F460537

General Info

Members Datasets Scaffolds Average Seq Length
534 246 1068 156

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10443690|Ga0105237_104436902
Length 164
Sequence VGSDELVPVGRVGRPHGVDGAFFVENPSARAGVFTSGAMLYAGGEPATVVASRHGSGGRPVIRLDRDVGRGTELAVARAALPSLTDEDEFYVFELVGLSVEEESGRQLGRVREVLEYPGNDVLELDSGASLPLVEACVRKVDLAGGRIVVAVGFTDPEQSSPCA

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
105 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
106 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
107 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
108 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
109 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
110 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
111 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
128 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
129 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
130 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
131 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
132 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
133 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
134 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
135 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
162 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
168 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
169 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
170 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
171 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
202 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
243 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 9.36
Rhizosphere 90.07
Stem 0
Stem Tuber 0
Unclassified 9.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10443690 3300009545 Bacteria 1304
2 Ga0070658_10093479 3300005327 Bacteria 2480
3 Ga0070683_100033346 3300005329 Bacteria 4695
4 Ga0070680_100118363 3300005336 Bacteria 2209
5 Ga0070680_100174672 3300005336 Bacteria 1808
6 Ga0070680_100193961 3300005336 Bacteria 1712
7 Ga0070680_100942312 3300005336 Bacteria 745
8 Ga0070682_100082642 3300005337 Bacteria 2082
9 Ga0070682_100262710 3300005337 Bacteria 1250
10 Ga0070660_100055136 3300005339 Bacteria 3071
11 Ga0070691_10227048 3300005341 Bacteria 992
12 Ga0070661_100058955 3300005344 Bacteria 2814
13 Ga0070661_100704256 3300005344 Bacteria 823
14 Ga0070692_10091779 3300005345 Bacteria 1652
15 Ga0070671_100136876 3300005355 Bacteria 2065
16 Ga0070659_100623037 3300005366 Bacteria 929
17 Ga0070709_10024136 3300005434 Bacteria 3577
18 Ga0070714_100004990 3300005435 Bacteria 10087
19 Ga0070714_100006640 3300005435 Bacteria 8953
20 Ga0070714_100013910 3300005435 Bacteria 6455
21 Ga0070714_100065867 3300005435 Bacteria 3121
22 Ga0070714_100130172 3300005435 Bacteria 2248
23 Ga0070714_100415550 3300005435 Bacteria 1273
24 Ga0070714_101637530 3300005435 Unclassified 629
25 Ga0070713_100013273 3300005436 Bacteria 6076
26 Ga0070713_100204352 3300005436 Bacteria 1785
27 Ga0070713_100379465 3300005436 Bacteria 1317
28 Ga0070710_10013323 3300005437 Bacteria 4114
29 Ga0070710_10013773 3300005437 Bacteria 4058
30 Ga0070711_100030354 3300005439 Bacteria 3577
31 Ga0070711_100280702 3300005439 Unclassified 1317
32 Ga0070705_100125339 3300005440 Bacteria 1666
33 Ga0070705_100331795 3300005440 Bacteria 1102
34 Ga0070663_100369678 3300005455 Bacteria 1165
35 Ga0070662_100611937 3300005457 Bacteria 917
36 Ga0070681_10017999 3300005458 Bacteria 7059
37 Ga0070681_10537939 3300005458 Bacteria 1082
38 Ga0070681_10692832 3300005458 Bacteria 934
39 Ga0070706_100459891 3300005467 Bacteria 1184
40 Ga0070706_101611722 3300005467 Bacteria 592
41 Ga0070707_100001421 3300005468 Bacteria 23463
42 Ga0070707_100307125 3300005468 Bacteria 1542
43 Ga0070699_100126495 3300005518 Bacteria 2251
44 Ga0070699_100210734 3300005518 Bacteria 1730
45 Ga0070679_100062033 3300005530 Unclassified 3726
46 Ga0070679_100112791 3300005530 Bacteria 2704
47 Ga0070679_100468284 3300005530 Bacteria 1204
48 Ga0070684_100215560 3300005535 Unclassified 1750
49 Ga0070684_100218082 3300005535 Bacteria 1740
50 Ga0070684_100301103 3300005535 Bacteria 1471
51 Ga0070686_100568748 3300005544 Bacteria 889
52 Ga0070695_100000334 3300005545 Bacteria 24267
53 Ga0070696_100315109 3300005546 Bacteria 1202
54 Ga0070696_100527814 3300005546 Bacteria 943
55 Ga0070693_100350001 3300005547 Bacteria 1011
56 Ga0070693_100351636 3300005547 Bacteria 1009
57 Ga0070704_100128105 3300005549 Bacteria 1962
58 Ga0070704_100356772 3300005549 Bacteria 1236
59 Ga0068855_100099403 3300005563 Bacteria 3351
60 Ga0068855_100370866 3300005563 Bacteria 1573
61 Ga0070664_100094840 3300005564 Bacteria 2588
62 Ga0068856_100277510 3300005614 Bacteria 1692
63 Ga0068856_100284806 3300005614 Bacteria 1669
64 Ga0068856_100500227 3300005614 Bacteria 1236
65 Ga0068852_101461726 3300005616 Bacteria 706
66 Ga0068866_10498687 3300005718 Bacteria 805
67 Ga0068863_100204364 3300005841 Bacteria 1901
68 Ga0068863_100626316 3300005841 Bacteria 1066
69 Ga0081538_10011714 3300005981 Bacteria 7082
70 Ga0070717_10009831 3300006028 Bacteria 7203
71 Ga0070717_10011872 3300006028 Bacteria 6628
72 Ga0070717_10031287 3300006028 Bacteria 4279
73 Ga0070717_10094720 3300006028 Bacteria 2526
74 Ga0070715_10000828 3300006163 Bacteria 8480
75 Ga0070716_100041038 3300006173 Bacteria 2576
76 Ga0070716_100321166 3300006173 Unclassified 1085
77 Ga0070712_100013170 3300006175 Bacteria 5277
78 Ga0070712_100107991 3300006175 Bacteria 2071
79 Ga0070712_100486308 3300006175 Bacteria 1033
80 Ga0070712_100613412 3300006175 Bacteria 922
81 Ga0075433_10049479 3300006852 Bacteria 3657
82 Ga0075434_100063784 3300006871 Bacteria 3667
83 Ga0105240_10061979 3300009093 Bacteria 4658
84 Ga0105240_10305703 3300009093 Bacteria 1818
85 Ga0111539_10652632 3300009094 Bacteria 1225
86 Ga0105245_10137055 3300009098 Bacteria 2301
87 Ga0105245_10178310 3300009098 Bacteria 2028
88 Ga0105245_10210097 3300009098 Bacteria 1873
89 Ga0105247_10198011 3300009101 Bacteria 1348
90 Ga0105243_11383478 3300009148 Bacteria 724
91 Ga0105241_10213192 3300009174 Bacteria 1619
92 Ga0105248_10466885 3300009177 Bacteria 1423
93 Ga0105237_10026151 3300009545 Bacteria 5964
94 Ga0105238_10118859 3300009551 Bacteria 2623
95 Ga0105238_10557194 3300009551 Bacteria 1151
96 Ga0105239_10407348 3300010375 Bacteria 1539
97 Ga0105239_12429455 3300010375 Bacteria 610
98 Ga0157370_11864519 3300013104 Unclassified 539
99 Ga0157369_10131577 3300013105 Bacteria 2651
100 Ga0157369_10351059 3300013105 Bacteria 1532
101 Ga0157374_10079274 3300013296 Bacteria 3112
102 Ga0157374_10597588 3300013296 Bacteria 1113
103 Ga0157374_11350846 3300013296 Bacteria 735
104 Ga0157372_10018430 3300013307 Bacteria 7503
105 Ga0157372_10111220 3300013307 Bacteria 3138
106 Ga0157372_10346730 3300013307 Bacteria 1730
107 Ga0157372_10951558 3300013307 Unclassified 996
108 Ga0157375_12472012 3300013308 Bacteria 620
109 Ga0182008_10109773 3300014497 Bacteria 1367
110 Ga0182008_10151273 3300014497 Bacteria 1164
111 Ga0157379_11099037 3300014968 Bacteria 761
112 Ga0157376_10016558 3300014969 Bacteria 5601
113 Ga0206356_10041401 3300020070 Bacteria 1459
114 Ga0206354_10014060 3300020081 Unclassified 1093
115 Ga0206353_11460353 3300020082 Unclassified 1382
116 Ga0213871_10037246 3300021441 Bacteria 1294
117 Ga0224712_10047371 3300022467 Bacteria 1654
118 Ga0207692_10058612 3300025898 Bacteria 1984
119 Ga0207692_10162181 3300025898 Unclassified 1289
120 Ga0207685_10011750 3300025905 Bacteria 2646
121 Ga0207685_10209854 3300025905 Bacteria 920
122 Ga0207699_10007116 3300025906 Bacteria 5455
123 Ga0207705_10059643 3300025909 Bacteria 2754
124 Ga0207684_11200225 3300025910 Bacteria 628
125 Ga0207707_10023726 3300025912 Bacteria 5365
126 Ga0207707_10180308 3300025912 Bacteria 1844
127 Ga0207707_10233238 3300025912 Bacteria 1601
128 Ga0207695_10011313 3300025913 Bacteria 10818
129 Ga0207671_10176259 3300025914 Bacteria 1662
130 Ga0207693_10001626 3300025915 Bacteria 19847
131 Ga0207693_10017266 3300025915 Bacteria 5756
132 Ga0207693_10150761 3300025915 Bacteria 1829
133 Ga0207663_10035664 3300025916 Bacteria 2986
134 Ga0207663_10159361 3300025916 Unclassified 1591
135 Ga0207663_10425193 3300025916 Unclassified 1020
136 Ga0207657_10001172 3300025919 Bacteria 27807
137 Ga0207649_10068941 3300025920 Bacteria 2250
138 Ga0207652_10175290 3300025921 Bacteria 1925
139 Ga0207652_11173728 3300025921 Unclassified 669
140 Ga0207646_10003417 3300025922 Bacteria 17931
141 Ga0207646_10056069 3300025922 Bacteria 3523
142 Ga0207694_10574394 3300025924 Bacteria 947
143 Ga0207694_11539015 3300025924 Unclassified 561
144 Ga0207687_10072642 3300025927 Bacteria 2462
145 Ga0207687_10106620 3300025927 Bacteria 2072
146 Ga0207687_10108056 3300025927 Bacteria 2059
147 Ga0207700_10018023 3300025928 Bacteria 4731
148 Ga0207700_10361963 3300025928 Bacteria 1265
149 Ga0207664_10005865 3300025929 Bacteria 8399
150 Ga0207664_10016617 3300025929 Bacteria 5373
151 Ga0207664_10069815 3300025929 Bacteria 2825
152 Ga0207664_10144708 3300025929 Bacteria 2014
153 Ga0207664_10189588 3300025929 Bacteria 1769
154 Ga0207664_11110591 3300025929 Bacteria 707
155 Ga0207664_11116949 3300025929 Bacteria 704
156 Ga0207644_10264351 3300025931 Bacteria 1377
157 Ga0207706_10183477 3300025933 Bacteria 1838
158 Ga0207706_10510444 3300025933 Bacteria 1037
159 Ga0207709_11083482 3300025935 Bacteria 657
160 Ga0207665_10024562 3300025939 Bacteria 3974
161 Ga0207665_10305352 3300025939 Bacteria 1191
162 Ga0207661_10010984 3300025944 Bacteria 6541
163 Ga0207661_10333442 3300025944 Bacteria 1366
164 Ga0207679_10245483 3300025945 Bacteria 1519
165 Ga0207667_10155798 3300025949 Bacteria 2351
166 Ga0207651_10773584 3300025960 Bacteria 850
167 Ga0207639_11281774 3300026041 Bacteria 688
168 Ga0207702_10304915 3300026078 Bacteria 1512
169 Ga0207702_11464259 3300026078 Bacteria 676
170 Ga0207641_10471466 3300026088 Bacteria 1216
171 Ga0207674_10066080 3300026116 Bacteria 3644
172 Ga0207683_10240951 3300026121 Bacteria 1650
173 Ga0207698_10501137 3300026142 Bacteria 1182
174 Ga0307408_100133893 3300031548 Bacteria 1937
175 Ga0307405_10026429 3300031731 Bacteria 3348
176 Ga0307407_10126813 3300031903 Bacteria 1627
177 Ga0307409_101205756 3300031995 Bacteria 780
178 Ga0307416_100033247 3300032002 Bacteria 3907
179 Ga0307415_100000128 3300032126 Bacteria 32744
180 Ga0373959_0071595 3300034820 Bacteria 785
181 Ga0373926_0275723 3300035083 Unclassified 654
182 Ga0373934_0006432 3300035086 Bacteria 4358
183 Ga0373940_0062151 3300035088 Bacteria 1071
184 Ga0373944_0005337 3300035089 Bacteria 3381
185 Ga0373939_0101052 3300035114 Bacteria 990
186 Ga0373945_0003284 3300035116 Bacteria 5073
187 Ga0373945_0271363 3300035116 Unclassified 721
188 Ga0373956_0139684 3300035119 Bacteria 1137
189 Ga0373943_0015576 3300035170 Bacteria 3456
190 Ga0373946_0037702 3300035171 Bacteria 1966
191 Ga0373955_0196985 3300035172 Bacteria 1199
192 Ga0373924_0040697 3300035410 Bacteria 1903
193 Ga0373931_0096533 3300035691 Bacteria 1656
194 Ga0373931_0098871 3300035691 Bacteria 1638
195 Ga0373935_0008543 3300035692 Bacteria 6131
196 Ga0373935_0020830 3300035692 Bacteria 4011
197 Ga0373927_0260455 3300035695 Unclassified 1140
198 Ga0373933_0209685 3300035724 Bacteria 1248
199 Ga0373947_0046637 3300035725 Bacteria 2595
200 Ga0373937_0018152 3300036401 Bacteria 6276
201 Ga0373937_0198569 3300036401 Bacteria 1885
202 Ga0395899_0001498 3300037312 Bacteria 19829
203 Ga0395899_0007899 3300037312 Bacteria 8194
204 Ga0395899_0317728 3300037312 Bacteria 1050
205 Ga0395899_0393861 3300037312 Bacteria 918
206 Ga0395900_0001151 3300037418 Bacteria 33219
207 Ga0395900_0029263 3300037418 Bacteria 5650
208 Ga0395900_0035710 3300037418 Bacteria 5121
209 Ga0395900_0106711 3300037418 Bacteria 2877
210 Ga0395900_1504462 3300037418 Unclassified 585
211 Ga0395900_1545814 3300037418 Bacteria 575
212 Ga0395898_0004451 3300037466 Bacteria 15315
213 Ga0395898_0013814 3300037466 Bacteria 8301
214 Ga0395898_0072653 3300037466 Bacteria 3323
215 Ga0395898_0105139 3300037466 Bacteria 2707
216 Ga0395898_0167152 3300037466 Bacteria 2103
217 Ga0395898_0366100 3300037466 Bacteria 1375
218 Ga0395898_0465436 3300037466 Bacteria 1203
219 Ga0395898_0861966 3300037466 Unclassified 845
220 Ga0395905_0002919 3300037471 Bacteria 18634
221 Ga0395905_0004848 3300037471 Bacteria 13871
222 Ga0395905_0150413 3300037471 Unclassified 2190
223 Ga0395905_0197526 3300037471 Bacteria 1886
224 Ga0395901_0006888 3300038443 Bacteria 11478
225 Ga0395901_0016282 3300038443 Bacteria 7572
226 Ga0395901_0235789 3300038443 Bacteria 1909
227 Ga0395901_0748704 3300038443 Bacteria 970
228 Ga0436360_0920358 3300039438 Bacteria 2240
229 Ga0439466_0042205 3300041411 Bacteria 1519
230 Ga0451839_1190706 3300041496 Unclassified 604
231 Ga0450898_012870 3300042134 Bacteria 1388
232 Ga0450907_050878 3300042146 Bacteria 712
233 Ga0439446_0117194 3300042156 Bacteria 854
234 Ga0439434_0028958 3300042435 Bacteria 1679
235 Ga0466972_0014839 3300044658 Bacteria 3899
236 Ga0466965_0010775 3300044683 Bacteria 4277
237 Ga0466965_0116580 3300044683 Bacteria 1376
238 Ga0466965_0247639 3300044683 Bacteria 955
239 Ga0466965_0380378 3300044683 Bacteria 777
240 Ga0466965_0395938 3300044683 Unclassified 762
241 Ga0466966_0094476 3300044684 Bacteria 1853
242 Ga0466961_0031456 3300044693 Bacteria 3411
243 Ga0466961_0048982 3300044693 Bacteria 2701
244 Ga0466961_0056553 3300044693 Bacteria 2500
245 Ga0466963_0000118 3300044694 Bacteria 29387
246 Ga0466963_0004071 3300044694 Bacteria 8456
247 Ga0466963_0007626 3300044694 Bacteria 6458
248 Ga0466963_0012606 3300044694 Bacteria 5178
249 Ga0466963_0016631 3300044694 Bacteria 4576
250 Ga0466963_0029006 3300044694 Bacteria 3558
251 Ga0466963_0030926 3300044694 Bacteria 3457
252 Ga0466963_0035721 3300044694 Bacteria 3238
253 Ga0466963_0047453 3300044694 Bacteria 2834
254 Ga0466963_0053412 3300044694 Bacteria 2682
255 Ga0466963_0076495 3300044694 Bacteria 2260
256 Ga0466964_0002432 3300044706 Bacteria 6617
257 Ga0466964_0004607 3300044706 Bacteria 5097
258 Ga0466964_0026523 3300044706 Bacteria 2268
259 Ga0466964_0034009 3300044706 Bacteria 2033
260 Ga0466964_0155871 3300044706 Bacteria 1063
261 Ga0466964_0227769 3300044706 Bacteria 908
262 Ga0466964_0565152 3300044706 Bacteria 619
263 Ga0466971_0000267 3300044719 Bacteria 20039
264 Ga0466971_0000713 3300044719 Bacteria 13307
265 Ga0466971_0124289 3300044719 Bacteria 1195
266 Ga0466971_0237392 3300044719 Unclassified 866
267 Ga0466968_0000530 3300044735 Bacteria 12949
268 Ga0466968_0014166 3300044735 Bacteria 3148
269 Ga0466968_0034101 3300044735 Bacteria 2123
270 Ga0466968_0056073 3300044735 Bacteria 1692
271 Ga0466968_0190792 3300044735 Bacteria 956
272 Ga0466968_0211384 3300044735 Bacteria 911
273 Ga0466968_0379459 3300044735 Unclassified 690
274 Ga0466970_0055229 3300044765 Bacteria 2121
275 Ga0466957_0009125 3300044842 Bacteria 5656
276 Ga0466957_0011140 3300044842 Bacteria 5178
277 Ga0466957_0013447 3300044842 Bacteria 4746
278 Ga0466957_0022802 3300044842 Bacteria 3696
279 Ga0466957_0039842 3300044842 Bacteria 2836
280 Ga0466957_0048745 3300044842 Bacteria 2574
281 Ga0466957_0133717 3300044842 Bacteria 1592
282 Ga0466960_0008612 3300044901 Bacteria 4181
283 Ga0466960_0012809 3300044901 Bacteria 3549
284 Ga0466960_0020168 3300044901 Bacteria 2949
285 Ga0466959_0017580 3300045049 Bacteria 5242
286 Ga0466959_0053866 3300045049 Bacteria 2940
287 Ga0466959_0186001 3300045049 Bacteria 1451
288 Ga0466959_0191652 3300045049 Bacteria 1426
289 Ga0466958_0000495 3300045836 Bacteria 16502
290 Ga0466958_0002659 3300045836 Bacteria 9035
291 Ga0466958_0003194 3300045836 Bacteria 8452
292 Ga0466958_0008925 3300045836 Bacteria 5570
293 Ga0466958_0009742 3300045836 Bacteria 5361
294 Ga0466958_0016750 3300045836 Bacteria 4225
295 Ga0466958_0038580 3300045836 Bacteria 2866
296 Ga0466958_0075254 3300045836 Bacteria 2071
297 Ga0466958_0183509 3300045836 Bacteria 1328
298 Ga0466958_0342798 3300045836 Unclassified 961
299 Ga0466958_0424520 3300045836 Bacteria 859
300 Ga0466967_0005677 3300045976 Bacteria 8696
301 Ga0466967_0009665 3300045976 Bacteria 7174
302 Ga0466967_0029955 3300045976 Bacteria 4561
303 Ga0466967_0039231 3300045976 Bacteria 4069
304 Ga0466967_0044487 3300045976 Bacteria 3852
305 Ga0466967_0050006 3300045976 Bacteria 3659
306 Ga0466967_0068536 3300045976 Bacteria 3168
307 Ga0466967_0113430 3300045976 Bacteria 2493
308 Ga0466967_0127958 3300045976 Bacteria 2354
309 Ga0466967_0128008 3300045976 Bacteria 2354
310 Ga0466967_0134013 3300045976 Bacteria 2302
311 Ga0466967_0257297 3300045976 Bacteria 1669
312 Ga0466967_0361037 3300045976 Bacteria 1407
313 Ga0466967_0497241 3300045976 Bacteria 1196
314 Ga0466967_0716363 3300045976 Bacteria 992
315 Ga0495592_0000125 3300046454 Bacteria 68045
316 Ga0495592_0005522 3300046454 Bacteria 9351
317 Ga0495603_0007384 3300046455 Bacteria 6609
318 Ga0495629_0037621 3300046459 Bacteria 3410
319 Ga0495629_0131183 3300046459 Bacteria 1745
320 Ga0495641_0002166 3300046461 Bacteria 15735
321 Ga0495641_0069467 3300046461 Bacteria 1583
322 Ga0495641_0284884 3300046461 Unclassified 744
323 Ga0495651_0000011 3300046462 Bacteria 147193
324 Ga0495651_0053221 3300046462 Bacteria 3117
325 Ga0495651_0053601 3300046462 Bacteria 3104
326 Ga0495653_0005067 3300046463 Bacteria 10691
327 Ga0495653_0045977 3300046463 Bacteria 3381
328 Ga0495653_0076835 3300046463 Bacteria 2481
329 Ga0495580_0026301 3300046472 Bacteria 4244
330 Ga0495582_0064158 3300046473 Bacteria 2028
331 Ga0495582_0066542 3300046473 Bacteria 1991
332 Ga0495582_0688618 3300046473 Bacteria 591
333 Ga0495639_0002434 3300046475 Bacteria 8127
334 Ga0495639_0225244 3300046475 Unclassified 923
335 Ga0495662_0040226 3300046476 Bacteria 2257
336 Ga0495662_0056117 3300046476 Bacteria 1902
337 Ga0495664_0052196 3300046477 Bacteria 2429
338 Ga0495664_0066647 3300046477 Bacteria 2147
339 Ga0495584_0467659 3300046491 Bacteria 642
340 Ga0495594_0492079 3300046499 Unclassified 697
341 Ga0495596_0100130 3300046500 Bacteria 1125
342 Ga0495607_0008218 3300046501 Bacteria 7142
343 Ga0495608_0031190 3300046511 Bacteria 3605
344 Ga0495608_0067051 3300046511 Bacteria 2348
345 Ga0495608_0116995 3300046511 Bacteria 1710
346 Ga0495608_0143686 3300046511 Bacteria 1522
347 Ga0495608_0487615 3300046511 Bacteria 747
348 Ga0495618_0007063 3300046514 Bacteria 6792
349 Ga0495618_0080709 3300046514 Bacteria 2076
350 Ga0495618_0157793 3300046514 Bacteria 1447
351 Ga0495628_0000040 3300046516 Bacteria 104506
352 Ga0495628_0144154 3300046516 Bacteria 1816
353 Ga0495628_0176667 3300046516 Bacteria 1617
354 Ga0495628_0220512 3300046516 Bacteria 1424
355 Ga0495628_0494830 3300046516 Bacteria 883
356 Ga0495630_0019460 3300046517 Unclassified 4990
357 Ga0495630_0024760 3300046517 Bacteria 4436
358 Ga0495630_0216768 3300046517 Bacteria 1461
359 Ga0495637_0193359 3300046520 Unclassified 750
360 Ga0495644_0001368 3300046523 Bacteria 9959
361 Ga0495644_0228540 3300046523 Bacteria 720
362 Ga0495663_0078295 3300046525 Bacteria 1061
363 Ga0495666_0004106 3300046526 Bacteria 7353
364 Ga0495666_0445422 3300046526 Unclassified 580
365 Ga0495642_0018320 3300046528 Bacteria 2741
366 Ga0495652_0000299 3300046529 Bacteria 58948
367 Ga0495652_0025357 3300046529 Bacteria 5246
368 Ga0495665_0010827 3300046531 Bacteria 4934
369 Ga0495665_0213158 3300046531 Bacteria 1000
370 Ga0495640_0025758 3300046533 Bacteria 4260
371 Ga0495587_0000212 3300046536 Bacteria 43340
372 Ga0495587_0097758 3300046536 Bacteria 1692
373 Ga0495587_0102124 3300046536 Bacteria 1651
374 Ga0495645_0000035 3300046543 Bacteria 102305
375 Ga0495645_0127050 3300046543 Bacteria 1791
376 Ga0495645_0380901 3300046543 Bacteria 902
377 Ga0495633_0051575 3300046558 Bacteria 1938
378 Ga0495667_0071245 3300046559 Bacteria 2267
379 Ga0495656_0002084 3300046615 Bacteria 6601
380 Ga0495656_0395647 3300046615 Bacteria 722
381 Ga0495634_0118795 3300046642 Bacteria 1694
382 Ga0495634_0134086 3300046642 Bacteria 1576
383 Ga0495634_0170328 3300046642 Bacteria 1368
384 Ga0495634_0437360 3300046642 Bacteria 773
385 Ga0495611_0006116 3300046648 Bacteria 5135
386 Ga0495635_0016143 3300046663 Bacteria 5214
387 Ga0495635_0072886 3300046663 Bacteria 2352
388 Ga0495635_0206138 3300046663 Unclassified 1332
389 Ga0495659_0002432 3300046664 Bacteria 6010
390 Ga0495659_0239918 3300046664 Bacteria 753
391 Ga0495588_0124220 3300046674 Bacteria 1361
392 Ga0495657_0012115 3300046675 Bacteria 6417
393 Ga0495657_0018821 3300046675 Bacteria 4991
394 Ga0495657_0080116 3300046675 Bacteria 2114
395 Ga0495657_0129494 3300046675 Bacteria 1582
396 Ga0495599_0000009 3300046678 Bacteria 217299
397 Ga0495599_0124874 3300046678 Bacteria 1599
398 Ga0495599_0278280 3300046678 Bacteria 1014
399 Ga0495623_0002770 3300046679 Bacteria 11583
400 Ga0495623_0093399 3300046679 Bacteria 1842
401 Ga0495623_0099293 3300046679 Bacteria 1775
402 Ga0495646_0004330 3300046680 Bacteria 8944
403 Ga0495646_0145979 3300046680 Bacteria 1319
404 Ga0495646_0330825 3300046680 Unclassified 801
405 Ga0495647_0024108 3300046681 Bacteria 2213
406 Ga0495647_0056390 3300046681 Bacteria 1540
407 Ga0495613_0007817 3300046689 Bacteria 7953
408 Ga0495613_0072321 3300046689 Bacteria 2513
409 Ga0495613_0077722 3300046689 Bacteria 2414
410 Ga0495613_0186429 3300046689 Bacteria 1468
411 Ga0495624_0018533 3300046690 Bacteria 4655
412 Ga0495624_0074468 3300046690 Bacteria 2109
413 Ga0495670_0098133 3300046691 Bacteria 1506
414 Ga0495671_0220164 3300046692 Bacteria 919
415 Ga0495600_0045430 3300046809 Bacteria 2866
416 Ga0495581_0003407 3300047315 Bacteria 9134
417 Ga0495604_0000847 3300047317 Bacteria 25539
418 Ga0495604_0094507 3300047317 Bacteria 2210
419 Ga0495636_0194362 3300047318 Bacteria 924
420 Ga0495674_0061607 3300047319 Bacteria 3269
421 Ga0495674_0091709 3300047319 Bacteria 2594
422 Ga0495674_0114412 3300047319 Bacteria 2284
423 Ga0495674_0330917 3300047319 Unclassified 1239
424 Ga0495676_0039058 3300047321 Bacteria 3935
425 Ga0495676_0448594 3300047321 Bacteria 851
426 Ga0495676_0651616 3300047321 Unclassified 683
427 Ga0495680_0016594 3300047322 Bacteria 6321
428 Ga0495680_0022970 3300047322 Bacteria 5191
429 Ga0495680_0058872 3300047322 Bacteria 2967
430 Ga0495680_0059551 3300047322 Bacteria 2947
431 Ga0495675_0000137 3300047444 Bacteria 50947
432 Ga0495675_0122813 3300047444 Bacteria 1617
433 Ga0495679_013665 3300047446 Bacteria 3036
434 Ga0495684_0012595 3300047471 Bacteria 6522
435 Ga0495684_0103727 3300047471 Bacteria 2149
436 Ga0495684_0785013 3300047471 Bacteria 624
437 Ga0495593_0008432 3300047673 Bacteria 5994
438 Ga0495602_0000733 3300048088 Bacteria 30967
439 Ga0495614_0004562 3300048089 Bacteria 6243
440 Ga0496100_0004812 3300048903 Bacteria 7210
441 Ga0496100_0153649 3300048903 Bacteria 1644
442 Ga0496100_0352361 3300048903 Unclassified 1112
443 Ga0496100_0800518 3300048903 Bacteria 738
444 Ga0496101_0085826 3300048904 Bacteria 2333
445 Ga0496101_0550463 3300048904 Bacteria 912
446 Ga0496101_0696428 3300048904 Unclassified 802
447 Ga0496102_0001719 3300048905 Bacteria 19153
448 Ga0496102_0068787 3300048905 Bacteria 3249
449 Ga0496102_0283621 3300048905 Bacteria 1561
450 Ga0496103_0148716 3300048906 Bacteria 1500
451 Ga0496104_0023791 3300048907 Bacteria 5633
452 Ga0496104_0041399 3300048907 Bacteria 4319
453 Ga0496104_0151405 3300048907 Bacteria 2226
454 Ga0496104_0184803 3300048907 Bacteria 1995
455 Ga0496105_0017143 3300048908 Bacteria 5800
456 Ga0496105_0092912 3300048908 Bacteria 2491
457 Ga0496105_0206207 3300048908 Unclassified 1603
458 Ga0496105_0237373 3300048908 Bacteria 1480
459 Ga0496106_0029860 3300048909 Bacteria 4063
460 Ga0496106_0453328 3300048909 Bacteria 1030
461 Ga0496107_0003518 3300048910 Bacteria 10486
462 Ga0496107_0079651 3300048910 Bacteria 2388
463 Ga0496108_0003564 3300048911 Bacteria 12475
464 Ga0496108_0005066 3300048911 Bacteria 10646
465 Ga0496108_0165583 3300048911 Bacteria 1911
466 Ga0496109_0005012 3300048912 Bacteria 11058
467 Ga0496109_0031188 3300048912 Bacteria 4781
468 Ga0496109_0089590 3300048912 Bacteria 2844
469 Ga0496109_0289056 3300048912 Bacteria 1545
470 Ga0496109_0518895 3300048912 Bacteria 1124
471 Ga0496110_0052783 3300048913 Bacteria 3572
472 Ga0496110_0164894 3300048913 Bacteria 2009
473 Ga0496110_0378318 3300048913 Bacteria 1290
474 Ga0496111_0031522 3300048914 Bacteria 3777
475 Ga0496111_0083665 3300048914 Bacteria 2332
476 Ga0496111_0153316 3300048914 Bacteria 1709
477 Ga0496111_0542239 3300048914 Unclassified 854
478 Ga0496112_0163212 3300048915 Bacteria 2194
479 Ga0496112_0201923 3300048915 Bacteria 1947
480 Ga0496112_0299601 3300048915 Bacteria 1553
481 Ga0496112_0932496 3300048915 Bacteria 789
482 Ga0496114_0011420 3300048917 Bacteria 7097
483 Ga0496114_0154099 3300048917 Bacteria 1994
484 Ga0496114_0321016 3300048917 Bacteria 1368
485 Ga0496114_0376391 3300048917 Bacteria 1257
486 Ga0496115_0003422 3300048918 Bacteria 11400
487 Ga0496115_0003592 3300048918 Bacteria 11145
488 Ga0496115_0159425 3300048918 Bacteria 1864
489 Ga0496115_0277322 3300048918 Unclassified 1376
490 Ga0501040_0259456 3300049576 Bacteria 1240
491 Ga0501041_0082839 3300049577 Bacteria 1977
492 Ga0501043_0298834 3300049579 Bacteria 1231
493 Ga0501067_0113289 3300049583 Unclassified 1508
494 Ga0501068_0676744 3300049584 Unclassified 674
495 Ga0501069_0172606 3300049585 Unclassified 1248
496 Ga0501071_0288863 3300049587 Bacteria 1242
497 Ga0501072_0244382 3300049588 Bacteria 1430
498 Ga0501075_0559267 3300049591 Bacteria 873
499 Ga0501076_0271800 3300049592 Bacteria 1388
500 Ga0501079_0144867 3300049741 Bacteria 1851
501 Ga0501079_0174158 3300049741 Bacteria 1678
502 nmdc:mga08y16_187104_c1 3300050511 Bacteria 2148
503 nmdc:mga0n895_435440_c1 3300050512 Bacteria 1325
504 nmdc:mga0rr50_715083_c1 3300050513 Unclassified 855
505 nmdc:mga08x19_644262_c1 3300050514 Bacteria 751
506 nmdc:mga0a205_1184540_c1 3300050515 Unclassified 612
507 Ga0495601_0002178 3300053077 Bacteria 11028
508 Ga0495601_0011903 3300053077 Bacteria 5214
509 Ga0495601_0413162 3300053077 Bacteria 874
510 Ga0495601_0764372 3300053077 Bacteria 614
511 Ga0495612_0015122 3300053078 Bacteria 3094
512 Ga0495612_0023169 3300053078 Bacteria 2490
513 Ga0495612_0066547 3300053078 Unclassified 1498
514 Ga0495612_0319180 3300053078 Unclassified 698
515 Ga0495595_0009594 3300053084 Bacteria 4010
516 Ga0495595_0013567 3300053084 Bacteria 3443
517 Ga0495595_0039249 3300053084 Bacteria 2159
518 Ga0495595_0112471 3300053084 Bacteria 1321
519 Ga0495595_0566009 3300053084 Bacteria 580
520 Ga0495619_0018551 3300053085 Bacteria 4414
521 Ga0495619_0231049 3300053085 Bacteria 1281
522 Ga0495619_0406020 3300053085 Bacteria 940
523 Ga0495619_0680590 3300053085 Unclassified 700
524 Ga0500566_0029077 3300053094 Bacteria 3229
525 Ga0500608_314901 3300053122 Unclassified 573
526 Ga0501084_0237553 3300054114 Bacteria 1538
527 Ga0501084_1508291 3300054114 Bacteria 562
528 Ga0466962_0006235 3300061719 Bacteria 5727
529 Ga0466962_0019218 3300061719 Bacteria 3281
530 Ga0466962_0045816 3300061719 Unclassified 2090
531 Ga0466962_0128396 3300061719 Unclassified 1225
532 Ga0530510_0202111 3300061734 Bacteria 1476
533 Ga0530510_0205028 3300061734 Bacteria 1465
534 Ga0530510_0555156 3300061734 Bacteria 872
535 Ga0105237_10443690
536 Ga0070658_10093479
537 Ga0070683_100033346
538 Ga0070680_100118363
539 Ga0070680_100174672
540 Ga0070680_100193961
541 Ga0070680_100942312
542 Ga0070682_100082642
543 Ga0070682_100262710
544 Ga0070660_100055136
545 Ga0070691_10227048
546 Ga0070661_100058955
547 Ga0070661_100704256
548 Ga0070692_10091779
549 Ga0070671_100136876
550 Ga0070659_100623037
551 Ga0070709_10024136
552 Ga0070714_100004990
553 Ga0070714_100006640
554 Ga0070714_100013910
555 Ga0070714_100065867
556 Ga0070714_100130172
557 Ga0070714_100415550
558 Ga0070714_101637530
559 Ga0070713_100013273
560 Ga0070713_100204352
561 Ga0070713_100379465
562 Ga0070710_10013323
563 Ga0070710_10013773
564 Ga0070711_100030354
565 Ga0070711_100280702
566 Ga0070705_100125339
567 Ga0070705_100331795
568 Ga0070663_100369678
569 Ga0070662_100611937
570 Ga0070681_10017999
571 Ga0070681_10537939
572 Ga0070681_10692832
573 Ga0070706_100459891
574 Ga0070706_101611722
575 Ga0070707_100001421
576 Ga0070707_100307125
577 Ga0070699_100126495
578 Ga0070699_100210734
579 Ga0070679_100062033
580 Ga0070679_100112791
581 Ga0070679_100468284
582 Ga0070684_100215560
583 Ga0070684_100218082
584 Ga0070684_100301103
585 Ga0070686_100568748
586 Ga0070695_100000334
587 Ga0070696_100315109
588 Ga0070696_100527814
589 Ga0070693_100350001
590 Ga0070693_100351636
591 Ga0070704_100128105
592 Ga0070704_100356772
593 Ga0068855_100099403
594 Ga0068855_100370866
595 Ga0070664_100094840
596 Ga0068856_100277510
597 Ga0068856_100284806
598 Ga0068856_100500227
599 Ga0068852_101461726
600 Ga0068866_10498687
601 Ga0068863_100204364
602 Ga0068863_100626316
603 Ga0081538_10011714
604 Ga0070717_10009831
605 Ga0070717_10011872
606 Ga0070717_10031287
607 Ga0070717_10094720
608 Ga0070715_10000828
609 Ga0070716_100041038
610 Ga0070716_100321166
611 Ga0070712_100013170
612 Ga0070712_100107991
613 Ga0070712_100486308
614 Ga0070712_100613412
615 Ga0075433_10049479
616 Ga0075434_100063784
617 Ga0105240_10061979
618 Ga0105240_10305703
619 Ga0111539_10652632
620 Ga0105245_10137055
621 Ga0105245_10178310
622 Ga0105245_10210097
623 Ga0105247_10198011
624 Ga0105243_11383478
625 Ga0105241_10213192
626 Ga0105248_10466885
627 Ga0105237_10026151
628 Ga0105238_10118859
629 Ga0105238_10557194
630 Ga0105239_10407348
631 Ga0105239_12429455
632 Ga0157370_11864519
633 Ga0157369_10131577
634 Ga0157369_10351059
635 Ga0157374_10079274
636 Ga0157374_10597588
637 Ga0157374_11350846
638 Ga0157372_10018430
639 Ga0157372_10111220
640 Ga0157372_10346730
641 Ga0157372_10951558
642 Ga0157375_12472012
643 Ga0182008_10109773
644 Ga0182008_10151273
645 Ga0157379_11099037
646 Ga0157376_10016558
647 Ga0206356_10041401
648 Ga0206354_10014060
649 Ga0206353_11460353
650 Ga0213871_10037246
651 Ga0224712_10047371
652 Ga0207692_10058612
653 Ga0207692_10162181
654 Ga0207685_10011750
655 Ga0207685_10209854
656 Ga0207699_10007116
657 Ga0207705_10059643
658 Ga0207684_11200225
659 Ga0207707_10023726
660 Ga0207707_10180308
661 Ga0207707_10233238
662 Ga0207695_10011313
663 Ga0207671_10176259
664 Ga0207693_10001626
665 Ga0207693_10017266
666 Ga0207693_10150761
667 Ga0207663_10035664
668 Ga0207663_10159361
669 Ga0207663_10425193
670 Ga0207657_10001172
671 Ga0207649_10068941
672 Ga0207652_10175290
673 Ga0207652_11173728
674 Ga0207646_10003417
675 Ga0207646_10056069
676 Ga0207694_10574394
677 Ga0207694_11539015
678 Ga0207687_10072642
679 Ga0207687_10106620
680 Ga0207687_10108056
681 Ga0207700_10018023
682 Ga0207700_10361963
683 Ga0207664_10005865
684 Ga0207664_10016617
685 Ga0207664_10069815
686 Ga0207664_10144708
687 Ga0207664_10189588
688 Ga0207664_11110591
689 Ga0207664_11116949
690 Ga0207644_10264351
691 Ga0207706_10183477
692 Ga0207706_10510444
693 Ga0207709_11083482
694 Ga0207665_10024562
695 Ga0207665_10305352
696 Ga0207661_10010984
697 Ga0207661_10333442
698 Ga0207679_10245483
699 Ga0207667_10155798
700 Ga0207651_10773584
701 Ga0207639_11281774
702 Ga0207702_10304915
703 Ga0207702_11464259
704 Ga0207641_10471466
705 Ga0207674_10066080
706 Ga0207683_10240951
707 Ga0207698_10501137
708 Ga0307408_100133893
709 Ga0307405_10026429
710 Ga0307407_10126813
711 Ga0307409_101205756
712 Ga0307416_100033247
713 Ga0307415_100000128
714 Ga0373959_0071595
715 Ga0373926_0275723
716 Ga0373934_0006432
717 Ga0373940_0062151
718 Ga0373944_0005337
719 Ga0373939_0101052
720 Ga0373945_0003284
721 Ga0373945_0271363
722 Ga0373956_0139684
723 Ga0373943_0015576
724 Ga0373946_0037702
725 Ga0373955_0196985
726 Ga0373924_0040697
727 Ga0373931_0096533
728 Ga0373931_0098871
729 Ga0373935_0008543
730 Ga0373935_0020830
731 Ga0373927_0260455
732 Ga0373933_0209685
733 Ga0373947_0046637
734 Ga0373937_0018152
735 Ga0373937_0198569
736 Ga0395899_0001498
737 Ga0395899_0007899
738 Ga0395899_0317728
739 Ga0395899_0393861
740 Ga0395900_0001151
741 Ga0395900_0029263
742 Ga0395900_0035710
743 Ga0395900_0106711
744 Ga0395900_1504462
745 Ga0395900_1545814
746 Ga0395898_0004451
747 Ga0395898_0013814
748 Ga0395898_0072653
749 Ga0395898_0105139
750 Ga0395898_0167152
751 Ga0395898_0366100
752 Ga0395898_0465436
753 Ga0395898_0861966
754 Ga0395905_0002919
755 Ga0395905_0004848
756 Ga0395905_0150413
757 Ga0395905_0197526
758 Ga0395901_0006888
759 Ga0395901_0016282
760 Ga0395901_0235789
761 Ga0395901_0748704
762 Ga0436360_0920358
763 Ga0439466_0042205
764 Ga0451839_1190706
765 Ga0450898_012870
766 Ga0450907_050878
767 Ga0439446_0117194
768 Ga0439434_0028958
769 Ga0466972_0014839
770 Ga0466965_0010775
771 Ga0466965_0116580
772 Ga0466965_0247639
773 Ga0466965_0380378
774 Ga0466965_0395938
775 Ga0466966_0094476
776 Ga0466961_0031456
777 Ga0466961_0048982
778 Ga0466961_0056553
779 Ga0466963_0000118
780 Ga0466963_0004071
781 Ga0466963_0007626
782 Ga0466963_0012606
783 Ga0466963_0016631
784 Ga0466963_0029006
785 Ga0466963_0030926
786 Ga0466963_0035721
787 Ga0466963_0047453
788 Ga0466963_0053412
789 Ga0466963_0076495
790 Ga0466964_0002432
791 Ga0466964_0004607
792 Ga0466964_0026523
793 Ga0466964_0034009
794 Ga0466964_0155871
795 Ga0466964_0227769
796 Ga0466964_0565152
797 Ga0466971_0000267
798 Ga0466971_0000713
799 Ga0466971_0124289
800 Ga0466971_0237392
801 Ga0466968_0000530
802 Ga0466968_0014166
803 Ga0466968_0034101
804 Ga0466968_0056073
805 Ga0466968_0190792
806 Ga0466968_0211384
807 Ga0466968_0379459
808 Ga0466970_0055229
809 Ga0466957_0009125
810 Ga0466957_0011140
811 Ga0466957_0013447
812 Ga0466957_0022802
813 Ga0466957_0039842
814 Ga0466957_0048745
815 Ga0466957_0133717
816 Ga0466960_0008612
817 Ga0466960_0012809
818 Ga0466960_0020168
819 Ga0466959_0017580
820 Ga0466959_0053866
821 Ga0466959_0186001
822 Ga0466959_0191652
823 Ga0466958_0000495
824 Ga0466958_0002659
825 Ga0466958_0003194
826 Ga0466958_0008925
827 Ga0466958_0009742
828 Ga0466958_0016750
829 Ga0466958_0038580
830 Ga0466958_0075254
831 Ga0466958_0183509
832 Ga0466958_0342798
833 Ga0466958_0424520
834 Ga0466967_0005677
835 Ga0466967_0009665
836 Ga0466967_0029955
837 Ga0466967_0039231
838 Ga0466967_0044487
839 Ga0466967_0050006
840 Ga0466967_0068536
841 Ga0466967_0113430
842 Ga0466967_0127958
843 Ga0466967_0128008
844 Ga0466967_0134013
845 Ga0466967_0257297
846 Ga0466967_0361037
847 Ga0466967_0497241
848 Ga0466967_0716363
849 Ga0495592_0000125
850 Ga0495592_0005522
851 Ga0495603_0007384
852 Ga0495629_0037621
853 Ga0495629_0131183
854 Ga0495641_0002166
855 Ga0495641_0069467
856 Ga0495641_0284884
857 Ga0495651_0000011
858 Ga0495651_0053221
859 Ga0495651_0053601
860 Ga0495653_0005067
861 Ga0495653_0045977
862 Ga0495653_0076835
863 Ga0495580_0026301
864 Ga0495582_0064158
865 Ga0495582_0066542
866 Ga0495582_0688618
867 Ga0495639_0002434
868 Ga0495639_0225244
869 Ga0495662_0040226
870 Ga0495662_0056117
871 Ga0495664_0052196
872 Ga0495664_0066647
873 Ga0495584_0467659
874 Ga0495594_0492079
875 Ga0495596_0100130
876 Ga0495607_0008218
877 Ga0495608_0031190
878 Ga0495608_0067051
879 Ga0495608_0116995
880 Ga0495608_0143686
881 Ga0495608_0487615
882 Ga0495618_0007063
883 Ga0495618_0080709
884 Ga0495618_0157793
885 Ga0495628_0000040
886 Ga0495628_0144154
887 Ga0495628_0176667
888 Ga0495628_0220512
889 Ga0495628_0494830
890 Ga0495630_0019460
891 Ga0495630_0024760
892 Ga0495630_0216768
893 Ga0495637_0193359
894 Ga0495644_0001368
895 Ga0495644_0228540
896 Ga0495663_0078295
897 Ga0495666_0004106
898 Ga0495666_0445422
899 Ga0495642_0018320
900 Ga0495652_0000299
901 Ga0495652_0025357
902 Ga0495665_0010827
903 Ga0495665_0213158
904 Ga0495640_0025758
905 Ga0495587_0000212
906 Ga0495587_0097758
907 Ga0495587_0102124
908 Ga0495645_0000035
909 Ga0495645_0127050
910 Ga0495645_0380901
911 Ga0495633_0051575
912 Ga0495667_0071245
913 Ga0495656_0002084
914 Ga0495656_0395647
915 Ga0495634_0118795
916 Ga0495634_0134086
917 Ga0495634_0170328
918 Ga0495634_0437360
919 Ga0495611_0006116
920 Ga0495635_0016143
921 Ga0495635_0072886
922 Ga0495635_0206138
923 Ga0495659_0002432
924 Ga0495659_0239918
925 Ga0495588_0124220
926 Ga0495657_0012115
927 Ga0495657_0018821
928 Ga0495657_0080116
929 Ga0495657_0129494
930 Ga0495599_0000009
931 Ga0495599_0124874
932 Ga0495599_0278280
933 Ga0495623_0002770
934 Ga0495623_0093399
935 Ga0495623_0099293
936 Ga0495646_0004330
937 Ga0495646_0145979
938 Ga0495646_0330825
939 Ga0495647_0024108
940 Ga0495647_0056390
941 Ga0495613_0007817
942 Ga0495613_0072321
943 Ga0495613_0077722
944 Ga0495613_0186429
945 Ga0495624_0018533
946 Ga0495624_0074468
947 Ga0495670_0098133
948 Ga0495671_0220164
949 Ga0495600_0045430
950 Ga0495581_0003407
951 Ga0495604_0000847
952 Ga0495604_0094507
953 Ga0495636_0194362
954 Ga0495674_0061607
955 Ga0495674_0091709
956 Ga0495674_0114412
957 Ga0495674_0330917
958 Ga0495676_0039058
959 Ga0495676_0448594
960 Ga0495676_0651616
961 Ga0495680_0016594
962 Ga0495680_0022970
963 Ga0495680_0058872
964 Ga0495680_0059551
965 Ga0495675_0000137
966 Ga0495675_0122813
967 Ga0495679_013665
968 Ga0495684_0012595
969 Ga0495684_0103727
970 Ga0495684_0785013
971 Ga0495593_0008432
972 Ga0495602_0000733
973 Ga0495614_0004562
974 Ga0496100_0004812
975 Ga0496100_0153649
976 Ga0496100_0352361
977 Ga0496100_0800518
978 Ga0496101_0085826
979 Ga0496101_0550463
980 Ga0496101_0696428
981 Ga0496102_0001719
982 Ga0496102_0068787
983 Ga0496102_0283621
984 Ga0496103_0148716
985 Ga0496104_0023791
986 Ga0496104_0041399
987 Ga0496104_0151405
988 Ga0496104_0184803
989 Ga0496105_0017143
990 Ga0496105_0092912
991 Ga0496105_0206207
992 Ga0496105_0237373
993 Ga0496106_0029860
994 Ga0496106_0453328
995 Ga0496107_0003518
996 Ga0496107_0079651
997 Ga0496108_0003564
998 Ga0496108_0005066
999 Ga0496108_0165583
1000 Ga0496109_0005012
1001 Ga0496109_0031188
1002 Ga0496109_0089590
1003 Ga0496109_0289056
1004 Ga0496109_0518895
1005 Ga0496110_0052783
1006 Ga0496110_0164894
1007 Ga0496110_0378318
1008 Ga0496111_0031522
1009 Ga0496111_0083665
1010 Ga0496111_0153316
1011 Ga0496111_0542239
1012 Ga0496112_0163212
1013 Ga0496112_0201923
1014 Ga0496112_0299601
1015 Ga0496112_0932496
1016 Ga0496114_0011420
1017 Ga0496114_0154099
1018 Ga0496114_0321016
1019 Ga0496114_0376391
1020 Ga0496115_0003422
1021 Ga0496115_0003592
1022 Ga0496115_0159425
1023 Ga0496115_0277322
1024 Ga0501040_0259456
1025 Ga0501041_0082839
1026 Ga0501043_0298834
1027 Ga0501067_0113289
1028 Ga0501068_0676744
1029 Ga0501069_0172606
1030 Ga0501071_0288863
1031 Ga0501072_0244382
1032 Ga0501075_0559267
1033 Ga0501076_0271800
1034 Ga0501079_0144867
1035 Ga0501079_0174158
1036 nmdc:mga08y16_187104_c1
1037 nmdc:mga0n895_435440_c1
1038 nmdc:mga0rr50_715083_c1
1039 nmdc:mga08x19_644262_c1
1040 nmdc:mga0a205_1184540_c1
1041 Ga0495601_0002178
1042 Ga0495601_0011903
1043 Ga0495601_0413162
1044 Ga0495601_0764372
1045 Ga0495612_0015122
1046 Ga0495612_0023169
1047 Ga0495612_0066547
1048 Ga0495612_0319180
1049 Ga0495595_0009594
1050 Ga0495595_0013567
1051 Ga0495595_0039249
1052 Ga0495595_0112471
1053 Ga0495595_0566009
1054 Ga0495619_0018551
1055 Ga0495619_0231049
1056 Ga0495619_0406020
1057 Ga0495619_0680590
1058 Ga0500566_0029077
1059 Ga0500608_314901
1060 Ga0501084_0237553
1061 Ga0501084_1508291
1062 Ga0466962_0006235
1063 Ga0466962_0019218
1064 Ga0466962_0045816
1065 Ga0466962_0128396
1066 Ga0530510_0202111
1067 Ga0530510_0205028
1068 Ga0530510_0555156

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05239

PRC

PRC-barrel domain

87

154

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cq1-assembly1.cif.gz_A solution structure of the c-terminal domain of mycobacterium tuberculosis ribosome maturation factor protein rimm 0.7991 90 159
3a1p-assembly2.cif.gz_C structure of ribosome maturation protein rimm and ribosomal protein s19 0.7654 7 157
7cq1-assembly1.cif.gz_A solution structure of the c-terminal domain of mycobacterium tuberculosis ribosome maturation factor protein rimm 0.7271 90 159
3a1p-assembly2.cif.gz_C structure of ribosome maturation protein rimm and ribosomal protein s19 0.7269 7 157
7jw4-assembly1.cif.gz_A-2 crystal structure of pdgh110b in complex with d-galactose 0.6933 9 80
ID Description Score Start End Superfamily
af_P0A7X6_101_182_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.9419 87 157 2.30.30.240
af_P9WH19_99_175_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.9399 87 156 2.30.30.240
af_Q2FZ44_92_167_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.9328 87 157 2.30.30.240
af_I1KSK3_174_274_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.9045 87 151 2.30.30.240
2f1lA02 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.8765 91 154 2.30.30.240
ID Description Score Start End GO Terms
AF-A0A3R8NDC9-F1-model_v4 16S rRNA processing protein RimM 0.9474 77 155 GO:0005840
GO:0006364
GO:0043022
AF-A0A538M9A1-F1-model_v4 Ribosome maturation factor RimM 0.9257 1 157 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A3D1ZCS0-F1-model_v4 16S rRNA processing protein RimM 0.9219 77 151 GO:0005840
GO:0006364
GO:0043022
AF-A0A7X5N2U9-F1-model_v4 Ribosome maturation factor RimM 0.9204 77 154 GO:0005737
GO:0005840
GO:0006364
GO:0043022
AF-A0A538G680-F1-model_v4 Ribosome maturation factor RimM 0.9174 2 157 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022

Map