F460561

General Info

Members Datasets Scaffolds Average Seq Length
534 219 534 206

Family's Representative Sequence

Representative Sequence 3300042011|Ga0439454_017448|Ga0439454_017448_26_787
Length 253
Sequence MQLYKGLLLRAFCTSIAAIQQPKLAIREKFFGTKDKMSLHLLTIWLNRMVNKEKDKSTEEKILSAAKKVFVRKGMAGARMQDIADEAGINKALLHYYFRNKEKLFEVIFMEAASKLFPRINEVFTSDLPLFEKIESFCSEYITVVSENPYLPLFVLNEINQDPEYFLQKVWSGQSKPQPXXXXQQIEREVKKGTIKKISPVSLLMNLVSLTIFPFVAKPMFQKNLGLDELQFRSIMEQRKKEIPKFIIDSIRK

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
168 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
169 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
217 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
218 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.94
Nodule 0
Rhizoplane 0.75
Rhizosphere 98.31
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1025945 3300001915 Bacteria 893
2 JGI24751J29686_10002322 3300002459 Bacteria 3841
3 JGI24751J29686_10002413 3300002459 Bacteria 3767
4 Ga0065712_10004787 3300005290 Bacteria 3759
5 Ga0065712_10162696 3300005290 Bacteria 1291
6 Ga0065712_10188549 3300005290 Bacteria 1159
7 Ga0065715_10268983 3300005293 Unclassified 1116
8 Ga0070658_10069542 3300005327 Bacteria 2880
9 Ga0070658_10608070 3300005327 Bacteria 947
10 Ga0070676_10155725 3300005328 Bacteria 1466
11 Ga0070683_100002306 3300005329 Bacteria 15135
12 Ga0070683_100015970 3300005329 Bacteria 6606
13 Ga0070683_100626400 3300005329 Bacteria 1030
14 Ga0070690_100024488 3300005330 Unclassified 3710
15 Ga0070690_100050564 3300005330 Bacteria 2652
16 Ga0070670_100009051 3300005331 Bacteria 8507
17 Ga0070670_100021498 3300005331 Bacteria 5550
18 Ga0070670_100108407 3300005331 Bacteria 2393
19 Ga0070670_100287097 3300005331 Unclassified 1437
20 Ga0070670_100506809 3300005331 Bacteria 1074
21 Ga0070670_100909115 3300005331 Bacteria 798
22 Ga0068869_100028430 3300005334 Bacteria 3907
23 Ga0068869_100049314 3300005334 Bacteria 3047
24 Ga0068869_100057141 3300005334 Bacteria 2848
25 Ga0068869_100069906 3300005334 Unclassified 2597
26 Ga0070666_10038111 3300005335 Unclassified 3198
27 Ga0070666_10138750 3300005335 Bacteria 1693
28 Ga0070666_10170691 3300005335 Bacteria 1523
29 Ga0070680_100017166 3300005336 Bacteria 5703
30 Ga0070680_100052453 3300005336 Bacteria 3329
31 Ga0070680_100076714 3300005336 Bacteria 2751
32 Ga0070680_100347752 3300005336 Unclassified 1260
33 Ga0070682_100072795 3300005337 Unclassified 2203
34 Ga0068868_100001063 3300005338 Bacteria 18804
35 Ga0068868_100022140 3300005338 Unclassified 4793
36 Ga0068868_100046819 3300005338 Bacteria 3385
37 Ga0070689_100005751 3300005340 Bacteria 8503
38 Ga0070689_100019100 3300005340 Bacteria 5062
39 Ga0070689_100025849 3300005340 Bacteria 4414
40 Ga0070661_100000802 3300005344 Bacteria 22567
41 Ga0070661_100009511 3300005344 Bacteria 6733
42 Ga0070661_100368769 3300005344 Unclassified 1130
43 Ga0070661_100389609 3300005344 Unclassified 1100
44 Ga0070668_100010520 3300005347 Bacteria 6878
45 Ga0070668_100015099 3300005347 Bacteria 5770
46 Ga0070668_100111849 3300005347 Bacteria 2174
47 Ga0070669_100009067 3300005353 Bacteria 7094
48 Ga0070669_100096418 3300005353 Bacteria 2225
49 Ga0070675_100067460 3300005354 Unclassified 2960
50 Ga0070675_100180745 3300005354 Bacteria 1824
51 Ga0070671_100067658 3300005355 Unclassified 2978
52 Ga0070671_100293403 3300005355 Unclassified 1384
53 Ga0070671_100387595 3300005355 Bacteria 1194
54 Ga0070671_100770217 3300005355 Bacteria 837
55 Ga0070674_100056846 3300005356 Bacteria 2713
56 Ga0070674_100434418 3300005356 Bacteria 1080
57 Ga0070674_100556451 3300005356 Bacteria 963
58 Ga0070673_100042077 3300005364 Bacteria 3520
59 Ga0070688_100005900 3300005365 Bacteria 6485
60 Ga0070688_100037062 3300005365 Unclassified 2970
61 Ga0070688_100139119 3300005365 Bacteria 1647
62 Ga0070688_100338672 3300005365 Bacteria 1098
63 Ga0070659_100036423 3300005366 Bacteria 3837
64 Ga0070659_100053443 3300005366 Bacteria 3179
65 Ga0070667_100059799 3300005367 Bacteria 3224
66 Ga0070667_100076041 3300005367 Unclassified 2867
67 Ga0070667_100085594 3300005367 Bacteria 2703
68 Ga0070667_100579431 3300005367 Unclassified 1033
69 Ga0070667_100903978 3300005367 Bacteria 822
70 Ga0070709_10049639 3300005434 Unclassified 2625
71 Ga0070714_100005072 3300005435 Bacteria 10020
72 Ga0070714_100010482 3300005435 Bacteria 7325
73 Ga0070710_10019783 3300005437 Bacteria 3485
74 Ga0070700_100076647 3300005441 Bacteria 2148
75 Ga0070700_100370111 3300005441 Bacteria 1068
76 Ga0070663_100421686 3300005455 Bacteria 1095
77 Ga0070678_100044598 3300005456 Bacteria 3167
78 Ga0070678_100090873 3300005456 Unclassified 2342
79 Ga0070678_100225066 3300005456 Unclassified 1561
80 Ga0070678_100622884 3300005456 Bacteria 965
81 Ga0070662_100013468 3300005457 Bacteria 5444
82 Ga0070662_100058094 3300005457 Bacteria 2814
83 Ga0070662_100306787 3300005457 Bacteria 1291
84 Ga0070681_10159026 3300005458 Bacteria 2183
85 Ga0070681_10316972 3300005458 Bacteria 1469
86 Ga0068867_100139779 3300005459 Bacteria 1892
87 Ga0068867_100175873 3300005459 Bacteria 1698
88 Ga0068867_100211334 3300005459 Bacteria 1558
89 Ga0068867_100359336 3300005459 Unclassified 1218
90 Ga0068867_100490808 3300005459 Bacteria 1054
91 Ga0068867_100703725 3300005459 Bacteria 892
92 Ga0070685_10031385 3300005466 Unclassified 2968
93 Ga0070685_10042854 3300005466 Bacteria 2585
94 Ga0070685_10142639 3300005466 Bacteria 1510
95 Ga0070698_100005585 3300005471 Bacteria 13750
96 Ga0070698_100005948 3300005471 Bacteria 13308
97 Ga0070698_100066526 3300005471 Bacteria 3627
98 Ga0070679_100001469 3300005530 Bacteria 20899
99 Ga0070679_100821684 3300005530 Bacteria 872
100 Ga0070684_100000772 3300005535 Bacteria 22197
101 Ga0070684_100004165 3300005535 Bacteria 10957
102 Ga0070684_100245603 3300005535 Bacteria 1636
103 Ga0070684_101192523 3300005535 Unclassified 716
104 Ga0068853_100001075 3300005539 Bacteria 19291
105 Ga0068853_100053760 3300005539 Bacteria 3468
106 Ga0068853_100218425 3300005539 Bacteria 1740
107 Ga0070672_100016283 3300005543 Bacteria 5320
108 Ga0070672_100460744 3300005543 Unclassified 1096
109 Ga0070686_100007568 3300005544 Bacteria 6065
110 Ga0070665_100021077 3300005548 Bacteria 6553
111 Ga0070665_100130277 3300005548 Bacteria 2517
112 Ga0068855_100211766 3300005563 Bacteria 2177
113 Ga0068855_100736558 3300005563 Bacteria 1052
114 Ga0070664_100000505 3300005564 Bacteria 29592
115 Ga0070664_100004719 3300005564 Bacteria 10933
116 Ga0070664_100033251 3300005564 Unclassified 4318
117 Ga0070664_100052458 3300005564 Bacteria 3455
118 Ga0070664_100406310 3300005564 Bacteria 1246
119 Ga0068857_100001366 3300005577 Bacteria 19225
120 Ga0068857_100033074 3300005577 Bacteria 4572
121 Ga0068857_100049806 3300005577 Unclassified 3716
122 Ga0068857_100099080 3300005577 Bacteria 2614
123 Ga0068857_100120401 3300005577 Bacteria 2363
124 Ga0068857_100209665 3300005577 Bacteria 1778
125 Ga0068854_100049621 3300005578 Unclassified 2999
126 Ga0070702_100020388 3300005615 Bacteria 3472
127 Ga0068852_100004584 3300005616 Bacteria 9786
128 Ga0068852_100188844 3300005616 Bacteria 1943
129 Ga0068852_100298341 3300005616 Bacteria 1559
130 Ga0068852_101105083 3300005616 Bacteria 813
131 Ga0068859_100027214 3300005617 Bacteria 5736
132 Ga0068859_100083156 3300005617 Bacteria 3244
133 Ga0068859_100088006 3300005617 Bacteria 3155
134 Ga0068859_100286702 3300005617 Unclassified 1739
135 Ga0068859_100985732 3300005617 Bacteria 925
136 Ga0068859_101498420 3300005617 Bacteria 744
137 Ga0068864_100054711 3300005618 Unclassified 3445
138 Ga0068864_100122411 3300005618 Bacteria 2328
139 Ga0068864_100200539 3300005618 Unclassified 1833
140 Ga0068866_10023531 3300005718 Bacteria 2868
141 Ga0068866_10080201 3300005718 Unclassified 1750
142 Ga0068861_100003722 3300005719 Bacteria 10171
143 Ga0068861_100048731 3300005719 Bacteria 3204
144 Ga0068861_100133990 3300005719 Bacteria 2014
145 Ga0068861_100135016 3300005719 Bacteria 2007
146 Ga0068861_100766819 3300005719 Unclassified 902
147 Ga0068851_10142565 3300005834 Unclassified 1304
148 Ga0068870_10278515 3300005840 Bacteria 1048
149 Ga0068863_100003170 3300005841 Bacteria 16256
150 Ga0068863_100093749 3300005841 Unclassified 2849
151 Ga0068858_100039810 3300005842 Bacteria 4357
152 Ga0068858_100216438 3300005842 Unclassified 1813
153 Ga0068860_100082198 3300005843 Bacteria 3063
154 Ga0068860_100137258 3300005843 Bacteria 2349
155 Ga0068860_100485410 3300005843 Unclassified 1232
156 Ga0068862_100001846 3300005844 Bacteria 19205
157 Ga0068862_100067354 3300005844 Bacteria 3087
158 Ga0068862_100099088 3300005844 Bacteria 2547
159 Ga0081539_10000916 3300005985 Bacteria 55685
160 Ga0081539_10018471 3300005985 Bacteria 4837
161 Ga0070717_10000765 3300006028 Bacteria 21027
162 Ga0075366_10015790 3300006195 Bacteria 4334
163 Ga0097621_100059062 3300006237 Bacteria 3139
164 Ga0097621_100061557 3300006237 Bacteria 3079
165 Ga0097621_100256057 3300006237 Bacteria 1534
166 Ga0097621_100451145 3300006237 Bacteria 1159
167 Ga0068871_100048000 3300006358 Bacteria 3444
168 Ga0068871_100085730 3300006358 Unclassified 2616
169 Ga0075428_100043655 3300006844 Bacteria 4929
170 Ga0075428_100429517 3300006844 Bacteria 1415
171 Ga0075430_100064504 3300006846 Bacteria 3077
172 Ga0075431_100005665 3300006847 Bacteria 12346
173 Ga0075431_100115808 3300006847 Bacteria 2767
174 Ga0075429_100014673 3300006880 Bacteria 6793
175 Ga0075429_100033309 3300006880 Bacteria 4476
176 Ga0075429_100081129 3300006880 Bacteria 2828
177 Ga0075429_100535019 3300006880 Bacteria 1027
178 Ga0068865_100031844 3300006881 Bacteria 3519
179 Ga0068865_100065129 3300006881 Bacteria 2566
180 Ga0068865_100548662 3300006881 Bacteria 970
181 Ga0097620_100027213 3300006931 Bacteria 5736
182 Ga0097620_100083165 3300006931 Bacteria 3244
183 Ga0097620_100088009 3300006931 Bacteria 3155
184 Ga0097620_100286709 3300006931 Unclassified 1739
185 Ga0097620_100985940 3300006931 Bacteria 925
186 Ga0097620_101498471 3300006931 Bacteria 744
187 Ga0111539_10015995 3300009094 Bacteria 9320
188 Ga0111539_10059808 3300009094 Bacteria 4517
189 Ga0111539_10082802 3300009094 Bacteria 3774
190 Ga0111539_10688375 3300009094 Bacteria 1190
191 Ga0105247_10052519 3300009101 Bacteria 2513
192 Ga0114129_10156929 3300009147 Bacteria 3111
193 Ga0105243_10135634 3300009148 Bacteria 2093
194 Ga0105241_10307920 3300009174 Bacteria 1362
195 Ga0105242_10030519 3300009176 Bacteria 4304
196 Ga0105242_10167445 3300009176 Unclassified 1929
197 Ga0105242_10184072 3300009176 Bacteria 1845
198 Ga0105242_10259437 3300009176 Bacteria 1569
199 Ga0105249_10010436 3300009553 Bacteria 8163
200 Ga0105249_10029655 3300009553 Bacteria 4942
201 Ga0105249_10069048 3300009553 Bacteria 3261
202 Ga0105249_10124188 3300009553 Bacteria 2456
203 Ga0105249_10988377 3300009553 Unclassified 910
204 Ga0105239_10137513 3300010375 Unclassified 2720
205 Ga0105239_11598967 3300010375 Unclassified 754
206 Ga0105246_10020025 3300011119 Bacteria 4288
207 Ga0105246_10046086 3300011119 Unclassified 2972
208 Ga0157373_10030138 3300013100 Bacteria 3904
209 Ga0157373_10031460 3300013100 Bacteria 3820
210 Ga0157371_10014381 3300013102 Bacteria 5973
211 Ga0157371_10028755 3300013102 Bacteria 4023
212 Ga0157371_10037665 3300013102 Unclassified 3461
213 Ga0157371_10037897 3300013102 Bacteria 3450
214 Ga0157371_10095424 3300013102 Bacteria 2108
215 Ga0157371_10125194 3300013102 Unclassified 1828
216 Ga0157371_10197921 3300013102 Unclassified 1440
217 Ga0157371_10326975 3300013102 Bacteria 1113
218 Ga0157370_10000263 3300013104 Bacteria 66700
219 Ga0157370_10043995 3300013104 Bacteria 4296
220 Ga0157370_10779300 3300013104 Bacteria 871
221 Ga0157369_10018964 3300013105 Bacteria 7705
222 Ga0157369_10144839 3300013105 Bacteria 2512
223 Ga0157369_10358010 3300013105 Bacteria 1515
224 Ga0157369_11216357 3300013105 Bacteria 769
225 Ga0157374_10002918 3300013296 Bacteria 14328
226 Ga0157374_10007884 3300013296 Bacteria 9090
227 Ga0157374_10109889 3300013296 Bacteria 2651
228 Ga0157374_10129203 3300013296 Unclassified 2444
229 Ga0157374_10209760 3300013296 Bacteria 1910
230 Ga0157378_10012333 3300013297 Bacteria 7483
231 Ga0157378_10014153 3300013297 Bacteria 6981
232 Ga0157378_10102451 3300013297 Bacteria 2615
233 Ga0157378_10341093 3300013297 Unclassified 1461
234 Ga0157378_11480574 3300013297 Bacteria 723
235 Ga0163162_10025708 3300013306 Bacteria 5821
236 Ga0163162_10065714 3300013306 Unclassified 3675
237 Ga0163162_10080280 3300013306 Bacteria 3330
238 Ga0163162_10092054 3300013306 Unclassified 3115
239 Ga0163162_10128999 3300013306 Bacteria 2637
240 Ga0163162_10136894 3300013306 Bacteria 2560
241 Ga0163162_10157430 3300013306 Bacteria 2392
242 Ga0163162_10296717 3300013306 Unclassified 1748
243 Ga0163162_10653690 3300013306 Unclassified 1175
244 Ga0157372_10044971 3300013307 Bacteria 4894
245 Ga0157372_10265586 3300013307 Bacteria 1993
246 Ga0157372_10357028 3300013307 Bacteria 1703
247 Ga0157372_10482006 3300013307 Bacteria 1446
248 Ga0157372_10699044 3300013307 Unclassified 1180
249 Ga0157372_10730537 3300013307 Bacteria 1151
250 Ga0157372_11199257 3300013307 Bacteria 877
251 Ga0157375_10011610 3300013308 Bacteria 7782
252 Ga0157375_10141767 3300013308 Bacteria 2531
253 Ga0157375_10155364 3300013308 Bacteria 2426
254 Ga0163163_10008995 3300014325 Bacteria 8899
255 Ga0163163_10093924 3300014325 Unclassified 3016
256 Ga0163163_10154925 3300014325 Bacteria 2335
257 Ga0163163_10376488 3300014325 Bacteria 1477
258 Ga0163163_10560485 3300014325 Bacteria 1205
259 Ga0157380_10020317 3300014326 Bacteria 4963
260 Ga0157380_10043757 3300014326 Bacteria 3507
261 Ga0157380_10253112 3300014326 Bacteria 1595
262 Ga0157380_10265396 3300014326 Unclassified 1562
263 Ga0157380_10505120 3300014326 Bacteria 1175
264 Ga0157377_10003612 3300014745 Bacteria 7007
265 Ga0157377_10006329 3300014745 Bacteria 5639
266 Ga0157377_10052824 3300014745 Unclassified 2296
267 Ga0157379_10021385 3300014968 Bacteria 5727
268 Ga0157379_10024716 3300014968 Bacteria 5332
269 Ga0157379_10043900 3300014968 Bacteria 3991
270 Ga0157379_10071364 3300014968 Bacteria 3107
271 Ga0157379_10796989 3300014968 Bacteria 892
272 Ga0157376_10015885 3300014969 Bacteria 5700
273 Ga0157376_10378283 3300014969 Bacteria 1363
274 Ga0157376_10509298 3300014969 Bacteria 1184
275 Ga0163161_10002549 3300017792 Bacteria 13011
276 Ga0163161_10012223 3300017792 Bacteria 5955
277 Ga0163161_10145664 3300017792 Bacteria 1796
278 Ga0163161_10208540 3300017792 Bacteria 1509
279 Ga0163161_10272871 3300017792 Unclassified 1324
280 Ga0163161_10420719 3300017792 Unclassified 1075
281 Ga0207697_10006128 3300025315 Bacteria 5491
282 Ga0207697_10038761 3300025315 Bacteria 1955
283 Ga0207697_10057560 3300025315 Unclassified 1613
284 Ga0207682_10024567 3300025893 Bacteria 2387
285 Ga0207642_10017992 3300025899 Bacteria 2702
286 Ga0207642_10068913 3300025899 Bacteria 1676
287 Ga0207642_10136903 3300025899 Bacteria 1286
288 Ga0207688_10060838 3300025901 Unclassified 2128
289 Ga0207680_10143608 3300025903 Unclassified 1584
290 Ga0207680_10163231 3300025903 Bacteria 1496
291 Ga0207680_10219551 3300025903 Bacteria 1303
292 Ga0207699_10014775 3300025906 Unclassified 4037
293 Ga0207699_10364920 3300025906 Bacteria 1022
294 Ga0207645_10000354 3300025907 Bacteria 38157
295 Ga0207645_10024656 3300025907 Bacteria 3896
296 Ga0207645_10089634 3300025907 Bacteria 1978
297 Ga0207643_10050573 3300025908 Bacteria 2357
298 Ga0207705_10013458 3300025909 Bacteria 5902
299 Ga0207654_10614520 3300025911 Bacteria 776
300 Ga0207660_10031924 3300025917 Bacteria 3632
301 Ga0207660_10228086 3300025917 Bacteria 1464
302 Ga0207660_10794357 3300025917 Unclassified 772
303 Ga0207662_10024919 3300025918 Bacteria 3444
304 Ga0207662_10353891 3300025918 Unclassified 987
305 Ga0207662_10411405 3300025918 Bacteria 919
306 Ga0207657_10011684 3300025919 Bacteria 8701
307 Ga0207657_10017212 3300025919 Bacteria 6942
308 Ga0207657_10217611 3300025919 Bacteria 1531
309 Ga0207649_10001160 3300025920 Bacteria 15873
310 Ga0207649_10007972 3300025920 Bacteria 5762
311 Ga0207652_10003426 3300025921 Bacteria 13089
312 Ga0207652_10046045 3300025921 Bacteria 3720
313 Ga0207681_10068857 3300025923 Bacteria 2460
314 Ga0207681_10137467 3300025923 Bacteria 1815
315 Ga0207681_10303615 3300025923 Bacteria 1264
316 Ga0207650_10047341 3300025925 Bacteria 3169
317 Ga0207650_10060964 3300025925 Bacteria 2815
318 Ga0207650_10206926 3300025925 Bacteria 1574
319 Ga0207650_10240182 3300025925 Unclassified 1464
320 Ga0207650_10305498 3300025925 Bacteria 1300
321 Ga0207650_10345323 3300025925 Bacteria 1223
322 Ga0207659_10086078 3300025926 Bacteria 2336
323 Ga0207700_10003696 3300025928 Bacteria 8925
324 Ga0207700_10007957 3300025928 Bacteria 6527
325 Ga0207664_10006880 3300025929 Bacteria 7861
326 Ga0207664_10055997 3300025929 Unclassified 3131
327 Ga0207644_10025302 3300025931 Unclassified 4082
328 Ga0207644_10192645 3300025931 Bacteria 1604
329 Ga0207644_10263790 3300025931 Bacteria 1378
330 Ga0207644_10401329 3300025931 Bacteria 1121
331 Ga0207690_10058342 3300025932 Bacteria 2611
332 Ga0207706_10006556 3300025933 Bacteria 10783
333 Ga0207706_10039716 3300025933 Bacteria 4173
334 Ga0207706_10062224 3300025933 Bacteria 3287
335 Ga0207706_10135521 3300025933 Bacteria 2166
336 Ga0207686_10644657 3300025934 Bacteria 837
337 Ga0207670_10141389 3300025936 Unclassified 1775
338 Ga0207670_10165121 3300025936 Bacteria 1656
339 Ga0207669_10271761 3300025937 Bacteria 1273
340 Ga0207669_10395395 3300025937 Bacteria 1081
341 Ga0207704_10044526 3300025938 Bacteria 2630
342 Ga0207704_10071969 3300025938 Unclassified 2196
343 Ga0207704_10135965 3300025938 Unclassified 1711
344 Ga0207704_10191899 3300025938 Bacteria 1487
345 Ga0207704_10565657 3300025938 Bacteria 926
346 Ga0207691_10025231 3300025940 Bacteria 5582
347 Ga0207691_10029719 3300025940 Bacteria 5110
348 Ga0207691_10133234 3300025940 Bacteria 2194
349 Ga0207691_10186480 3300025940 Unclassified 1811
350 Ga0207689_10003402 3300025942 Bacteria 14529
351 Ga0207689_10006527 3300025942 Bacteria 10294
352 Ga0207689_10038084 3300025942 Bacteria 3984
353 Ga0207689_10055671 3300025942 Bacteria 3255
354 Ga0207689_10750374 3300025942 Bacteria 824
355 Ga0207661_10000929 3300025944 Bacteria 19227
356 Ga0207661_10006780 3300025944 Bacteria 8110
357 Ga0207661_10229285 3300025944 Bacteria 1644
358 Ga0207661_10371742 3300025944 Bacteria 1293
359 Ga0207679_10000232 3300025945 Bacteria 43046
360 Ga0207679_10006857 3300025945 Bacteria 7217
361 Ga0207679_10033582 3300025945 Bacteria 3611
362 Ga0207679_10108385 3300025945 Unclassified 2187
363 Ga0207679_10133921 3300025945 Bacteria 1992
364 Ga0207667_10033896 3300025949 Bacteria 5486
365 Ga0207667_10773546 3300025949 Bacteria 958
366 Ga0207651_10028121 3300025960 Bacteria 3542
367 Ga0207651_10052142 3300025960 Bacteria 2788
368 Ga0207651_10393964 3300025960 Bacteria 1176
369 Ga0207712_10014046 3300025961 Bacteria 5140
370 Ga0207712_10031639 3300025961 Bacteria 3566
371 Ga0207712_10145468 3300025961 Bacteria 1824
372 Ga0207712_10279807 3300025961 Unclassified 1361
373 Ga0207712_10316010 3300025961 Bacteria 1287
374 Ga0207712_10491190 3300025961 Bacteria 1048
375 Ga0207668_10050700 3300025972 Unclassified 2862
376 Ga0207668_10053711 3300025972 Bacteria 2793
377 Ga0207668_10739588 3300025972 Unclassified 867
378 Ga0207640_10039254 3300025981 Bacteria 2995
379 Ga0207640_10079812 3300025981 Unclassified 2231
380 Ga0207640_10521139 3300025981 Bacteria 993
381 Ga0207658_10052125 3300025986 Unclassified 3019
382 Ga0207658_10075241 3300025986 Bacteria 2569
383 Ga0207677_10034678 3300026023 Bacteria 3270
384 Ga0207677_10059862 3300026023 Bacteria 2629
385 Ga0207677_10379418 3300026023 Bacteria 1193
386 Ga0207703_10016225 3300026035 Bacteria 5805
387 Ga0207703_10287183 3300026035 Unclassified 1496
388 Ga0207639_10084890 3300026041 Bacteria 2517
389 Ga0207639_10619977 3300026041 Bacteria 999
390 Ga0207678_10451411 3300026067 Bacteria 1117
391 Ga0207708_10219815 3300026075 Unclassified 1522
392 Ga0207708_10466552 3300026075 Bacteria 1054
393 Ga0207708_11064864 3300026075 Bacteria 704
394 Ga0207641_10004439 3300026088 Bacteria 12154
395 Ga0207641_11142859 3300026088 Bacteria 778
396 Ga0207648_10000404 3300026089 Bacteria 48036
397 Ga0207648_10001472 3300026089 Bacteria 25920
398 Ga0207648_10028636 3300026089 Bacteria 4938
399 Ga0207648_10054096 3300026089 Bacteria 3507
400 Ga0207648_10079442 3300026089 Bacteria 2861
401 Ga0207648_10203174 3300026089 Bacteria 1758
402 Ga0207648_10267386 3300026089 Bacteria 1527
403 Ga0207676_10036804 3300026095 Bacteria 3726
404 Ga0207676_10037115 3300026095 Unclassified 3711
405 Ga0207676_10099647 3300026095 Unclassified 2405
406 Ga0207676_10169086 3300026095 Bacteria 1903
407 Ga0207676_10225403 3300026095 Bacteria 1672
408 Ga0207674_10009679 3300026116 Bacteria 10985
409 Ga0207674_10064304 3300026116 Bacteria 3701
410 Ga0207674_10089594 3300026116 Bacteria 3069
411 Ga0207674_10108382 3300026116 Bacteria 2754
412 Ga0207674_10131565 3300026116 Bacteria 2465
413 Ga0207674_10174999 3300026116 Bacteria 2099
414 Ga0207674_10185949 3300026116 Bacteria 2028
415 Ga0207675_100000326 3300026118 Bacteria 45358
416 Ga0207675_100031508 3300026118 Bacteria 4938
417 Ga0207675_100037522 3300026118 Bacteria 4520
418 Ga0207675_100202430 3300026118 Bacteria 1907
419 Ga0207675_100212948 3300026118 Bacteria 1859
420 Ga0207675_100285250 3300026118 Bacteria 1605
421 Ga0207683_10003746 3300026121 Bacteria 13185
422 Ga0207683_10103551 3300026121 Bacteria 2543
423 Ga0207683_10279767 3300026121 Bacteria 1525
424 Ga0207683_10582112 3300026121 Bacteria 1035
425 Ga0207683_10897741 3300026121 Bacteria 823
426 Ga0207698_10017457 3300026142 Bacteria 4870
427 Ga0207698_10074085 3300026142 Bacteria 2714
428 Ga0207698_10628627 3300026142 Bacteria 1061
429 Ga0207428_10152627 3300027907 Bacteria 1757
430 Ga0268266_10067836 3300028379 Bacteria 3088
431 Ga0268266_10101845 3300028379 Bacteria 2532
432 Ga0268266_10777187 3300028379 Bacteria 925
433 Ga0268265_10379755 3300028380 Bacteria 1299
434 Ga0268264_10057356 3300028381 Bacteria 3258
435 Ga0268264_10083705 3300028381 Bacteria 2733
436 Ga0268264_10520434 3300028381 Bacteria 1163
437 Ga0265338_10245687 3300028800 Bacteria 1323
438 Ga0265324_10068561 3300029957 Bacteria 1209
439 Ga0307408_100101076 3300031548 Bacteria 2197
440 Ga0307405_10002560 3300031731 Bacteria 8068
441 Ga0307410_10058893 3300031852 Bacteria 2620
442 Ga0307406_10163752 3300031901 Bacteria 1602
443 Ga0307407_10006466 3300031903 Bacteria 5211
444 Ga0307412_10003625 3300031911 Bacteria 8578
445 Ga0307409_100001406 3300031995 Bacteria 11777
446 Ga0307416_100032115 3300032002 Bacteria 3962
447 Ga0307414_10007419 3300032004 Bacteria 6161
448 Ga0307411_10015740 3300032005 Bacteria 4259
449 Ga0307415_100026187 3300032126 Bacteria 3674
450 Ga0373957_0082100 3300035120 Bacteria 1274
451 Ga0373943_0186318 3300035170 Bacteria 1143
452 Ga0373955_0013680 3300035172 Bacteria 3932
453 Ga0373924_0071536 3300035410 Bacteria 1464
454 Ga0373935_0278617 3300035692 Bacteria 1177
455 Ga0373933_0115285 3300035724 Bacteria 1679
456 Ga0395905_0547333 3300037471 Bacteria 1059
457 Ga0439465_0044047 3300041413 Bacteria 1449
458 Ga0439454_017448 3300042011 Bacteria 1025
459 Ga0453683_0022168 3300044673 Bacteria 4053
460 Ga0453683_0195686 3300044673 Bacteria 1283
461 Ga0453684_0066771 3300044712 Bacteria 4578
462 Ga0453684_0262131 3300044712 Bacteria 1979
463 Ga0466958_0075447 3300045836 Unclassified 2068
464 Ga0466958_0299184 3300045836 Bacteria 1033
465 Ga0466967_0368932 3300045976 Unclassified 1392
466 Ga0495638_0357469 3300046460 Bacteria 769
467 Ga0495653_0349335 3300046463 Bacteria 951
468 Ga0495580_0110566 3300046472 Bacteria 1909
469 Ga0495608_0293909 3300046511 Bacteria 1007
470 Ga0495618_0042877 3300046514 Bacteria 2854
471 Ga0495628_0007334 3300046516 Bacteria 9549
472 Ga0495586_0456934 3300046535 Bacteria 736
473 Ga0495667_0094567 3300046559 Bacteria 1935
474 Ga0495634_0069131 3300046642 Bacteria 2331
475 Ga0495634_0154377 3300046642 Bacteria 1450
476 Ga0495611_0139403 3300046648 Bacteria 1132
477 Ga0495646_0306422 3300046680 Bacteria 839
478 Ga0495658_0442592 3300046683 Bacteria 830
479 Ga0495613_0152615 3300046689 Bacteria 1647
480 Ga0495686_0010384 3300047472 Bacteria 6628
481 Ga0495686_0052545 3300047472 Bacteria 2555
482 Ga0496108_0186759 3300048911 Bacteria 1796
483 Ga0496110_0243398 3300048913 Bacteria 1637
484 Ga0496112_0290570 3300048915 Bacteria 1581
485 Ga0496113_0303869 3300048916 Bacteria 1278
486 Ga0501032_0020511 3300049569 Bacteria 4601
487 Ga0501034_0000410 3300049571 Bacteria 72148
488 Ga0501034_0001945 3300049571 Bacteria 26170
489 Ga0501034_0019303 3300049571 Bacteria 6976
490 Ga0501034_0044164 3300049571 Bacteria 4507
491 Ga0501036_0244603 3300049572 Bacteria 1504
492 Ga0501036_0322616 3300049572 Bacteria 1290
493 Ga0501037_0005753 3300049573 Bacteria 9054
494 Ga0501038_0281584 3300049574 Bacteria 1309
495 Ga0501039_0087577 3300049575 Bacteria 2426
496 Ga0501039_0100013 3300049575 Bacteria 2263
497 Ga0501043_0017443 3300049579 Bacteria 5627
498 Ga0501043_0103058 3300049579 Unclassified 2242
499 Ga0501043_0202002 3300049579 Bacteria 1542
500 Ga0501046_0017485 3300049580 Bacteria 5982
501 Ga0501046_0211024 3300049580 Bacteria 1441
502 Ga0501047_0004355 3300049581 Bacteria 13318
503 Ga0501068_0347262 3300049584 Bacteria 953
504 Ga0501070_0014107 3300049586 Bacteria 6727
505 Ga0501070_0026739 3300049586 Bacteria 4840
506 Ga0501073_0000921 3300049589 Bacteria 21203
507 Ga0501073_0169923 3300049589 Bacteria 1509
508 Ga0501074_0004884 3300049590 Bacteria 9613
509 Ga0501074_0200162 3300049590 Bacteria 1423
510 Ga0501253_059453 3300049683 Bacteria 820
511 Ga0501080_0235331 3300049742 Bacteria 1673
512 Ga0501080_0273625 3300049742 Bacteria 1536
513 Ga0501083_0286170 3300049744 Bacteria 1072
514 Ga0501035_0014708 3300049822 Bacteria 7223
515 Ga0501035_0056449 3300049822 Bacteria 3503
516 Ga0501044_0021107 3300049823 Bacteria 6953
517 Ga0501044_0397333 3300049823 Bacteria 1291
518 Ga0501284_00021 3300050005 Bacteria 89729
519 nmdc:mga0k408_5067_c1 3300050493 Bacteria 6981
520 nmdc:mga09592_20327_c1 3300050508 Bacteria 5458
521 nmdc:mga09592_45558_c1 3300050508 Bacteria 3695
522 nmdc:mga09592_570816_c1 3300050508 Bacteria 971
523 nmdc:mga0qj67_426866_c1 3300050509 Bacteria 1068
524 nmdc:mga0qj67_99517_c1 3300050509 Bacteria 2343
525 nmdc:mga06r32_115302_c1 3300050510 Bacteria 2646
526 nmdc:mga06r32_418268_c1 3300050510 Bacteria 1322
527 nmdc:mga08y16_606717_c1 3300050511 Bacteria 1103
528 nmdc:mga08y16_80503_c1 3300050511 Unclassified 3396
529 nmdc:mga08y16_846821_c1 3300050511 Bacteria 904
530 nmdc:mga0n895_615771_c1 3300050512 Bacteria 1087
531 Ga0500641_0099617 3300053096 Bacteria 1246
532 Ga0500568_0000236 3300053139 Bacteria 47278
533 Ga0500611_000006 3300053727 Bacteria 226069
534 Ga0501082_0671700 3300060353 Unclassified 907

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_100005072 Ga0070714_1000050729 178
2 3300005437 Ga0070710_10019783 Ga0070710_100197831 178
3 3300005563 Ga0068855_100736558 Ga0068855_1007365582 178
4 3300013105 Ga0157369_11216357 Ga0157369_112163571 178
5 3300025906 Ga0207699_10364920 Ga0207699_103649201 178
6 3300025928 Ga0207700_10007957 Ga0207700_100079572 178
7 3300025929 Ga0207664_10006880 Ga0207664_100068809 178
8 3300025949 Ga0207667_10773546 Ga0207667_107735462 178
9 3300050508 nmdc:mga09592_570816_c1 nmdc:mga09592_570816_c1_397_933 178
10 3300013104 Ga0157370_10779300 Ga0157370_107793001 187
11 3300049569 Ga0501032_0020511 Ga0501032_0020511_3531_4145 187
12 3300049571 Ga0501034_0001945 Ga0501034_0001945_4098_4712 187
13 3300049573 Ga0501037_0005753 Ga0501037_0005753_4256_4870 187
14 3300049575 Ga0501039_0100013 Ga0501039_0100013_163_777 187
15 3300049579 Ga0501043_0017443 Ga0501043_0017443_3846_4460 187
16 3300049822 Ga0501035_0056449 Ga0501035_0056449_168_782 187
17 3300049823 Ga0501044_0021107 Ga0501044_0021107_3855_4469 187
18 3300005435 Ga0070714_100010482 Ga0070714_1000104825 188
19 3300006028 Ga0070717_10000765 Ga0070717_1000076512 188
20 3300025929 Ga0207664_10055997 Ga0207664_100559971 188
21 3300005434 Ga0070709_10049639 Ga0070709_100496392 189
22 3300025906 Ga0207699_10014775 Ga0207699_100147753 189
23 3300025928 Ga0207700_10003696 Ga0207700_100036964 189
24 3300005355 Ga0070671_100293403 Ga0070671_1002934031 191
25 3300005367 Ga0070667_100076041 Ga0070667_1000760413 191
26 3300005543 Ga0070672_100460744 Ga0070672_1004607441 191
27 3300005617 Ga0068859_100286702 Ga0068859_1002867022 191
28 3300005841 Ga0068863_100093749 Ga0068863_1000937492 191
29 3300005842 Ga0068858_100216438 Ga0068858_1002164382 191
30 3300006881 Ga0068865_100031844 Ga0068865_1000318442 191
31 3300006931 Ga0097620_100286709 Ga0097620_1002867092 191
32 3300013306 Ga0163162_10653690 Ga0163162_106536902 191
33 3300014968 Ga0157379_10796989 Ga0157379_107969892 191
34 3300017792 Ga0163161_10272871 Ga0163161_102728712 191
35 3300025986 Ga0207658_10052125 Ga0207658_100521252 191
36 3300046472 Ga0495580_0110566 Ga0495580_0110566_331_945 194
37 3300017792 Ga0163161_10208540 Ga0163161_102085402 195
38 3300035120 Ga0373957_0082100 Ga0373957_0082100_599_1213 195
39 3300035170 Ga0373943_0186318 Ga0373943_0186318_328_942 195
40 3300035172 Ga0373955_0013680 Ga0373955_0013680_1511_2125 195
41 3300035410 Ga0373924_0071536 Ga0373924_0071536_17_631 195
42 3300035692 Ga0373935_0278617 Ga0373935_0278617_307_921 195
43 3300035724 Ga0373933_0115285 Ga0373933_0115285_283_897 195
44 3300046463 Ga0495653_0349335 Ga0495653_0349335_289_903 195
45 3300046511 Ga0495608_0293909 Ga0495608_0293909_344_958 195
46 3300046514 Ga0495618_0042877 Ga0495618_0042877_318_932 195
47 3300046516 Ga0495628_0007334 Ga0495628_0007334_549_1163 195
48 3300046535 Ga0495586_0456934 Ga0495586_0456934_55_669 195
49 3300046559 Ga0495667_0094567 Ga0495667_0094567_711_1325 195
50 3300046642 Ga0495634_0069131 Ga0495634_0069131_1417_2031 195
51 3300046680 Ga0495646_0306422 Ga0495646_0306422_47_661 195
52 3300046689 Ga0495613_0152615 Ga0495613_0152615_929_1543 195
53 3300026121 Ga0207683_10279767 Ga0207683_102797672 196
54 3300009553 Ga0105249_10124188 Ga0105249_101241883 199
55 3300005719 Ga0068861_100766819 Ga0068861_1007668192 200
56 3300005841 Ga0068863_100003170 Ga0068863_10000317012 200
57 3300013306 Ga0163162_10296717 Ga0163162_102967171 200
58 3300026035 Ga0207703_10287183 Ga0207703_102871832 200
59 3300026088 Ga0207641_10004439 Ga0207641_100044393 200
60 3300006237 Ga0097621_100256057 Ga0097621_1002560572 202
61 3300014969 Ga0157376_10378283 Ga0157376_103782832 202
62 3300005331 Ga0070670_100909115 Ga0070670_1009091151 203
63 3300005459 Ga0068867_100175873 Ga0068867_1001758731 203
64 3300005616 Ga0068852_101105083 Ga0068852_1011050832 203
65 3300006237 Ga0097621_100451145 Ga0097621_1004511452 203
66 3300013102 Ga0157371_10037665 Ga0157371_100376652 203
67 3300013105 Ga0157369_10358010 Ga0157369_103580102 203
68 3300013297 Ga0157378_10102451 Ga0157378_101024512 203
69 3300013307 Ga0157372_10357028 Ga0157372_103570282 203
70 3300014325 Ga0163163_10560485 Ga0163163_105604852 203
71 3300026095 Ga0207676_10036804 Ga0207676_100368044 203
72 3300026121 Ga0207683_10103551 Ga0207683_101035513 203
73 3300031548 Ga0307408_100101076 Ga0307408_1001010762 203
74 3300031731 Ga0307405_10002560 Ga0307405_100025603 203
75 3300031852 Ga0307410_10058893 Ga0307410_100588932 203
76 3300031903 Ga0307407_10006466 Ga0307407_100064664 203
77 3300031911 Ga0307412_10003625 Ga0307412_100036257 203
78 3300031995 Ga0307409_100001406 Ga0307409_1000014062 203
79 3300032002 Ga0307416_100032115 Ga0307416_1000321152 203
80 3300032004 Ga0307414_10007419 Ga0307414_100074192 203
81 3300032005 Ga0307411_10015740 Ga0307411_100157403 203
82 3300032126 Ga0307415_100026187 Ga0307415_1000261873 203
83 3300037471 Ga0395905_0547333 Ga0395905_0547333_134_820 203
84 3300045836 Ga0466958_0075447 Ga0466958_0075447_679_1389 203
85 3300060353 Ga0501082_0671700 Ga0501082_0671700_47_715 203
86 3300002459 JGI24751J29686_10002322 JGI24751J29686_100023225 204
87 3300002459 JGI24751J29686_10002413 JGI24751J29686_100024132 204
88 3300005290 Ga0065712_10162696 Ga0065712_101626962 204
89 3300005290 Ga0065712_10188549 Ga0065712_101885491 204
90 3300005329 Ga0070683_100002306 Ga0070683_10000230610 204
91 3300005329 Ga0070683_100015970 Ga0070683_1000159702 204
92 3300005329 Ga0070683_100626400 Ga0070683_1006264002 204
93 3300005330 Ga0070690_100024488 Ga0070690_1000244882 204
94 3300005330 Ga0070690_100050564 Ga0070690_1000505642 204
95 3300005331 Ga0070670_100009051 Ga0070670_1000090512 204
96 3300005331 Ga0070670_100021498 Ga0070670_1000214986 204
97 3300005334 Ga0068869_100069906 Ga0068869_1000699062 204
98 3300005335 Ga0070666_10038111 Ga0070666_100381112 204
99 3300005335 Ga0070666_10170691 Ga0070666_101706912 204
100 3300005337 Ga0070682_100072795 Ga0070682_1000727952 204
101 3300005338 Ga0068868_100001063 Ga0068868_10000106312 204
102 3300005338 Ga0068868_100022140 Ga0068868_1000221402 204
103 3300005338 Ga0068868_100046819 Ga0068868_1000468192 204
104 3300005340 Ga0070689_100005751 Ga0070689_1000057512 204
105 3300005340 Ga0070689_100025849 Ga0070689_1000258493 204
106 3300005344 Ga0070661_100000802 Ga0070661_1000008027 204
107 3300005344 Ga0070661_100009511 Ga0070661_1000095119 204
108 3300005344 Ga0070661_100368769 Ga0070661_1003687691 204
109 3300005344 Ga0070661_100389609 Ga0070661_1003896091 204
110 3300005353 Ga0070669_100096418 Ga0070669_1000964182 204
111 3300005354 Ga0070675_100180745 Ga0070675_1001807452 204
112 3300005355 Ga0070671_100067658 Ga0070671_1000676583 204
113 3300005355 Ga0070671_100387595 Ga0070671_1003875951 204
114 3300005355 Ga0070671_100770217 Ga0070671_1007702171 204
115 3300005364 Ga0070673_100042077 Ga0070673_1000420771 204
116 3300005365 Ga0070688_100037062 Ga0070688_1000370622 204
117 3300005365 Ga0070688_100139119 Ga0070688_1001391192 204
118 3300005365 Ga0070688_100338672 Ga0070688_1003386722 204
119 3300005366 Ga0070659_100036423 Ga0070659_1000364232 204
120 3300005367 Ga0070667_100059799 Ga0070667_1000597992 204
121 3300005367 Ga0070667_100579431 Ga0070667_1005794311 204
122 3300005441 Ga0070700_100076647 Ga0070700_1000766472 204
123 3300005455 Ga0070663_100421686 Ga0070663_1004216862 204
124 3300005456 Ga0070678_100044598 Ga0070678_1000445983 204
125 3300005456 Ga0070678_100090873 Ga0070678_1000908731 204
126 3300005456 Ga0070678_100225066 Ga0070678_1002250662 204
127 3300005457 Ga0070662_100058094 Ga0070662_1000580943 204
128 3300005457 Ga0070662_100306787 Ga0070662_1003067872 204
129 3300005459 Ga0068867_100139779 Ga0068867_1001397792 204
130 3300005459 Ga0068867_100359336 Ga0068867_1003593362 204
131 3300005466 Ga0070685_10031385 Ga0070685_100313852 204
132 3300005466 Ga0070685_10042854 Ga0070685_100428543 204
133 3300005535 Ga0070684_100000772 Ga0070684_10000077215 204
134 3300005535 Ga0070684_100004165 Ga0070684_1000041659 204
135 3300005535 Ga0070684_100245603 Ga0070684_1002456032 204
136 3300005535 Ga0070684_101192523 Ga0070684_1011925231 204
137 3300005539 Ga0068853_100001075 Ga0068853_10000107513 204
138 3300005544 Ga0070686_100007568 Ga0070686_1000075683 204
139 3300005548 Ga0070665_100130277 Ga0070665_1001302772 204
140 3300005564 Ga0070664_100000505 Ga0070664_10000050521 204
141 3300005564 Ga0070664_100004719 Ga0070664_10000471916 204
142 3300005564 Ga0070664_100033251 Ga0070664_1000332512 204
143 3300005564 Ga0070664_100052458 Ga0070664_1000524582 204
144 3300005577 Ga0068857_100001366 Ga0068857_1000013663 204
145 3300005577 Ga0068857_100033074 Ga0068857_1000330746 204
146 3300005577 Ga0068857_100049806 Ga0068857_1000498062 204
147 3300005577 Ga0068857_100120401 Ga0068857_1001204012 204
148 3300005577 Ga0068857_100209665 Ga0068857_1002096652 204
149 3300005578 Ga0068854_100049621 Ga0068854_1000496213 204
150 3300005615 Ga0070702_100020388 Ga0070702_1000203882 204
151 3300005616 Ga0068852_100188844 Ga0068852_1001888442 204
152 3300005617 Ga0068859_100083156 Ga0068859_1000831562 204
153 3300005617 Ga0068859_100088006 Ga0068859_1000880062 204
154 3300005617 Ga0068859_101498420 Ga0068859_1014984201 204
155 3300005618 Ga0068864_100122411 Ga0068864_1001224112 204
156 3300005618 Ga0068864_100200539 Ga0068864_1002005392 204
157 3300005718 Ga0068866_10080201 Ga0068866_100802012 204
158 3300005719 Ga0068861_100048731 Ga0068861_1000487312 204
159 3300005834 Ga0068851_10142565 Ga0068851_101425652 204
160 3300005842 Ga0068858_100039810 Ga0068858_1000398103 204
161 3300005843 Ga0068860_100485410 Ga0068860_1004854102 204
162 3300005844 Ga0068862_100099088 Ga0068862_1000990883 204
163 3300005985 Ga0081539_10000916 Ga0081539_1000091655 204
164 3300005985 Ga0081539_10018471 Ga0081539_100184713 204
165 3300006237 Ga0097621_100059062 Ga0097621_1000590622 204
166 3300006358 Ga0068871_100085730 Ga0068871_1000857303 204
167 3300006847 Ga0075431_100005665 Ga0075431_1000056652 204
168 3300006880 Ga0075429_100033309 Ga0075429_1000333093 204
169 3300006880 Ga0075429_100535019 Ga0075429_1005350192 204
170 3300006931 Ga0097620_100083165 Ga0097620_1000831652 204
171 3300006931 Ga0097620_100088009 Ga0097620_1000880092 204
172 3300006931 Ga0097620_101498471 Ga0097620_1014984711 204
173 3300009094 Ga0111539_10082802 Ga0111539_100828023 204
174 3300009094 Ga0111539_10688375 Ga0111539_106883752 204
175 3300009101 Ga0105247_10052519 Ga0105247_100525193 204
176 3300009147 Ga0114129_10156929 Ga0114129_101569293 204
177 3300009174 Ga0105241_10307920 Ga0105241_103079202 204
178 3300009176 Ga0105242_10167445 Ga0105242_101674452 204
179 3300009176 Ga0105242_10184072 Ga0105242_101840722 204
180 3300009553 Ga0105249_10010436 Ga0105249_100104361 204
181 3300009553 Ga0105249_10069048 Ga0105249_100690482 204
182 3300009553 Ga0105249_10988377 Ga0105249_109883772 204
183 3300010375 Ga0105239_10137513 Ga0105239_101375132 204
184 3300010375 Ga0105239_11598967 Ga0105239_115989671 204
185 3300011119 Ga0105246_10046086 Ga0105246_100460862 204
186 3300013100 Ga0157373_10031460 Ga0157373_100314602 204
187 3300013104 Ga0157370_10043995 Ga0157370_100439952 204
188 3300013296 Ga0157374_10002918 Ga0157374_100029185 204
189 3300013296 Ga0157374_10007884 Ga0157374_100078848 204
190 3300013296 Ga0157374_10129203 Ga0157374_101292032 204
191 3300013296 Ga0157374_10209760 Ga0157374_102097602 204
192 3300013297 Ga0157378_10014153 Ga0157378_100141534 204
193 3300013297 Ga0157378_10341093 Ga0157378_103410932 204
194 3300013297 Ga0157378_11480574 Ga0157378_114805741 204
195 3300013306 Ga0163162_10025708 Ga0163162_100257083 204
196 3300013306 Ga0163162_10065714 Ga0163162_100657142 204
197 3300013306 Ga0163162_10092054 Ga0163162_100920543 204
198 3300013306 Ga0163162_10128999 Ga0163162_101289992 204
199 3300013307 Ga0157372_10265586 Ga0157372_102655862 204
200 3300013308 Ga0157375_10011610 Ga0157375_100116102 204
201 3300013308 Ga0157375_10141767 Ga0157375_101417672 204
202 3300014325 Ga0163163_10008995 Ga0163163_100089954 204
203 3300014325 Ga0163163_10093924 Ga0163163_100939242 204
204 3300014325 Ga0163163_10154925 Ga0163163_101549252 204
205 3300014325 Ga0163163_10376488 Ga0163163_103764882 204
206 3300014326 Ga0157380_10043757 Ga0157380_100437571 204
207 3300014326 Ga0157380_10265396 Ga0157380_102653961 204
208 3300014326 Ga0157380_10505120 Ga0157380_105051201 204
209 3300014745 Ga0157377_10003612 Ga0157377_100036121 204
210 3300014745 Ga0157377_10006329 Ga0157377_100063294 204
211 3300014745 Ga0157377_10052824 Ga0157377_100528242 204
212 3300014968 Ga0157379_10021385 Ga0157379_100213856 204
213 3300014968 Ga0157379_10024716 Ga0157379_100247164 204
214 3300014968 Ga0157379_10043900 Ga0157379_100439002 204
215 3300014969 Ga0157376_10015885 Ga0157376_100158853 204
216 3300014969 Ga0157376_10509298 Ga0157376_105092982 204
217 3300017792 Ga0163161_10002549 Ga0163161_100025494 204
218 3300017792 Ga0163161_10145664 Ga0163161_101456642 204
219 3300017792 Ga0163161_10420719 Ga0163161_104207192 204
220 3300025315 Ga0207697_10057560 Ga0207697_100575602 204
221 3300025899 Ga0207642_10136903 Ga0207642_101369031 204
222 3300025901 Ga0207688_10060838 Ga0207688_100608382 204
223 3300025903 Ga0207680_10143608 Ga0207680_101436082 204
224 3300025903 Ga0207680_10219551 Ga0207680_102195512 204
225 3300025907 Ga0207645_10024656 Ga0207645_100246564 204
226 3300025911 Ga0207654_10614520 Ga0207654_106145201 204
227 3300025918 Ga0207662_10024919 Ga0207662_100249192 204
228 3300025918 Ga0207662_10353891 Ga0207662_103538912 204
229 3300025918 Ga0207662_10411405 Ga0207662_104114052 204
230 3300025920 Ga0207649_10001160 Ga0207649_100011605 204
231 3300025920 Ga0207649_10007972 Ga0207649_100079723 204
232 3300025923 Ga0207681_10068857 Ga0207681_100688572 204
233 3300025923 Ga0207681_10303615 Ga0207681_103036152 204
234 3300025925 Ga0207650_10047341 Ga0207650_100473412 204
235 3300025926 Ga0207659_10086078 Ga0207659_100860782 204
236 3300025931 Ga0207644_10025302 Ga0207644_100253022 204
237 3300025931 Ga0207644_10263790 Ga0207644_102637902 204
238 3300025931 Ga0207644_10401329 Ga0207644_104013292 204
239 3300025933 Ga0207706_10006556 Ga0207706_1000655615 204
240 3300025933 Ga0207706_10039716 Ga0207706_100397164 204
241 3300025933 Ga0207706_10062224 Ga0207706_100622243 204
242 3300025934 Ga0207686_10644657 Ga0207686_106446571 204
243 3300025936 Ga0207670_10141389 Ga0207670_101413892 204
244 3300025938 Ga0207704_10071969 Ga0207704_100719692 204
245 3300025938 Ga0207704_10135965 Ga0207704_101359651 204
246 3300025940 Ga0207691_10186480 Ga0207691_101864802 204
247 3300025942 Ga0207689_10055671 Ga0207689_100556713 204
248 3300025944 Ga0207661_10000929 Ga0207661_1000092914 204
249 3300025944 Ga0207661_10006780 Ga0207661_100067809 204
250 3300025944 Ga0207661_10229285 Ga0207661_102292851 204
251 3300025945 Ga0207679_10000232 Ga0207679_1000023215 204
252 3300025945 Ga0207679_10006857 Ga0207679_100068575 204
253 3300025945 Ga0207679_10033582 Ga0207679_100335823 204
254 3300025945 Ga0207679_10108385 Ga0207679_101083851 204
255 3300025960 Ga0207651_10028121 Ga0207651_100281214 204
256 3300025961 Ga0207712_10031639 Ga0207712_100316392 204
257 3300025961 Ga0207712_10145468 Ga0207712_101454681 204
258 3300025961 Ga0207712_10279807 Ga0207712_102798071 204
259 3300025961 Ga0207712_10491190 Ga0207712_104911902 204
260 3300025972 Ga0207668_10739588 Ga0207668_107395881 204
261 3300025981 Ga0207640_10039254 Ga0207640_100392542 204
262 3300025981 Ga0207640_10079812 Ga0207640_100798122 204
263 3300026023 Ga0207677_10034678 Ga0207677_100346784 204
264 3300026023 Ga0207677_10059862 Ga0207677_100598622 204
265 3300026023 Ga0207677_10379418 Ga0207677_103794181 204
266 3300026035 Ga0207703_10016225 Ga0207703_100162252 204
267 3300026041 Ga0207639_10084890 Ga0207639_100848902 204
268 3300026067 Ga0207678_10451411 Ga0207678_104514112 204
269 3300026075 Ga0207708_11064864 Ga0207708_110648641 204
270 3300026089 Ga0207648_10054096 Ga0207648_100540963 204
271 3300026089 Ga0207648_10079442 Ga0207648_100794422 204
272 3300026095 Ga0207676_10037115 Ga0207676_100371154 204
273 3300026095 Ga0207676_10169086 Ga0207676_101690863 204
274 3300026095 Ga0207676_10225403 Ga0207676_102254032 204
275 3300026116 Ga0207674_10009679 Ga0207674_1000967913 204
276 3300026116 Ga0207674_10131565 Ga0207674_101315652 204
277 3300026116 Ga0207674_10174999 Ga0207674_101749991 204
278 3300026116 Ga0207674_10185949 Ga0207674_101859492 204
279 3300026118 Ga0207675_100031508 Ga0207675_1000315082 204
280 3300026118 Ga0207675_100202430 Ga0207675_1002024302 204
281 3300026142 Ga0207698_10074085 Ga0207698_100740853 204
282 3300027907 Ga0207428_10152627 Ga0207428_101526271 204
283 3300028379 Ga0268266_10067836 Ga0268266_100678362 204
284 3300028380 Ga0268265_10379755 Ga0268265_103797552 204
285 3300028381 Ga0268264_10057356 Ga0268264_100573562 204
286 3300028381 Ga0268264_10520434 Ga0268264_105204342 204
287 3300028800 Ga0265338_10245687 Ga0265338_102456872 204
288 3300029957 Ga0265324_10068561 Ga0265324_100685612 204
289 3300045836 Ga0466958_0299184 Ga0466958_0299184_213_896 204
290 3300045976 Ga0466967_0368932 Ga0466967_0368932_47_730 204
291 3300046642 Ga0495634_0154377 Ga0495634_0154377_692_1306 204
292 3300046683 Ga0495658_0442592 Ga0495658_0442592_155_769 204
293 3300048913 Ga0496110_0243398 Ga0496110_0243398_68_682 204
294 3300048915 Ga0496112_0290570 Ga0496112_0290570_891_1505 204
295 3300048916 Ga0496113_0303869 Ga0496113_0303869_190_804 204
296 3300049571 Ga0501034_0000410 Ga0501034_0000410_34847_35461 204
297 3300049683 Ga0501253_059453 Ga0501253_059453_154_768 204
298 3300050005 Ga0501284_00021 Ga0501284_00021_27227_27847 204
299 3300050508 nmdc:mga09592_20327_c1 nmdc:mga09592_20327_c1_2279_2896 204
300 3300050509 nmdc:mga0qj67_426866_c1 nmdc:mga0qj67_426866_c1_61_678 204
301 3300050510 nmdc:mga06r32_115302_c1 nmdc:mga06r32_115302_c1_1769_2386 204
302 3300050511 nmdc:mga08y16_80503_c1 nmdc:mga08y16_80503_c1_1691_2305 204
303 3300050512 nmdc:mga0n895_615771_c1 nmdc:mga0n895_615771_c1_419_1033 204
304 3300001915 JGI24741J21665_1025945 JGI24741J21665_10259452 205
305 3300005290 Ga0065712_10004787 Ga0065712_100047873 205
306 3300005293 Ga0065715_10268983 Ga0065715_102689832 205
307 3300005327 Ga0070658_10069542 Ga0070658_100695423 205
308 3300005327 Ga0070658_10608070 Ga0070658_106080702 205
309 3300005328 Ga0070676_10155725 Ga0070676_101557253 205
310 3300005331 Ga0070670_100108407 Ga0070670_1001084074 205
311 3300005331 Ga0070670_100287097 Ga0070670_1002870971 205
312 3300005331 Ga0070670_100506809 Ga0070670_1005068092 205
313 3300005334 Ga0068869_100028430 Ga0068869_1000284303 205
314 3300005334 Ga0068869_100049314 Ga0068869_1000493142 205
315 3300005334 Ga0068869_100057141 Ga0068869_1000571413 205
316 3300005335 Ga0070666_10138750 Ga0070666_101387502 205
317 3300005336 Ga0070680_100017166 Ga0070680_1000171664 205
318 3300005336 Ga0070680_100052453 Ga0070680_1000524534 205
319 3300005336 Ga0070680_100076714 Ga0070680_1000767143 205
320 3300005336 Ga0070680_100347752 Ga0070680_1003477522 205
321 3300005340 Ga0070689_100019100 Ga0070689_1000191005 205
322 3300005347 Ga0070668_100010520 Ga0070668_1000105205 205
323 3300005347 Ga0070668_100015099 Ga0070668_1000150992 205
324 3300005347 Ga0070668_100111849 Ga0070668_1001118492 205
325 3300005353 Ga0070669_100009067 Ga0070669_1000090676 205
326 3300005354 Ga0070675_100067460 Ga0070675_1000674602 205
327 3300005356 Ga0070674_100056846 Ga0070674_1000568463 205
328 3300005356 Ga0070674_100434418 Ga0070674_1004344181 205
329 3300005356 Ga0070674_100556451 Ga0070674_1005564511 205
330 3300005365 Ga0070688_100005900 Ga0070688_1000059009 205
331 3300005366 Ga0070659_100053443 Ga0070659_1000534431 205
332 3300005367 Ga0070667_100085594 Ga0070667_1000855942 205
333 3300005367 Ga0070667_100903978 Ga0070667_1009039781 205
334 3300005441 Ga0070700_100370111 Ga0070700_1003701113 205
335 3300005456 Ga0070678_100622884 Ga0070678_1006228841 205
336 3300005457 Ga0070662_100013468 Ga0070662_1000134682 205
337 3300005458 Ga0070681_10159026 Ga0070681_101590262 205
338 3300005458 Ga0070681_10316972 Ga0070681_103169721 205
339 3300005459 Ga0068867_100211334 Ga0068867_1002113342 205
340 3300005459 Ga0068867_100490808 Ga0068867_1004908082 205
341 3300005459 Ga0068867_100703725 Ga0068867_1007037251 205
342 3300005466 Ga0070685_10142639 Ga0070685_101426392 205
343 3300005471 Ga0070698_100005585 Ga0070698_10000558517 205
344 3300005471 Ga0070698_100005948 Ga0070698_1000059489 205
345 3300005471 Ga0070698_100066526 Ga0070698_1000665262 205
346 3300005530 Ga0070679_100001469 Ga0070679_10000146927 205
347 3300005530 Ga0070679_100821684 Ga0070679_1008216841 205
348 3300005539 Ga0068853_100053760 Ga0068853_1000537604 205
349 3300005539 Ga0068853_100218425 Ga0068853_1002184252 205
350 3300005543 Ga0070672_100016283 Ga0070672_1000162833 205
351 3300005548 Ga0070665_100021077 Ga0070665_1000210778 205
352 3300005563 Ga0068855_100211766 Ga0068855_1002117662 205
353 3300005564 Ga0070664_100406310 Ga0070664_1004063102 205
354 3300005577 Ga0068857_100099080 Ga0068857_1000990803 205
355 3300005616 Ga0068852_100004584 Ga0068852_1000045843 205
356 3300005616 Ga0068852_100298341 Ga0068852_1002983412 205
357 3300005617 Ga0068859_100027214 Ga0068859_1000272144 205
358 3300005617 Ga0068859_100985732 Ga0068859_1009857322 205
359 3300005618 Ga0068864_100054711 Ga0068864_1000547112 205
360 3300005718 Ga0068866_10023531 Ga0068866_100235315 205
361 3300005719 Ga0068861_100003722 Ga0068861_1000037225 205
362 3300005719 Ga0068861_100133990 Ga0068861_1001339902 205
363 3300005719 Ga0068861_100135016 Ga0068861_1001350162 205
364 3300005840 Ga0068870_10278515 Ga0068870_102785151 205
365 3300005843 Ga0068860_100082198 Ga0068860_1000821983 205
366 3300005843 Ga0068860_100137258 Ga0068860_1001372582 205
367 3300005844 Ga0068862_100001846 Ga0068862_10000184614 205
368 3300005844 Ga0068862_100067354 Ga0068862_1000673543 205
369 3300006195 Ga0075366_10015790 Ga0075366_100157902 205
370 3300006237 Ga0097621_100061557 Ga0097621_1000615572 205
371 3300006358 Ga0068871_100048000 Ga0068871_1000480002 205
372 3300006844 Ga0075428_100043655 Ga0075428_1000436553 205
373 3300006844 Ga0075428_100429517 Ga0075428_1004295172 205
374 3300006846 Ga0075430_100064504 Ga0075430_1000645043 205
375 3300006847 Ga0075431_100115808 Ga0075431_1001158082 205
376 3300006880 Ga0075429_100014673 Ga0075429_1000146734 205
377 3300006880 Ga0075429_100081129 Ga0075429_1000811293 205
378 3300006881 Ga0068865_100065129 Ga0068865_1000651292 205
379 3300006881 Ga0068865_100548662 Ga0068865_1005486621 205
380 3300006931 Ga0097620_100027213 Ga0097620_1000272135 205
381 3300006931 Ga0097620_100985940 Ga0097620_1009859402 205
382 3300009094 Ga0111539_10015995 Ga0111539_100159958 205
383 3300009094 Ga0111539_10059808 Ga0111539_100598082 205
384 3300009148 Ga0105243_10135634 Ga0105243_101356342 205
385 3300009176 Ga0105242_10030519 Ga0105242_100305193 205
386 3300009176 Ga0105242_10259437 Ga0105242_102594372 205
387 3300009553 Ga0105249_10029655 Ga0105249_100296555 205
388 3300011119 Ga0105246_10020025 Ga0105246_100200251 205
389 3300013100 Ga0157373_10030138 Ga0157373_100301382 205
390 3300013102 Ga0157371_10014381 Ga0157371_100143815 205
391 3300013102 Ga0157371_10028755 Ga0157371_100287551 205
392 3300013102 Ga0157371_10037897 Ga0157371_100378971 205
393 3300013102 Ga0157371_10095424 Ga0157371_100954241 205
394 3300013102 Ga0157371_10125194 Ga0157371_101251942 205
395 3300013102 Ga0157371_10197921 Ga0157371_101979212 205
396 3300013102 Ga0157371_10326975 Ga0157371_103269751 205
397 3300013104 Ga0157370_10000263 Ga0157370_1000026373 205
398 3300013105 Ga0157369_10018964 Ga0157369_100189646 205
399 3300013105 Ga0157369_10144839 Ga0157369_101448392 205
400 3300013296 Ga0157374_10109889 Ga0157374_101098893 205
401 3300013297 Ga0157378_10012333 Ga0157378_100123338 205
402 3300013306 Ga0163162_10080280 Ga0163162_100802803 205
403 3300013306 Ga0163162_10136894 Ga0163162_101368942 205
404 3300013306 Ga0163162_10157430 Ga0163162_101574302 205
405 3300013307 Ga0157372_10044971 Ga0157372_100449711 205
406 3300013307 Ga0157372_10482006 Ga0157372_104820062 205
407 3300013307 Ga0157372_10699044 Ga0157372_106990441 205
408 3300013307 Ga0157372_10730537 Ga0157372_107305371 205
409 3300013307 Ga0157372_11199257 Ga0157372_111992572 205
410 3300013308 Ga0157375_10155364 Ga0157375_101553642 205
411 3300014326 Ga0157380_10020317 Ga0157380_100203176 205
412 3300014326 Ga0157380_10253112 Ga0157380_102531121 205
413 3300014968 Ga0157379_10071364 Ga0157379_100713642 205
414 3300017792 Ga0163161_10012223 Ga0163161_100122233 205
415 3300025315 Ga0207697_10006128 Ga0207697_100061281 205
416 3300025315 Ga0207697_10038761 Ga0207697_100387611 205
417 3300025893 Ga0207682_10024567 Ga0207682_100245672 205
418 3300025899 Ga0207642_10017992 Ga0207642_100179921 205
419 3300025899 Ga0207642_10068913 Ga0207642_100689131 205
420 3300025903 Ga0207680_10163231 Ga0207680_101632312 205
421 3300025907 Ga0207645_10000354 Ga0207645_1000035427 205
422 3300025907 Ga0207645_10089634 Ga0207645_100896342 205
423 3300025908 Ga0207643_10050573 Ga0207643_100505732 205
424 3300025909 Ga0207705_10013458 Ga0207705_100134583 205
425 3300025917 Ga0207660_10031924 Ga0207660_100319242 205
426 3300025917 Ga0207660_10228086 Ga0207660_102280862 205
427 3300025917 Ga0207660_10794357 Ga0207660_107943571 205
428 3300025919 Ga0207657_10011684 Ga0207657_100116846 205
429 3300025919 Ga0207657_10017212 Ga0207657_100172123 205
430 3300025919 Ga0207657_10217611 Ga0207657_102176112 205
431 3300025921 Ga0207652_10003426 Ga0207652_100034261 205
432 3300025921 Ga0207652_10046045 Ga0207652_100460452 205
433 3300025923 Ga0207681_10137467 Ga0207681_101374673 205
434 3300025925 Ga0207650_10060964 Ga0207650_100609642 205
435 3300025925 Ga0207650_10206926 Ga0207650_102069262 205
436 3300025925 Ga0207650_10240182 Ga0207650_102401822 205
437 3300025925 Ga0207650_10305498 Ga0207650_103054982 205
438 3300025925 Ga0207650_10345323 Ga0207650_103453232 205
439 3300025931 Ga0207644_10192645 Ga0207644_101926452 205
440 3300025932 Ga0207690_10058342 Ga0207690_100583423 205
441 3300025933 Ga0207706_10135521 Ga0207706_101355212 205
442 3300025936 Ga0207670_10165121 Ga0207670_101651212 205
443 3300025937 Ga0207669_10271761 Ga0207669_102717612 205
444 3300025937 Ga0207669_10395395 Ga0207669_103953952 205
445 3300025938 Ga0207704_10044526 Ga0207704_100445263 205
446 3300025938 Ga0207704_10191899 Ga0207704_101918992 205
447 3300025938 Ga0207704_10565657 Ga0207704_105656571 205
448 3300025940 Ga0207691_10025231 Ga0207691_100252316 205
449 3300025940 Ga0207691_10029719 Ga0207691_100297195 205
450 3300025940 Ga0207691_10133234 Ga0207691_101332341 205
451 3300025942 Ga0207689_10003402 Ga0207689_1000340211 205
452 3300025942 Ga0207689_10006527 Ga0207689_100065278 205
453 3300025942 Ga0207689_10038084 Ga0207689_100380842 205
454 3300025942 Ga0207689_10750374 Ga0207689_107503741 205
455 3300025944 Ga0207661_10371742 Ga0207661_103717422 205
456 3300025945 Ga0207679_10133921 Ga0207679_101339213 205
457 3300025949 Ga0207667_10033896 Ga0207667_100338963 205
458 3300025960 Ga0207651_10052142 Ga0207651_100521422 205
459 3300025960 Ga0207651_10393964 Ga0207651_103939642 205
460 3300025961 Ga0207712_10014046 Ga0207712_100140465 205
461 3300025961 Ga0207712_10316010 Ga0207712_103160102 205
462 3300025972 Ga0207668_10050700 Ga0207668_100507003 205
463 3300025972 Ga0207668_10053711 Ga0207668_100537113 205
464 3300025981 Ga0207640_10521139 Ga0207640_105211392 205
465 3300025986 Ga0207658_10075241 Ga0207658_100752412 205
466 3300026041 Ga0207639_10619977 Ga0207639_106199771 205
467 3300026075 Ga0207708_10219815 Ga0207708_102198152 205
468 3300026075 Ga0207708_10466552 Ga0207708_104665522 205
469 3300026088 Ga0207641_11142859 Ga0207641_111428591 205
470 3300026089 Ga0207648_10000404 Ga0207648_1000040432 205
471 3300026089 Ga0207648_10001472 Ga0207648_1000147221 205
472 3300026089 Ga0207648_10028636 Ga0207648_100286364 205
473 3300026089 Ga0207648_10203174 Ga0207648_102031742 205
474 3300026089 Ga0207648_10267386 Ga0207648_102673862 205
475 3300026095 Ga0207676_10099647 Ga0207676_100996472 205
476 3300026116 Ga0207674_10064304 Ga0207674_100643042 205
477 3300026116 Ga0207674_10089594 Ga0207674_100895943 205
478 3300026116 Ga0207674_10108382 Ga0207674_101083822 205
479 3300026118 Ga0207675_100000326 Ga0207675_10000032624 205
480 3300026118 Ga0207675_100037522 Ga0207675_1000375227 205
481 3300026118 Ga0207675_100212948 Ga0207675_1002129482 205
482 3300026118 Ga0207675_100285250 Ga0207675_1002852502 205
483 3300026121 Ga0207683_10003746 Ga0207683_1000374611 205
484 3300026121 Ga0207683_10582112 Ga0207683_105821121 205
485 3300026121 Ga0207683_10897741 Ga0207683_108977412 205
486 3300026142 Ga0207698_10017457 Ga0207698_100174573 205
487 3300026142 Ga0207698_10628627 Ga0207698_106286272 205
488 3300028379 Ga0268266_10101845 Ga0268266_101018452 205
489 3300028379 Ga0268266_10777187 Ga0268266_107771871 205
490 3300028381 Ga0268264_10083705 Ga0268264_100837053 205
491 3300031901 Ga0307406_10163752 Ga0307406_101637522 205
492 3300041413 Ga0439465_0044047 Ga0439465_0044047_767_1384 205
493 3300042011 Ga0439454_017448 Ga0439454_017448_26_787 205
494 3300044673 Ga0453683_0022168 Ga0453683_0022168_13_636 205
495 3300044673 Ga0453683_0195686 Ga0453683_0195686_342_968 205
496 3300044712 Ga0453684_0066771 Ga0453684_0066771_3815_4453 205
497 3300044712 Ga0453684_0262131 Ga0453684_0262131_1263_1889 205
498 3300046460 Ga0495638_0357469 Ga0495638_0357469_46_663 205
499 3300046648 Ga0495611_0139403 Ga0495611_0139403_85_702 205
500 3300047472 Ga0495686_0010384 Ga0495686_0010384_4770_5435 205
501 3300047472 Ga0495686_0052545 Ga0495686_0052545_1461_2078 205
502 3300048911 Ga0496108_0186759 Ga0496108_0186759_187_804 205
503 3300049571 Ga0501034_0019303 Ga0501034_0019303_6298_6960 205
504 3300049571 Ga0501034_0044164 Ga0501034_0044164_3483_4124 205
505 3300049572 Ga0501036_0244603 Ga0501036_0244603_154_816 205
506 3300049572 Ga0501036_0322616 Ga0501036_0322616_372_1013 205
507 3300049574 Ga0501038_0281584 Ga0501038_0281584_47_709 205
508 3300049575 Ga0501039_0087577 Ga0501039_0087577_41_703 205
509 3300049579 Ga0501043_0103058 Ga0501043_0103058_873_1535 205
510 3300049579 Ga0501043_0202002 Ga0501043_0202002_571_1212 205
511 3300049580 Ga0501046_0017485 Ga0501046_0017485_4441_5103 205
512 3300049580 Ga0501046_0211024 Ga0501046_0211024_458_1099 205
513 3300049581 Ga0501047_0004355 Ga0501047_0004355_5672_6334 205
514 3300049584 Ga0501068_0347262 Ga0501068_0347262_166_807 205
515 3300049586 Ga0501070_0014107 Ga0501070_0014107_5585_6226 205
516 3300049586 Ga0501070_0026739 Ga0501070_0026739_2028_2645 205
517 3300049589 Ga0501073_0000921 Ga0501073_0000921_4269_4931 205
518 3300049589 Ga0501073_0169923 Ga0501073_0169923_361_1002 205
519 3300049590 Ga0501074_0004884 Ga0501074_0004884_509_1171 205
520 3300049590 Ga0501074_0200162 Ga0501074_0200162_508_1149 205
521 3300049742 Ga0501080_0235331 Ga0501080_0235331_509_1171 205
522 3300049742 Ga0501080_0273625 Ga0501080_0273625_508_1149 205
523 3300049744 Ga0501083_0286170 Ga0501083_0286170_295_936 205
524 3300049822 Ga0501035_0014708 Ga0501035_0014708_1552_2214 205
525 3300049823 Ga0501044_0397333 Ga0501044_0397333_442_1104 205
526 3300050493 nmdc:mga0k408_5067_c1 nmdc:mga0k408_5067_c1_6327_6944 205
527 3300050508 nmdc:mga09592_45558_c1 nmdc:mga09592_45558_c1_2109_2732 205
528 3300050509 nmdc:mga0qj67_99517_c1 nmdc:mga0qj67_99517_c1_1468_2085 205
529 3300050510 nmdc:mga06r32_418268_c1 nmdc:mga06r32_418268_c1_215_832 205
530 3300050511 nmdc:mga08y16_606717_c1 nmdc:mga08y16_606717_c1_387_1004 205
531 3300050511 nmdc:mga08y16_846821_c1 nmdc:mga08y16_846821_c1_101_718 205
532 3300053096 Ga0500641_0099617 Ga0500641_0099617_472_1089 205
533 3300053139 Ga0500568_0000236 Ga0500568_0000236_10703_11320 205
534 3300053727 Ga0500611_000006 Ga0500611_000006_112328_112945 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

62

108

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4x1e-assembly1.cif.gz_B crystal structure of unliganded e. coli transcriptional regulator rutr, w167a mutant 0.8002 13 202
4x1e-assembly1.cif.gz_B crystal structure of unliganded e. coli transcriptional regulator rutr, w167a mutant 0.7788 13 202
5k7z-assembly2.cif.gz_C crystal structure of aibr in complex with isovaleryl coenzyme a and operator dna 0.7639 9 167
3vpr-assembly2.cif.gz_D crystal structure of a tetr family transcriptional regulator pfmr from thermus thermophilus hb8 0.7633 8 205
3vpr-assembly2.cif.gz_C crystal structure of a tetr family transcriptional regulator pfmr from thermus thermophilus hb8 0.7624 14 205
ID Description Score Start End Superfamily
3whbA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9936 10 52 1.10.10.60
2wv1B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9888 10 52 1.10.10.60
3whcD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.987 9 52 1.10.10.60
3whcE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9842 10 52 1.10.10.60
5gpaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9838 13 52 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1Q3X7Q2-F1-model_v4 HTH tetR-type domain-containing protein 0.9391 10 205 GO:0003677
AF-A0A537J9P7-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9367 1 134 GO:0003677
AF-A0A3S2WB26-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9347 8 205 GO:0003677
AF-A0A3S2WB26-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9302 8 205 GO:0003677
AF-A0A2A4NF25-F1-model_v4 TetR family transcriptional regulator 0.9292 10 205 GO:0003677

Feature Viewer

pLDDT pTM Quality
89.13 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map