371_10326975 | Ga0157371_103269751 | 205 |
| 397 | 3300013104 | Ga0157370_10000263 | Ga0157370_1000026373 | 205 |
| 398 | 3300013105 | Ga0157369_10018964 | Ga0157369_100189646 | 205 |
| 399 | 3300013105 | Ga0157369_10144839 | Ga0157369_101448392 | 205 |
| 400 | 3300013296 | Ga0157374_10109889 | Ga0157374_101098893 | 205 |
| 401 | 3300013297 | Ga0157378_10012333 | Ga0157378_100123338 | 205 |
| 402 | 3300013306 | Ga0163162_10080280 | Ga0163162_100802803 | 205 |
| 403 | 3300013306 | Ga0163162_10136894 | Ga0163162_101368942 | 205 |
| 404 | 3300013306 | Ga0163162_10157430 | Ga0163162_101574302 | 205 |
| 405 | 3300013307 | Ga0157372_10044971 | Ga0157372_100449711 | 205 |
| 406 | 3300013307 | Ga0157372_10482006 | Ga0157372_104820062 | 205 |
| 407 | 3300013307 | Ga0157372_10699044 | Ga0157372_106990441 | 205 |
| 408 | 3300013307 | Ga0157372_10730537 | Ga0157372_107305371 | 205 |
| 409 | 3300013307 | Ga0157372_11199257 | Ga0157372_111992572 | 205 |
| 410 | 3300013308 | Ga0157375_10155364 | Ga0157375_101553642 | 205 |
| 411 | 3300014326 | Ga0157380_10020317 | Ga0157380_100203176 | 205 |
| 412 | 3300014326 | Ga0157380_10253112 | Ga0157380_102531121 | 205 |
| 413 | 3300014968 | Ga0157379_10071364 | Ga0157379_100713642 | 205 |
| 414 | 3300017792 | Ga0163161_10012223 | Ga0163161_100122233 | 205 |
| 415 | 3300025315 | Ga0207697_10006128 | Ga0207697_100061281 | 205 |
| 416 | 3300025315 | Ga0207697_10038761 | Ga0207697_100387611 | 205 |
| 417 | 3300025893 | Ga0207682_10024567 | Ga0207682_100245672 | 205 |
| 418 | 3300025899 | Ga0207642_10017992 | Ga0207642_100179921 | 205 |
| 419 | 3300025899 | Ga0207642_10068913 | Ga0207642_100689131 | 205 |
| 420 | 3300025903 | Ga0207680_10163231 | Ga0207680_101632312 | 205 |
| 421 | 3300025907 | Ga0207645_10000354 | Ga0207645_1000035427 | 205 |
| 422 | 3300025907 | Ga0207645_10089634 | Ga0207645_100896342 | 205 |
| 423 | 3300025908 | Ga0207643_10050573 | Ga0207643_100505732 | 205 |
| 424 | 3300025909 | Ga0207705_10013458 | Ga0207705_100134583 | 205 |
| 425 | 3300025917 | Ga0207660_10031924 | Ga0207660_100319242 | 205 |
| 426 | 3300025917 | Ga0207660_10228086 | Ga0207660_102280862 | 205 |
| 427 | 3300025917 | Ga0207660_10794357 | Ga0207660_107943571 | 205 |
| 428 | 3300025919 | Ga0207657_10011684 | Ga0207657_100116846 | 205 |
| 429 | 3300025919 | Ga0207657_10017212 | Ga0207657_100172123 | 205 |
| 430 | 3300025919 | Ga0207657_10217611 | Ga0207657_102176112 | 205 |
| 431 | 3300025921 | Ga0207652_10003426 | Ga0207652_100034261 | 205 |
| 432 | 3300025921 | Ga0207652_10046045 | Ga0207652_100460452 | 205 |
| 433 | 3300025923 | Ga0207681_10137467 | Ga0207681_101374673 | 205 |
| 434 | 3300025925 | Ga0207650_10060964 | Ga0207650_100609642 | 205 |
| 435 | 3300025925 | Ga0207650_10206926 | Ga0207650_102069262 | 205 |
| 436 | 3300025925 | Ga0207650_10240182 | Ga0207650_102401822 | 205 |
| 437 | 3300025925 | Ga0207650_10305498 | Ga0207650_103054982 | 205 |
| 438 | 3300025925 | Ga0207650_10345323 | Ga0207650_103453232 | 205 |
| 439 | 3300025931 | Ga0207644_10192645 | Ga0207644_101926452 | 205 |
| 440 | 3300025932 | Ga0207690_10058342 | Ga0207690_100583423 | 205 |
| 441 | 3300025933 | Ga0207706_10135521 | Ga0207706_101355212 | 205 |
| 442 | 3300025936 | Ga0207670_10165121 | Ga0207670_101651212 | 205 |
| 443 | 3300025937 | Ga0207669_10271761 | Ga0207669_102717612 | 205 |
| 444 | 3300025937 | Ga0207669_10395395 | Ga0207669_103953952 | 205 |
| 445 | 3300025938 | Ga0207704_10044526 | Ga0207704_100445263 | 205 |
| 446 | 3300025938 | Ga0207704_10191899 | Ga0207704_101918992 | 205 |
| 447 | 3300025938 | Ga0207704_10565657 | Ga0207704_105656571 | 205 |
| 448 | 3300025940 | Ga0207691_10025231 | Ga0207691_100252316 | 205 |
| 449 | 3300025940 | Ga0207691_10029719 | Ga0207691_100297195 | 205 |
| 450 | 3300025940 | Ga0207691_10133234 | Ga0207691_101332341 | 205 |
| 451 | 3300025942 | Ga0207689_10003402 | Ga0207689_1000340211 | 205 |
| 452 | 3300025942 | Ga0207689_10006527 | Ga0207689_100065278 | 205 |
| 453 | 3300025942 | Ga0207689_10038084 | Ga0207689_100380842 | 205 |
| 454 | 3300025942 | Ga0207689_10750374 | Ga0207689_107503741 | 205 |
| 455 | 3300025944 | Ga0207661_10371742 | Ga0207661_103717422 | 205 |
| 456 | 3300025945 | Ga0207679_10133921 | Ga0207679_101339213 | 205 |
| 457 | 3300025949 | Ga0207667_10033896 | Ga0207667_100338963 | 205 |
| 458 | 3300025960 | Ga0207651_10052142 | Ga0207651_100521422 | 205 |
| 459 | 3300025960 | Ga0207651_10393964 | Ga0207651_103939642 | 205 |
| 460 | 3300025961 | Ga0207712_10014046 | Ga0207712_100140465 | 205 |
| 461 | 3300025961 | Ga0207712_10316010 | Ga0207712_103160102 | 205 |
| 462 | 3300025972 | Ga0207668_10050700 | Ga0207668_100507003 | 205 |
| 463 | 3300025972 | Ga0207668_10053711 | Ga0207668_100537113 | 205 |
| 464 | 3300025981 | Ga0207640_10521139 | Ga0207640_105211392 | 205 |
| 465 | 3300025986 | Ga0207658_10075241 | Ga0207658_100752412 | 205 |
| 466 | 3300026041 | Ga0207639_10619977 | Ga0207639_106199771 | 205 |
| 467 | 3300026075 | Ga0207708_10219815 | Ga0207708_102198152 | 205 |
| 468 | 3300026075 | Ga0207708_10466552 | Ga0207708_104665522 | 205 |
| 469 | 3300026088 | Ga0207641_11142859 | Ga0207641_111428591 | 205 |
| 470 | 3300026089 | Ga0207648_10000404 | Ga0207648_1000040432 | 205 |
| 471 | 3300026089 | Ga0207648_10001472 | Ga0207648_1000147221 | 205 |
| 472 | 3300026089 | Ga0207648_10028636 | Ga0207648_100286364 | 205 |
| 473 | 3300026089 | Ga0207648_10203174 | Ga0207648_102031742 | 205 |
| 474 | 3300026089 | Ga0207648_10267386 | Ga0207648_102673862 | 205 |
| 475 | 3300026095 | Ga0207676_10099647 | Ga0207676_100996472 | 205 |
| 476 | 3300026116 | Ga0207674_10064304 | Ga0207674_100643042 | 205 |
| 477 | 3300026116 | Ga0207674_10089594 | Ga0207674_100895943 | 205 |
| 478 | 3300026116 | Ga0207674_10108382 | Ga0207674_101083822 | 205 |
| 479 | 3300026118 | Ga0207675_100000326 | Ga0207675_10000032624 | 205 |
| 480 | 3300026118 | Ga0207675_100037522 | Ga0207675_1000375227 | 205 |
| 481 | 3300026118 | Ga0207675_100212948 | Ga0207675_1002129482 | 205 |
| 482 | 3300026118 | Ga0207675_100285250 | Ga0207675_1002852502 | 205 |
| 483 | 3300026121 | Ga0207683_10003746 | Ga0207683_1000374611 | 205 |
| 484 | 3300026121 | Ga0207683_10582112 | Ga0207683_105821121 | 205 |
| 485 | 3300026121 | Ga0207683_10897741 | Ga0207683_108977412 | 205 |
| 486 | 3300026142 | Ga0207698_10017457 | Ga0207698_100174573 | 205 |
| 487 | 3300026142 | Ga0207698_10628627 | Ga0207698_106286272 | 205 |
| 488 | 3300028379 | Ga0268266_10101845 | Ga0268266_101018452 | 205 |
| 489 | 3300028379 | Ga0268266_10777187 | Ga0268266_107771871 | 205 |
| 490 | 3300028381 | Ga0268264_10083705 | Ga0268264_100837053 | 205 |
| 491 | 3300031901 | Ga0307406_10163752 | Ga0307406_101637522 | 205 |
| 492 | 3300041413 | Ga0439465_0044047 | Ga0439465_0044047_767_1384 | 205 |
| 493 | 3300042011 | Ga0439454_017448 | Ga0439454_017448_26_787 | 205 |
| 494 | 3300044673 | Ga0453683_0022168 | Ga0453683_0022168_13_636 | 205 |
| 495 | 3300044673 | Ga0453683_0195686 | Ga0453683_0195686_342_968 | 205 |
| 496 | 3300044712 | Ga0453684_0066771 | Ga0453684_0066771_3815_4453 | 205 |
| 497 | 3300044712 | Ga0453684_0262131 | Ga0453684_0262131_1263_1889 | 205 |
| 498 | 3300046460 | Ga0495638_0357469 | Ga0495638_0357469_46_663 | 205 |
| 499 | 3300046648 | Ga0495611_0139403 | Ga0495611_0139403_85_702 | 205 |
| 500 | 3300047472 | Ga0495686_0010384 | Ga0495686_0010384_4770_5435 | 205 |
| 501 | 3300047472 | Ga0495686_0052545 | Ga0495686_0052545_1461_2078 | 205 |
| 502 | 3300048911 | Ga0496108_0186759 | Ga0496108_0186759_187_804 | 205 |
| 503 | 3300049571 | Ga0501034_0019303 | Ga0501034_0019303_6298_6960 | 205 |
| 504 | 3300049571 | Ga0501034_0044164 | Ga0501034_0044164_3483_4124 | 205 |
| 505 | 3300049572 | Ga0501036_0244603 | Ga0501036_0244603_154_816 | 205 |
| 506 | 3300049572 | Ga0501036_0322616 | Ga0501036_0322616_372_1013 | 205 |
| 507 | 3300049574 | Ga0501038_0281584 | Ga0501038_0281584_47_709 | 205 |
| 508 | 3300049575 | Ga0501039_0087577 | Ga0501039_0087577_41_703 | 205 |
| 509 | 3300049579 | Ga0501043_0103058 | Ga0501043_0103058_873_1535 | 205 |
| 510 | 3300049579 | Ga0501043_0202002 | Ga0501043_0202002_571_1212 | 205 |
| 511 | 3300049580 | Ga0501046_0017485 | Ga0501046_0017485_4441_5103 | 205 |
| 512 | 3300049580 | Ga0501046_0211024 | Ga0501046_0211024_458_1099 | 205 |
| 513 | 3300049581 | Ga0501047_0004355 | Ga0501047_0004355_5672_6334 | 205 |
| 514 | 3300049584 | Ga0501068_0347262 | Ga0501068_0347262_166_807 | 205 |
| 515 | 3300049586 | Ga0501070_0014107 | Ga0501070_0014107_5585_6226 | 205 |
| 516 | 3300049586 | Ga0501070_0026739 | Ga0501070_0026739_2028_2645 | 205 |
| 517 | 3300049589 | Ga0501073_0000921 | Ga0501073_0000921_4269_4931 | 205 |
| 518 | 3300049589 | Ga0501073_0169923 | Ga0501073_0169923_361_1002 | 205 |
| 519 | 3300049590 | Ga0501074_0004884 | Ga0501074_0004884_509_1171 | 205 |
| 520 | 3300049590 | Ga0501074_0200162 | Ga0501074_0200162_508_1149 | 205 |
| 521 | 3300049742 | Ga0501080_0235331 | Ga0501080_0235331_509_1171 | 205 |
| 522 | 3300049742 | Ga0501080_0273625 | Ga0501080_0273625_508_1149 | 205 |
| 523 | 3300049744 | Ga0501083_0286170 | Ga0501083_0286170_295_936 | 205 |
| 524 | 3300049822 | Ga0501035_0014708 | Ga0501035_0014708_1552_2214 | 205 |
| 525 | 3300049823 | Ga0501044_0397333 | Ga0501044_0397333_442_1104 | 205 |
| 526 | 3300050493 | nmdc:mga0k408_5067_c1 | nmdc:mga0k408_5067_c1_6327_6944 | 205 |
| 527 | 3300050508 | nmdc:mga09592_45558_c1 | nmdc:mga09592_45558_c1_2109_2732 | 205 |
| 528 | 3300050509 | nmdc:mga0qj67_99517_c1 | nmdc:mga0qj67_99517_c1_1468_2085 | 205 |
| 529 | 3300050510 | nmdc:mga06r32_418268_c1 | nmdc:mga06r32_418268_c1_215_832 | 205 |
| 530 | 3300050511 | nmdc:mga08y16_606717_c1 | nmdc:mga08y16_606717_c1_387_1004 | 205 |
| 531 | 3300050511 | nmdc:mga08y16_846821_c1 | nmdc:mga08y16_846821_c1_101_718 | 205 |
| 532 | 3300053096 | Ga0500641_0099617 | Ga0500641_0099617_472_1089 | 205 |
| 533 | 3300053139 | Ga0500568_0000236 | Ga0500568_0000236_10703_11320 | 205 |
| 534 | 3300053727 | Ga0500611_000006 | Ga0500611_000006_112328_112945 | 205 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4x1e-assembly1.cif.gz_B | crystal structure of unliganded e. coli transcriptional regulator rutr, w167a mutant | 0.8002 | 13 | 202 |
| 4x1e-assembly1.cif.gz_B | crystal structure of unliganded e. coli transcriptional regulator rutr, w167a mutant | 0.7788 | 13 | 202 |
| 5k7z-assembly2.cif.gz_C | crystal structure of aibr in complex with isovaleryl coenzyme a and operator dna | 0.7639 | 9 | 167 |
| 3vpr-assembly2.cif.gz_D | crystal structure of a tetr family transcriptional regulator pfmr from thermus thermophilus hb8 | 0.7633 | 8 | 205 |
| 3vpr-assembly2.cif.gz_C | crystal structure of a tetr family transcriptional regulator pfmr from thermus thermophilus hb8 | 0.7624 | 14 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3whbA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9936 | 10 | 52 | 1.10.10.60 |
| 2wv1B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9888 | 10 | 52 | 1.10.10.60 |
| 3whcD01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.987 | 9 | 52 | 1.10.10.60 |
| 3whcE01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9842 | 10 | 52 | 1.10.10.60 |
| 5gpaB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9838 | 13 | 52 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q3X7Q2-F1-model_v4 | HTH tetR-type domain-containing protein | 0.9391 | 10 | 205 |
GO:0003677
|
| AF-A0A537J9P7-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.9367 | 1 | 134 |
GO:0003677
|
| AF-A0A3S2WB26-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.9347 | 8 | 205 |
GO:0003677
|
| AF-A0A3S2WB26-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.9302 | 8 | 205 |
GO:0003677
|
| AF-A0A2A4NF25-F1-model_v4 | TetR family transcriptional regulator | 0.9292 | 10 | 205 |
GO:0003677
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar