F460511

General Info

Members Datasets Scaffolds Average Seq Length
534 286 534 227

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100653220|Ga0070714_1006532202
Length 256
Sequence VRQRGADSRIGIGGTFGASAPLLGSVRRGLTKGTDTTMPTNKDFKRVVRARMKKTGESYTTARAHLLTPSPKDYAAIAGMSEASVRKATGCTWDRWVKALDRAKADEWTHKEIAKYVHTTYKTPDWWTQMVTVGYERIKGLRARGQQRDGTYEVSKSKVVHAPVAVLFETFADAKQRRLWLEDVDAVVRSATKNKSVRMRWPDGSAVDIGFISKGDRKSQVAVGHTKLPSHADAARMKTFWSERLAAVASLAQNAG

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
173 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
178 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
179 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
191 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
224 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
225 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
226 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
227 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
228 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
229 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
230 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
238 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
239 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
240 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
241 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
262 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
263 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
264 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
265 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
266 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
267 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
268 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
273 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
281 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
282 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.81
Rhizosphere 96.07
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_7673102 2162886012 Bacteria 855
2 JGI24752J21851_1010574 3300001976 Bacteria 1203
3 Ga0065704_10161587 3300005289 Unclassified 1351
4 Ga0065712_10035463 3300005290 Bacteria 1073
5 Ga0065715_10116800 3300005293 Bacteria 2368
6 Ga0065707_10001855 3300005295 Bacteria 6835
7 Ga0070658_10017251 3300005327 Bacteria 5778
8 Ga0070683_100000027 3300005329 Bacteria 172200
9 Ga0070683_100008048 3300005329 Bacteria 8951
10 Ga0070683_100014013 3300005329 Bacteria 7002
11 Ga0070690_100000146 3300005330 Bacteria 35905
12 Ga0070690_100069693 3300005330 Unclassified 2282
13 Ga0070670_100000025 3300005331 Bacteria 188514
14 Ga0070670_100005564 3300005331 Bacteria 10626
15 Ga0070670_100016898 3300005331 Bacteria 6264
16 Ga0070677_10010457 3300005333 Bacteria 3175
17 Ga0068869_100006829 3300005334 Bacteria 7260
18 Ga0068869_100020256 3300005334 Unclassified 4560
19 Ga0068869_100081504 3300005334 Unclassified 2416
20 Ga0068869_100279865 3300005334 Bacteria 1341
21 Ga0068869_100314165 3300005334 Bacteria 1269
22 Ga0070666_10002161 3300005335 Bacteria 11948
23 Ga0070666_10055831 3300005335 Unclassified 2666
24 Ga0070680_100022903 3300005336 Bacteria 4977
25 Ga0070680_100125827 3300005336 Bacteria 2141
26 Ga0070682_100004781 3300005337 Bacteria 7528
27 Ga0070682_100130364 3300005337 Viruses 1701
28 Ga0068868_100000266 3300005338 Bacteria 35315
29 Ga0068868_100037436 3300005338 Unclassified 3761
30 Ga0070660_100020133 3300005339 Bacteria 4899
31 Ga0070689_100009333 3300005340 Bacteria 6956
32 Ga0070689_100051475 3300005340 Bacteria 3184
33 Ga0070689_100102734 3300005340 Unclassified 2264
34 Ga0070689_100650665 3300005340 Unclassified 917
35 Ga0070687_100479192 3300005343 Unclassified 833
36 Ga0070661_100028142 3300005344 Unclassified 4053
37 Ga0070661_100199635 3300005344 Unclassified 1528
38 Ga0070661_100228621 3300005344 Unclassified 1429
39 Ga0070692_10001788 3300005345 Bacteria 8033
40 Ga0070669_100021825 3300005353 Unclassified 4578
41 Ga0070675_100001783 3300005354 Bacteria 15885
42 Ga0070675_100086523 3300005354 Bacteria 2620
43 Ga0070675_100103884 3300005354 Bacteria 2396
44 Ga0070673_100441753 3300005364 Bacteria 1169
45 Ga0070688_100004044 3300005365 Bacteria 7610
46 Ga0070688_100223989 3300005365 Bacteria 1327
47 Ga0070659_100006358 3300005366 Bacteria 8532
48 Ga0070659_100330395 3300005366 Unclassified 1276
49 Ga0070667_100000282 3300005367 Bacteria 57538
50 Ga0070709_10098519 3300005434 Unclassified 1943
51 Ga0070714_100016282 3300005435 Bacteria 5998
52 Ga0070714_100653220 3300005435 Unclassified 1012
53 Ga0070714_100671017 3300005435 Bacteria 999
54 Ga0070713_100055308 3300005436 Unclassified 3297
55 Ga0070713_100390201 3300005436 Bacteria 1299
56 Ga0070711_100420922 3300005439 Bacteria 1088
57 Ga0070708_100089005 3300005445 Unclassified 2808
58 Ga0070708_100504670 3300005445 Unclassified 1141
59 Ga0070663_100016928 3300005455 Bacteria 4745
60 Ga0070662_100108125 3300005457 Unclassified 2115
61 Ga0070681_10057621 3300005458 Unclassified 3865
62 Ga0068867_100022753 3300005459 Bacteria 4483
63 Ga0068867_100064950 3300005459 Bacteria 2714
64 Ga0068867_100065081 3300005459 Bacteria 2712
65 Ga0070706_100003576 3300005467 Bacteria 15267
66 Ga0070706_100027713 3300005467 Bacteria 5212
67 Ga0070707_100003617 3300005468 Bacteria 14581
68 Ga0070707_100146248 3300005468 Bacteria 2300
69 Ga0070698_100472488 3300005471 Bacteria 1190
70 Ga0070698_100656466 3300005471 Bacteria 990
71 Ga0070699_100013122 3300005518 Bacteria 7142
72 Ga0070699_100378669 3300005518 Bacteria 1277
73 Ga0070699_101021502 3300005518 Unclassified 758
74 Ga0070679_100011977 3300005530 Bacteria 8279
75 Ga0070679_100021771 3300005530 Bacteria 6262
76 Ga0070684_100000051 3300005535 Bacteria 78284
77 Ga0070684_100070288 3300005535 Unclassified 3080
78 Ga0070684_100380830 3300005535 Unclassified 1299
79 Ga0070697_100460737 3300005536 Bacteria 1108
80 Ga0068853_100029426 3300005539 Bacteria 4631
81 Ga0068853_100159055 3300005539 Bacteria 2037
82 Ga0068853_100304228 3300005539 Bacteria 1474
83 Ga0070672_100000420 3300005543 Bacteria 24671
84 Ga0070686_100021930 3300005544 Bacteria 3801
85 Ga0070686_100034053 3300005544 Unclassified 3135
86 Ga0070686_100224569 3300005544 Bacteria 1359
87 Ga0070686_100304241 3300005544 Bacteria 1183
88 Ga0070695_100006090 3300005545 Bacteria 7127
89 Ga0070693_100008096 3300005547 Bacteria 5161
90 Ga0070665_100285902 3300005548 Bacteria 1651
91 Ga0070704_100009596 3300005549 Bacteria 5859
92 Ga0070704_100525999 3300005549 Bacteria 1030
93 Ga0068855_100144577 3300005563 Unclassified 2709
94 Ga0070664_100128366 3300005564 Unclassified 2226
95 Ga0070664_100141295 3300005564 Unclassified 2120
96 Ga0068857_100032547 3300005577 Unclassified 4611
97 Ga0068857_100076169 3300005577 Bacteria 2992
98 Ga0068857_100117186 3300005577 Bacteria 2397
99 Ga0068857_100141279 3300005577 Bacteria 2177
100 Ga0068857_100509806 3300005577 Bacteria 1130
101 Ga0068854_100137368 3300005578 Bacteria 1872
102 Ga0068854_100160484 3300005578 Bacteria 1741
103 Ga0068854_100162967 3300005578 Unclassified 1729
104 Ga0068856_100001651 3300005614 Bacteria 23387
105 Ga0068856_100006311 3300005614 Bacteria 11631
106 Ga0070702_100003281 3300005615 Bacteria 7207
107 Ga0070702_100008920 3300005615 Bacteria 4882
108 Ga0068852_100048719 3300005616 Unclassified 3622
109 Ga0068852_100566160 3300005616 Bacteria 1138
110 Ga0068859_100002112 3300005617 Bacteria 20238
111 Ga0068859_100033228 3300005617 Bacteria 5180
112 Ga0068859_100058825 3300005617 Bacteria 3872
113 Ga0068859_100145755 3300005617 Bacteria 2443
114 Ga0068864_100000580 3300005618 Bacteria 31085
115 Ga0068864_100010456 3300005618 Bacteria 7669
116 Ga0068861_100465050 3300005719 Unclassified 1136
117 Ga0068870_10004852 3300005840 Bacteria 5817
118 Ga0068870_10329890 3300005840 Unclassified 972
119 Ga0068863_100221561 3300005841 Bacteria 1823
120 Ga0068858_100000871 3300005842 Bacteria 31216
121 Ga0068858_100115816 3300005842 Unclassified 2505
122 Ga0068858_100225875 3300005842 Unclassified 1774
123 Ga0068860_100000830 3300005843 Bacteria 34607
124 Ga0068860_100022376 3300005843 Bacteria 6115
125 Ga0068862_100463335 3300005844 Unclassified 1197
126 Ga0070712_100043193 3300006175 Bacteria 3103
127 Ga0097621_100019644 3300006237 Bacteria 5191
128 Ga0097621_100024466 3300006237 Bacteria 4716
129 Ga0097621_100086213 3300006237 Unclassified 2620
130 Ga0097621_100593574 3300006237 Bacteria 1012
131 Ga0068871_100000568 3300006358 Bacteria 25277
132 Ga0068871_100005214 3300006358 Bacteria 9089
133 Ga0068871_100025225 3300006358 Bacteria 4622
134 Ga0068871_100045603 3300006358 Bacteria 3529
135 Ga0068871_100161685 3300006358 Unclassified 1916
136 Ga0075428_100000133 3300006844 Bacteria 65398
137 Ga0075428_100006115 3300006844 Bacteria 13393
138 Ga0075428_100032736 3300006844 Bacteria 5742
139 Ga0075428_100046596 3300006844 Bacteria 4761
140 Ga0075430_100237846 3300006846 Bacteria 1509
141 Ga0075430_100368523 3300006846 Bacteria 1186
142 Ga0075431_100240068 3300006847 Bacteria 1844
143 Ga0075433_10031847 3300006852 Bacteria 4511
144 Ga0075433_10152275 3300006852 Bacteria 2057
145 Ga0075433_10176837 3300006852 Bacteria 1899
146 Ga0075433_10560283 3300006852 Bacteria 1004
147 Ga0075434_100027372 3300006871 Bacteria 5597
148 Ga0075434_100050410 3300006871 Bacteria 4135
149 Ga0075434_100275492 3300006871 Bacteria 1702
150 Ga0075434_100995973 3300006871 Unclassified 852
151 Ga0075429_100202902 3300006880 Bacteria 1737
152 Ga0068865_100159279 3300006881 Bacteria 1720
153 Ga0075436_100009356 3300006914 Bacteria 6698
154 Ga0075436_100180802 3300006914 Bacteria 1490
155 Ga0075436_100339560 3300006914 Unclassified 1081
156 Ga0097620_100002112 3300006931 Bacteria 20238
157 Ga0097620_100033229 3300006931 Bacteria 5180
158 Ga0097620_100058819 3300006931 Bacteria 3872
159 Ga0097620_100145761 3300006931 Bacteria 2443
160 Ga0075435_100220970 3300007076 Bacteria 1609
161 Ga0075435_100347460 3300007076 Bacteria 1271
162 Ga0105240_10015759 3300009093 Bacteria 10258
163 Ga0111539_10000956 3300009094 Bacteria 37902
164 Ga0111539_10001970 3300009094 Bacteria 27408
165 Ga0111539_10010341 3300009094 Bacteria 11748
166 Ga0111539_10107966 3300009094 Bacteria 3266
167 Ga0105245_10000052 3300009098 Bacteria 126402
168 Ga0105245_10002042 3300009098 Bacteria 18314
169 Ga0114129_10024087 3300009147 Bacteria 8625
170 Ga0114129_10032311 3300009147 Bacteria 7397
171 Ga0114129_10486826 3300009147 Unclassified 1613
172 Ga0114129_10924043 3300009147 Bacteria 1104
173 Ga0105243_10401106 3300009148 Unclassified 1274
174 Ga0105241_10015958 3300009174 Bacteria 5504
175 Ga0105241_10037191 3300009174 Bacteria 3666
176 Ga0105241_10571033 3300009174 Unclassified 1018
177 Ga0105241_10649680 3300009174 Bacteria 958
178 Ga0105242_10006010 3300009176 Bacteria 9361
179 Ga0105242_10437594 3300009176 Unclassified 1229
180 Ga0105248_10001890 3300009177 Bacteria 23227
181 Ga0105248_10004371 3300009177 Bacteria 15638
182 Ga0105248_10155099 3300009177 Unclassified 2584
183 Ga0105248_10186011 3300009177 Unclassified 2341
184 Ga0105248_10468233 3300009177 Bacteria 1420
185 Ga0105248_11283198 3300009177 Unclassified 828
186 Ga0105237_10237252 3300009545 Bacteria 1825
187 Ga0105238_10000002 3300009551 Bacteria 772711
188 Ga0105238_10780517 3300009551 Bacteria 970
189 Ga0105249_10717613 3300009553 Unclassified 1060
190 Ga0105249_11353505 3300009553 Unclassified 784
191 Ga0105239_10089963 3300010375 Unclassified 3386
192 Ga0105246_10001534 3300011119 Bacteria 13699
193 Ga0105246_10037011 3300011119 Unclassified 3273
194 Ga0157373_10048818 3300013100 Unclassified 3017
195 Ga0157373_10606954 3300013100 Bacteria 797
196 Ga0157370_10013271 3300013104 Bacteria 8490
197 Ga0157369_10000431 3300013105 Bacteria 55677
198 Ga0157369_10150218 3300013105 Unclassified 2462
199 Ga0157369_10911616 3300013105 Unclassified 901
200 Ga0157374_10000016 3300013296 Bacteria 293656
201 Ga0157374_10034535 3300013296 Unclassified 4620
202 Ga0157378_10003882 3300013297 Bacteria 13235
203 Ga0157378_10173448 3300013297 Bacteria 2024
204 Ga0157378_10829227 3300013297 Unclassified 952
205 Ga0163162_10034049 3300013306 Bacteria 5067
206 Ga0157372_10008784 3300013307 Bacteria 10731
207 Ga0157372_10041862 3300013307 Bacteria 5065
208 Ga0157372_10412569 3300013307 Unclassified 1574
209 Ga0157372_10470618 3300013307 Bacteria 1465
210 Ga0157375_10000010 3300013308 Bacteria 361011
211 Ga0157375_10000018 3300013308 Bacteria 285123
212 Ga0157375_10000185 3300013308 Bacteria 58274
213 Ga0157375_10004658 3300013308 Bacteria 11925
214 Ga0157375_10005944 3300013308 Bacteria 10636
215 Ga0157375_10066702 3300013308 Bacteria 3594
216 Ga0163163_10053471 3300014325 Unclassified 3986
217 Ga0163163_10116498 3300014325 Bacteria 2703
218 Ga0157380_10015824 3300014326 Bacteria 5548
219 Ga0157380_10594270 3300014326 Unclassified 1094
220 Ga0157377_10000004 3300014745 Bacteria 430019
221 Ga0157377_10000059 3300014745 Bacteria 84812
222 Ga0157377_10001123 3300014745 Bacteria 11338
223 Ga0157379_10007306 3300014968 Bacteria 9559
224 Ga0157376_10000018 3300014969 Bacteria 259397
225 Ga0157376_10004096 3300014969 Bacteria 10092
226 Ga0157376_10014892 3300014969 Bacteria 5856
227 Ga0157376_10049209 3300014969 Bacteria 3490
228 Ga0157376_10384146 3300014969 Bacteria 1353
229 Ga0182007_10068579 3300015262 Unclassified 1162
230 Ga0197907_10622141 3300020069 Bacteria 1117
231 Ga0206356_11009395 3300020070 Bacteria 1031
232 Ga0206356_11242621 3300020070 Bacteria 1104
233 Ga0206354_11555495 3300020081 Bacteria 963
234 Ga0213876_10000151 3300021384 Bacteria 74197
235 Ga0213876_10007075 3300021384 Bacteria 6116
236 Ga0207682_10007718 3300025893 Bacteria 4278
237 Ga0207680_10000344 3300025903 Bacteria 22220
238 Ga0207643_10003261 3300025908 Bacteria 8762
239 Ga0207643_10316007 3300025908 Unclassified 974
240 Ga0207684_10405718 3300025910 Bacteria 1171
241 Ga0207654_10046822 3300025911 Unclassified 2468
242 Ga0207654_10515191 3300025911 Unclassified 846
243 Ga0207707_10012424 3300025912 Bacteria 7403
244 Ga0207707_10029212 3300025912 Bacteria 4819
245 Ga0207707_10242083 3300025912 Bacteria 1568
246 Ga0207695_10064878 3300025913 Bacteria 3757
247 Ga0207695_10098109 3300025913 Bacteria 2930
248 Ga0207693_10051212 3300025915 Bacteria 3241
249 Ga0207663_10108523 3300025916 Unclassified 1879
250 Ga0207663_10336153 3300025916 Bacteria 1139
251 Ga0207660_10033324 3300025917 Bacteria 3562
252 Ga0207662_10021681 3300025918 Bacteria 3675
253 Ga0207662_10114186 3300025918 Unclassified 1687
254 Ga0207657_10036380 3300025919 Bacteria 4406
255 Ga0207649_10006807 3300025920 Bacteria 6210
256 Ga0207649_10022301 3300025920 Bacteria 3657
257 Ga0207649_10341944 3300025920 Bacteria 1105
258 Ga0207652_10095136 3300025921 Unclassified 2624
259 Ga0207652_10311354 3300025921 Unclassified 1421
260 Ga0207646_10001225 3300025922 Bacteria 32229
261 Ga0207646_10103278 3300025922 Bacteria 2556
262 Ga0207681_10303472 3300025923 Unclassified 1264
263 Ga0207694_10000001 3300025924 Bacteria 4078485
264 Ga0207650_10000079 3300025925 Bacteria 130505
265 Ga0207650_10010564 3300025925 Bacteria 6340
266 Ga0207659_10007570 3300025926 Bacteria 6689
267 Ga0207659_10025236 3300025926 Unclassified 3991
268 Ga0207659_10247572 3300025926 Bacteria 1445
269 Ga0207687_10000005 3300025927 Bacteria 770649
270 Ga0207687_10025397 3300025927 Unclassified 3964
271 Ga0207664_10445493 3300025929 Unclassified 1155
272 Ga0207644_10482427 3300025931 Bacteria 1021
273 Ga0207690_10387316 3300025932 Bacteria 1112
274 Ga0207706_10004331 3300025933 Bacteria 13324
275 Ga0207709_10097459 3300025935 Bacteria 1937
276 Ga0207670_10005533 3300025936 Bacteria 6943
277 Ga0207670_10106439 3300025936 Bacteria 2012
278 Ga0207670_10362489 3300025936 Bacteria 1150
279 Ga0207670_10563158 3300025936 Unclassified 932
280 Ga0207704_10123885 3300025938 Bacteria 1775
281 Ga0207691_10001597 3300025940 Bacteria 22526
282 Ga0207691_10011126 3300025940 Bacteria 8637
283 Ga0207691_10040017 3300025940 Unclassified 4334
284 Ga0207691_10065499 3300025940 Unclassified 3288
285 Ga0207711_10000705 3300025941 Bacteria 32901
286 Ga0207711_10079844 3300025941 Unclassified 2856
287 Ga0207711_10102289 3300025941 Unclassified 2536
288 Ga0207689_10002615 3300025942 Bacteria 16671
289 Ga0207689_10140770 3300025942 Bacteria 1987
290 Ga0207689_10317842 3300025942 Bacteria 1292
291 Ga0207689_10321678 3300025942 Bacteria 1284
292 Ga0207661_10000015 3300025944 Bacteria 318960
293 Ga0207661_10024610 3300025944 Unclassified 4564
294 Ga0207661_10152934 3300025944 Bacteria 1996
295 Ga0207679_10007391 3300025945 Bacteria 6965
296 Ga0207679_10151974 3300025945 Unclassified 1885
297 Ga0207651_10111121 3300025960 Unclassified 2057
298 Ga0207651_10139148 3300025960 Bacteria 1872
299 Ga0207640_10006449 3300025981 Bacteria 6440
300 Ga0207640_10065628 3300025981 Bacteria 2422
301 Ga0207640_10146551 3300025981 Bacteria 1728
302 Ga0207658_10086647 3300025986 Unclassified 2416
303 Ga0207677_10000086 3300026023 Bacteria 78341
304 Ga0207677_10166277 3300026023 Bacteria 1720
305 Ga0207703_10002356 3300026035 Bacteria 16454
306 Ga0207703_10204833 3300026035 Unclassified 1755
307 Ga0207703_10590266 3300026035 Unclassified 1050
308 Ga0207639_10126613 3300026041 Bacteria 2108
309 Ga0207639_10177291 3300026041 Bacteria 1810
310 Ga0207678_10029502 3300026067 Bacteria 4788
311 Ga0207708_10113193 3300026075 Bacteria 2108
312 Ga0207708_10146536 3300026075 Bacteria 1856
313 Ga0207702_10004929 3300026078 Bacteria 11731
314 Ga0207702_10088898 3300026078 Bacteria 2700
315 Ga0207641_10031186 3300026088 Bacteria 4420
316 Ga0207648_10086434 3300026089 Unclassified 2736
317 Ga0207648_10086949 3300026089 Bacteria 2728
318 Ga0207648_10385709 3300026089 Bacteria 1267
319 Ga0207676_10000278 3300026095 Bacteria 44651
320 Ga0207676_10008189 3300026095 Bacteria 7437
321 Ga0207676_10373364 3300026095 Unclassified 1326
322 Ga0207674_10001215 3300026116 Bacteria 33539
323 Ga0207674_10104537 3300026116 Bacteria 2810
324 Ga0207674_10297296 3300026116 Bacteria 1563
325 Ga0207675_100480264 3300026118 Unclassified 1235
326 Ga0207683_10455215 3300026121 Bacteria 1180
327 Ga0207698_10012930 3300026142 Bacteria 5487
328 Ga0207698_10944844 3300026142 Bacteria 871
329 Ga0207428_10008928 3300027907 Bacteria 9027
330 Ga0207428_10098935 3300027907 Unclassified 2256
331 Ga0207428_10622383 3300027907 Bacteria 776
332 Ga0268266_10010928 3300028379 Bacteria 7902
333 Ga0268265_10703070 3300028380 Unclassified 977
334 Ga0268264_10001110 3300028381 Bacteria 26593
335 Ga0268264_10035571 3300028381 Unclassified 4100
336 Ga0307511_10023640 3300030521 Bacteria 5721
337 Ga0307408_100140514 3300031548 Unclassified 1895
338 Ga0307405_10155536 3300031731 Unclassified 1613
339 Ga0307405_10399455 3300031731 Unclassified 1075
340 Ga0307413_10072892 3300031824 Bacteria 2169
341 Ga0307410_10548840 3300031852 Unclassified 957
342 Ga0307406_10261568 3300031901 Unclassified 1309
343 Ga0307412_10175522 3300031911 Unclassified 1606
344 Ga0307409_100030756 3300031995 Bacteria 3863
345 Ga0307409_100226557 3300031995 Unclassified 1691
346 Ga0307416_100501436 3300032002 Bacteria 1278
347 Ga0307414_10667579 3300032004 Unclassified 938
348 Ga0373934_0009753 3300035086 Bacteria 3603
349 Ga0373934_0172825 3300035086 Unclassified 887
350 Ga0373944_0005005 3300035089 Bacteria 3476
351 Ga0373944_0074698 3300035089 Bacteria 1110
352 Ga0373923_0015495 3300035111 Bacteria 2879
353 Ga0373923_0016230 3300035111 Unclassified 2825
354 Ga0373923_0069073 3300035111 Bacteria 1514
355 Ga0373945_0079063 3300035116 Bacteria 1257
356 Ga0373954_0021358 3300035118 Bacteria 2931
357 Ga0373956_0072245 3300035119 Bacteria 1575
358 Ga0373956_0201063 3300035119 Bacteria 944
359 Ga0373943_0033782 3300035170 Bacteria 2438
360 Ga0373943_0232480 3300035170 Bacteria 1030
361 Ga0373943_0310495 3300035170 Unclassified 897
362 Ga0373943_0350854 3300035170 Unclassified 845
363 Ga0373946_0022309 3300035171 Bacteria 2463
364 Ga0373946_0040949 3300035171 Bacteria 1898
365 Ga0373955_0000789 3300035172 Bacteria 13591
366 Ga0373955_0045131 3300035172 Bacteria 2377
367 Ga0373955_0349155 3300035172 Bacteria 896
368 Ga0373924_0013674 3300035410 Bacteria 3053
369 Ga0373931_0002737 3300035691 Bacteria 7840
370 Ga0373935_0039629 3300035692 Bacteria 2954
371 Ga0373935_0046096 3300035692 Bacteria 2753
372 Ga0373935_0218688 3300035692 Bacteria 1322
373 Ga0373933_0000245 3300035724 Bacteria 35837
374 Ga0373947_0005772 3300035725 Bacteria 7222
375 Ga0373937_0000452 3300036401 Bacteria 37877
376 Ga0373937_0424243 3300036401 Bacteria 1262
377 Ga0373925_0005514 3300037068 Bacteria 9419
378 Ga0373925_0057229 3300037068 Unclassified 2921
379 Ga0373925_0087903 3300037068 Unclassified 2373
380 Ga0373925_0137251 3300037068 Unclassified 1912
381 Ga0373925_0178304 3300037068 Bacteria 1680
382 Ga0436365_0039397 3300039437 Bacteria 2672
383 Ga0436365_0076143 3300039437 Bacteria 30351
384 Ga0436365_1639687 3300039437 Bacteria 3929
385 Ga0436362_0782701 3300039453 Bacteria 15623
386 Ga0453683_0258092 3300044673 Bacteria 1111
387 Ga0466966_0229158 3300044684 Unclassified 1121
388 Ga0466963_0311391 3300044694 Bacteria 1108
389 Ga0466959_0140726 3300045049 Bacteria 1705
390 Ga0451576_0007069 3300045051 Bacteria 13562
391 Ga0451576_0211343 3300045051 Unclassified 2026
392 Ga0466958_0049479 3300045836 Unclassified 2543
393 Ga0466967_0053224 3300045976 Bacteria 3557
394 Ga0495592_0006789 3300046454 Bacteria 8540
395 Ga0495592_0017704 3300046454 Bacteria 5414
396 Ga0495603_0015058 3300046455 Bacteria 4675
397 Ga0495629_0124471 3300046459 Bacteria 1796
398 Ga0495629_0220221 3300046459 Unclassified 1309
399 Ga0495651_0000069 3300046462 Bacteria 75854
400 Ga0495653_0000278 3300046463 Bacteria 41522
401 Ga0495580_0007205 3300046472 Bacteria 8951
402 Ga0495580_0080198 3300046472 Unclassified 2276
403 Ga0495580_0093019 3300046472 Bacteria 2098
404 Ga0495580_0111667 3300046472 Bacteria 1898
405 Ga0495582_0002775 3300046473 Bacteria 9774
406 Ga0495582_0006186 3300046473 Bacteria 6664
407 Ga0495639_0027751 3300046475 Bacteria 2506
408 Ga0495639_0039161 3300046475 Bacteria 2130
409 Ga0495664_0011043 3300046477 Bacteria 5081
410 Ga0495664_0147843 3300046477 Unclassified 1425
411 Ga0495594_0025929 3300046499 Unclassified 3152
412 Ga0495608_0001281 3300046511 Bacteria 17855
413 Ga0495608_0072816 3300046511 Bacteria 2241
414 Ga0495618_0138808 3300046514 Unclassified 1554
415 Ga0495620_0055283 3300046515 Bacteria 1673
416 Ga0495628_0000685 3300046516 Bacteria 31225
417 Ga0495630_0001791 3300046517 Bacteria 14992
418 Ga0495630_0033254 3300046517 Bacteria 3844
419 Ga0495666_0006745 3300046526 Bacteria 5774
420 Ga0495666_0206100 3300046526 Unclassified 903
421 Ga0495652_0000422 3300046529 Bacteria 49538
422 Ga0495665_0003789 3300046531 Bacteria 8183
423 Ga0495665_0020783 3300046531 Unclassified 3526
424 Ga0495665_0207182 3300046531 Unclassified 1015
425 Ga0495640_0133215 3300046533 Unclassified 1607
426 Ga0495587_0000165 3300046536 Bacteria 48041
427 Ga0495587_0022373 3300046536 Bacteria 3892
428 Ga0495598_0077904 3300046537 Bacteria 1058
429 Ga0495645_0000317 3300046543 Bacteria 34634
430 Ga0495645_0005395 3300046543 Bacteria 8768
431 Ga0495622_0249502 3300046557 Unclassified 781
432 Ga0495667_0007967 3300046559 Bacteria 7185
433 Ga0495634_0085026 3300046642 Bacteria 2062
434 Ga0495634_0311258 3300046642 Bacteria 950
435 Ga0495635_0001959 3300046663 Bacteria 13993
436 Ga0495588_0037688 3300046674 Bacteria 2457
437 Ga0495657_0000540 3300046675 Bacteria 34951
438 Ga0495599_0001255 3300046678 Bacteria 14402
439 Ga0495599_0008791 3300046678 Bacteria 6146
440 Ga0495623_0000272 3300046679 Bacteria 33587
441 Ga0495646_0000361 3300046680 Bacteria 23483
442 Ga0495646_0298639 3300046680 Bacteria 852
443 Ga0495658_0000148 3300046683 Bacteria 39132
444 Ga0495658_0025803 3300046683 Bacteria 3145
445 Ga0495669_0009802 3300046684 Bacteria 4045
446 Ga0495613_0043765 3300046689 Bacteria 3313
447 Ga0495613_0175459 3300046689 Bacteria 1519
448 Ga0495600_0104582 3300046809 Bacteria 1845
449 Ga0495581_0052073 3300047315 Bacteria 2364
450 Ga0495581_0094643 3300047315 Unclassified 1734
451 Ga0495604_0000028 3300047317 Bacteria 141804
452 Ga0495674_0003785 3300047319 Bacteria 14706
453 Ga0495674_0079231 3300047319 Bacteria 2821
454 Ga0495676_0257973 3300047321 Unclassified 1187
455 Ga0495680_0001253 3300047322 Bacteria 27785
456 Ga0495680_0063685 3300047322 Bacteria 2831
457 Ga0495675_0013685 3300047444 Bacteria 5126
458 Ga0495675_0014131 3300047444 Bacteria 5047
459 Ga0495684_0000044 3300047471 Bacteria 93511
460 Ga0495684_0005572 3300047471 Bacteria 9805
461 Ga0495684_0022733 3300047471 Unclassified 4822
462 Ga0495593_0000211 3300047673 Bacteria 30695
463 Ga0495593_0184385 3300047673 Bacteria 1051
464 Ga0495602_0000294 3300048088 Bacteria 45754
465 Ga0495614_0000092 3300048089 Bacteria 30125
466 Ga0495614_0113810 3300048089 Unclassified 1189
467 Ga0496100_0106982 3300048903 Bacteria 1937
468 Ga0496101_0028966 3300048904 Bacteria 3871
469 Ga0496102_0004034 3300048905 Bacteria 12443
470 Ga0496104_0174090 3300048907 Bacteria 2063
471 Ga0496104_0681655 3300048907 Unclassified 936
472 Ga0496105_0196408 3300048908 Bacteria 1648
473 Ga0496106_0000937 3300048909 Bacteria 21256
474 Ga0496107_0003384 3300048910 Bacteria 10664
475 Ga0496108_0073222 3300048911 Bacteria 2893
476 Ga0496108_0498735 3300048911 Unclassified 1063
477 Ga0496110_0088223 3300048913 Bacteria 2770
478 Ga0496111_0110355 3300048914 Bacteria 2026
479 Ga0496112_0003264 3300048915 Bacteria 13386
480 Ga0496112_0884249 3300048915 Bacteria 816
481 Ga0496113_0629283 3300048916 Bacteria 859
482 Ga0501031_0223997 3300049568 Bacteria 1224
483 Ga0501036_0373206 3300049572 Bacteria 1191
484 Ga0501036_0399192 3300049572 Bacteria 1147
485 Ga0501039_0167194 3300049575 Bacteria 1729
486 Ga0501040_0127153 3300049576 Unclassified 1790
487 Ga0501042_0200937 3300049578 Unclassified 1437
488 Ga0501043_0405273 3300049579 Unclassified 1030
489 Ga0501046_0180123 3300049580 Bacteria 1581
490 Ga0501068_0121953 3300049584 Unclassified 1626
491 Ga0501071_0628642 3300049587 Unclassified 826
492 Ga0501071_0788614 3300049587 Unclassified 732
493 Ga0501072_0082718 3300049588 Bacteria 2545
494 Ga0501073_0004716 3300049589 Bacteria 10243
495 Ga0501075_0028110 3300049591 Bacteria 4149
496 Ga0501075_0133534 3300049591 Bacteria 1891
497 Ga0501075_0180732 3300049591 Bacteria 1609
498 Ga0501076_0277225 3300049592 Unclassified 1373
499 Ga0501077_0000559 3300049593 Bacteria 22635
500 Ga0501079_0085984 3300049741 Bacteria 2434
501 Ga0501080_0035078 3300049742 Bacteria 4683
502 Ga0501045_0281387 3300049824 Unclassified 1238
503 nmdc:mga05p37_35759_c1 3300050507 Bacteria 6092
504 nmdc:mga05p37_51832_c1 3300050507 Bacteria 5046
505 nmdc:mga09592_429532_c1 3300050508 Bacteria 1141
506 nmdc:mga0qj67_40649_c1 3300050509 Bacteria 3655
507 nmdc:mga06r32_200449_c1 3300050510 Bacteria 1984
508 nmdc:mga06r32_680126_c1 3300050510 Bacteria 996
509 nmdc:mga08y16_196514_c1 3300050511 Bacteria 2091
510 nmdc:mga08y16_259330_c1 3300050511 Bacteria 1795
511 nmdc:mga0n895_46773_c1 3300050512 Bacteria 4229
512 nmdc:mga0n895_6608_c1 3300050512 Bacteria 9871
513 nmdc:mga0n895_80243_c1 3300050512 Bacteria 3251
514 nmdc:mga0rr50_10508_c1 3300050513 Bacteria 5877
515 nmdc:mga0rr50_166244_c1 3300050513 Bacteria 1794
516 nmdc:mga0rr50_211288_c1 3300050513 Unclassified 1599
517 nmdc:mga0rr50_332765_c1 3300050513 Bacteria 1275
518 nmdc:mga08x19_1565_c1 3300050514 Bacteria 14197
519 nmdc:mga08x19_7725_c1 3300050514 Bacteria 6387
520 nmdc:mga0a205_2302_c1 3300050515 Bacteria 16855
521 nmdc:mga0a205_34957_c1 3300050515 Unclassified 2824
522 nmdc:mga0a205_76227_c1 3300050515 Unclassified 3240
523 Ga0495601_0056696 3300053077 Bacteria 2481
524 Ga0495601_0065040 3300053077 Bacteria 2321
525 Ga0495612_0000242 3300053078 Bacteria 22605
526 Ga0495612_0040626 3300053078 Bacteria 1895
527 Ga0495595_0026679 3300053084 Bacteria 2568
528 Ga0495595_0129273 3300053084 Bacteria 1234
529 Ga0495619_0014895 3300053085 Bacteria 4912
530 Ga0495619_0076635 3300053085 Bacteria 2245
531 Ga0501084_0552984 3300054114 Unclassified 972
532 Ga0501082_0031450 3300060353 Bacteria 4577
533 Ga0501082_0731350 3300060353 Unclassified 866
534 Ga0530510_0292077 3300061734 Bacteria 1219

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026089 Ga0207648_10385709 Ga0207648_103857092 175
2 3300025944 Ga0207661_10152934 Ga0207661_101529342 182
3 3300048089 Ga0495614_0113810 Ga0495614_0113810_577_1167 182
4 3300048907 Ga0496104_0681655 Ga0496104_0681655_326_919 183
5 3300021384 Ga0213876_10007075 Ga0213876_100070753 191
6 3300039437 Ga0436365_1639687 Ga0436365_1639687_208_912 191
7 3300049587 Ga0501071_0628642 Ga0501071_0628642_31_639 198
8 3300005340 Ga0070689_100051475 Ga0070689_1000514752 199
9 3300026075 Ga0207708_10113193 Ga0207708_101131933 199
10 3300045836 Ga0466958_0049479 Ga0466958_0049479_1650_2378 199
11 3300049579 Ga0501043_0405273 Ga0501043_0405273_360_1001 199
12 3300005334 Ga0068869_100279865 Ga0068869_1002798652 200
13 3300006844 Ga0075428_100046596 Ga0075428_1000465963 200
14 3300013306 Ga0163162_10034049 Ga0163162_100340493 200
15 3300025942 Ga0207689_10317842 Ga0207689_103178421 200
16 3300009177 Ga0105248_10468233 Ga0105248_104682331 201
17 3300035170 Ga0373943_0310495 Ga0373943_0310495_60_764 201
18 3300037068 Ga0373925_0087903 Ga0373925_0087903_1414_2118 201
19 3300048915 Ga0496112_0884249 Ga0496112_0884249_172_789 201
20 3300009093 Ga0105240_10015759 Ga0105240_100157592 202
21 3300009174 Ga0105241_10649680 Ga0105241_106496801 202
22 3300013100 Ga0157373_10606954 Ga0157373_106069541 202
23 3300013105 Ga0157369_10150218 Ga0157369_101502183 202
24 3300013307 Ga0157372_10008784 Ga0157372_100087843 202
25 3300014969 Ga0157376_10000018 Ga0157376_10000018137 202
26 3300037068 Ga0373925_0178304 Ga0373925_0178304_1003_1668 202
27 3300046472 Ga0495580_0093019 Ga0495580_0093019_1408_2073 202
28 3300046680 Ga0495646_0298639 Ga0495646_0298639_167_820 202
29 3300050515 nmdc:mga0a205_34957_c1 nmdc:mga0a205_34957_c1_2205_2813 202
30 3300009551 Ga0105238_10000002 Ga0105238_10000002252 203
31 3300025924 Ga0207694_10000001 Ga0207694_10000001253 203
32 3300044673 Ga0453683_0258092 Ga0453683_0258092_21_692 203
33 3300045051 Ga0451576_0007069 Ga0451576_0007069_2025_2696 203
34 3300005578 Ga0068854_100137368 Ga0068854_1001373682 204
35 3300013296 Ga0157374_10000016 Ga0157374_10000016162 204
36 3300014745 Ga0157377_10000004 Ga0157377_10000004119 204
37 3300025936 Ga0207670_10362489 Ga0207670_103624892 204
38 3300025981 Ga0207640_10146551 Ga0207640_101465512 204
39 3300005467 Ga0070706_100027713 Ga0070706_1000277133 205
40 3300005468 Ga0070707_100146248 Ga0070707_1001462483 205
41 3300005471 Ga0070698_100472488 Ga0070698_1004724882 205
42 3300005518 Ga0070699_100378669 Ga0070699_1003786691 205
43 3300025922 Ga0207646_10103278 Ga0207646_101032782 205
44 3300044694 Ga0466963_0311391 Ga0466963_0311391_84_809 206
45 3300005445 Ga0070708_100089005 Ga0070708_1000890052 207
46 3300005467 Ga0070706_100003576 Ga0070706_1000035765 207
47 3300005468 Ga0070707_100003617 Ga0070707_1000036177 207
48 3300005518 Ga0070699_100013122 Ga0070699_1000131223 207
49 3300025922 Ga0207646_10001225 Ga0207646_100012253 207
50 3300005340 Ga0070689_100650665 Ga0070689_1006506651 209
51 3300005343 Ga0070687_100479192 Ga0070687_1004791921 209
52 3300005459 Ga0068867_100064950 Ga0068867_1000649502 209
53 3300009148 Ga0105243_10401106 Ga0105243_104011062 209
54 3300009176 Ga0105242_10437594 Ga0105242_104375942 209
55 3300014326 Ga0157380_10594270 Ga0157380_105942702 209
56 3300025936 Ga0207670_10563158 Ga0207670_105631581 209
57 3300026075 Ga0207708_10146536 Ga0207708_101465362 209
58 3300026089 Ga0207648_10086434 Ga0207648_100864343 209
59 3300026095 Ga0207676_10373364 Ga0207676_103733641 209
60 3300005436 Ga0070713_100055308 Ga0070713_1000553083 210
61 3300005617 Ga0068859_100145755 Ga0068859_1001457552 210
62 3300005844 Ga0068862_100463335 Ga0068862_1004633352 210
63 3300006914 Ga0075436_100339560 Ga0075436_1003395601 210
64 3300006931 Ga0097620_100145761 Ga0097620_1001457612 210
65 3300028380 Ga0268265_10703070 Ga0268265_107030701 210
66 3300005331 Ga0070670_100016898 Ga0070670_1000168983 212
67 3300005435 Ga0070714_100653220 Ga0070714_1006532202 212
68 3300005544 Ga0070686_100224569 Ga0070686_1002245691 212
69 3300005577 Ga0068857_100076169 Ga0068857_1000761692 212
70 3300049572 Ga0501036_0399192 Ga0501036_0399192_453_1103 212
71 3300049591 Ga0501075_0133534 Ga0501075_0133534_78_728 212
72 3300049741 Ga0501079_0085984 Ga0501079_0085984_317_967 212
73 3300005290 Ga0065712_10035463 Ga0065712_100354632 213
74 3300009177 Ga0105248_10155099 Ga0105248_101550992 213
75 3300009177 Ga0105248_11283198 Ga0105248_112831981 213
76 3300025941 Ga0207711_10102289 Ga0207711_101022894 213
77 3300026116 Ga0207674_10104537 Ga0207674_101045372 213
78 3300049575 Ga0501039_0167194 Ga0501039_0167194_519_1202 213
79 3300049576 Ga0501040_0127153 Ga0501040_0127153_610_1293 213
80 3300049578 Ga0501042_0200937 Ga0501042_0200937_287_970 213
81 3300049580 Ga0501046_0180123 Ga0501046_0180123_592_1275 213
82 3300049584 Ga0501068_0121953 Ga0501068_0121953_856_1539 213
83 3300049587 Ga0501071_0788614 Ga0501071_0788614_24_707 213
84 3300049588 Ga0501072_0082718 Ga0501072_0082718_1294_1977 213
85 3300049589 Ga0501073_0004716 Ga0501073_0004716_6002_6682 213
86 3300049591 Ga0501075_0028110 Ga0501075_0028110_366_1049 213
87 3300049592 Ga0501076_0277225 Ga0501076_0277225_21_704 213
88 3300049593 Ga0501077_0000559 Ga0501077_0000559_9452_10135 213
89 3300049742 Ga0501080_0035078 Ga0501080_0035078_2978_3658 213
90 3300049824 Ga0501045_0281387 Ga0501045_0281387_538_1221 213
91 3300054114 Ga0501084_0552984 Ga0501084_0552984_13_696 213
92 3300060353 Ga0501082_0031450 Ga0501082_0031450_2318_3001 213
93 3300001976 JGI24752J21851_1010574 JGI24752J21851_10105742 214
94 3300005329 Ga0070683_100008048 Ga0070683_1000080481 214
95 3300005329 Ga0070683_100014013 Ga0070683_1000140133 214
96 3300005330 Ga0070690_100069693 Ga0070690_1000696932 214
97 3300005331 Ga0070670_100005564 Ga0070670_1000055643 214
98 3300005334 Ga0068869_100020256 Ga0068869_1000202562 214
99 3300005335 Ga0070666_10055831 Ga0070666_100558312 214
100 3300005336 Ga0070680_100022903 Ga0070680_1000229033 214
101 3300005337 Ga0070682_100004781 Ga0070682_1000047813 214
102 3300005338 Ga0068868_100037436 Ga0068868_1000374362 214
103 3300005339 Ga0070660_100020133 Ga0070660_1000201334 214
104 3300005340 Ga0070689_100102734 Ga0070689_1001027343 214
105 3300005344 Ga0070661_100028142 Ga0070661_1000281422 214
106 3300005354 Ga0070675_100001783 Ga0070675_1000017833 214
107 3300005365 Ga0070688_100223989 Ga0070688_1002239891 214
108 3300005366 Ga0070659_100006358 Ga0070659_1000063581 214
109 3300005434 Ga0070709_10098519 Ga0070709_100985192 214
110 3300005457 Ga0070662_100108125 Ga0070662_1001081252 214
111 3300005458 Ga0070681_10057621 Ga0070681_100576213 214
112 3300005530 Ga0070679_100011977 Ga0070679_1000119774 214
113 3300005535 Ga0070684_100070288 Ga0070684_1000702881 214
114 3300005539 Ga0068853_100029426 Ga0068853_1000294263 214
115 3300005544 Ga0070686_100034053 Ga0070686_1000340531 214
116 3300005544 Ga0070686_100304241 Ga0070686_1003042411 214
117 3300005545 Ga0070695_100006090 Ga0070695_1000060903 214
118 3300005547 Ga0070693_100008096 Ga0070693_1000080963 214
119 3300005564 Ga0070664_100141295 Ga0070664_1001412952 214
120 3300005577 Ga0068857_100032547 Ga0068857_1000325473 214
121 3300005577 Ga0068857_100117186 Ga0068857_1001171862 214
122 3300005614 Ga0068856_100006311 Ga0068856_1000063113 214
123 3300005615 Ga0070702_100003281 Ga0070702_1000032813 214
124 3300005616 Ga0068852_100048719 Ga0068852_1000487193 214
125 3300005617 Ga0068859_100033228 Ga0068859_1000332282 214
126 3300005618 Ga0068864_100010456 Ga0068864_1000104563 214
127 3300005719 Ga0068861_100465050 Ga0068861_1004650501 214
128 3300005840 Ga0068870_10329890 Ga0068870_103298902 214
129 3300005842 Ga0068858_100115816 Ga0068858_1001158163 214
130 3300005843 Ga0068860_100022376 Ga0068860_1000223764 214
131 3300006237 Ga0097621_100086213 Ga0097621_1000862133 214
132 3300006358 Ga0068871_100005214 Ga0068871_1000052147 214
133 3300006931 Ga0097620_100033229 Ga0097620_1000332292 214
134 3300009094 Ga0111539_10107966 Ga0111539_101079664 214
135 3300009098 Ga0105245_10002042 Ga0105245_1000204216 214
136 3300009147 Ga0114129_10486826 Ga0114129_104868262 214
137 3300009174 Ga0105241_10015958 Ga0105241_100159585 214
138 3300009176 Ga0105242_10006010 Ga0105242_100060107 214
139 3300009177 Ga0105248_10004371 Ga0105248_1000437113 214
140 3300009177 Ga0105248_10186011 Ga0105248_101860112 214
141 3300009553 Ga0105249_10717613 Ga0105249_107176132 214
142 3300009553 Ga0105249_11353505 Ga0105249_113535051 214
143 3300010375 Ga0105239_10089963 Ga0105239_100899633 214
144 3300011119 Ga0105246_10001534 Ga0105246_100015347 214
145 3300013100 Ga0157373_10048818 Ga0157373_100488183 214
146 3300013105 Ga0157369_10911616 Ga0157369_109116161 214
147 3300013296 Ga0157374_10034535 Ga0157374_100345353 214
148 3300013307 Ga0157372_10041862 Ga0157372_100418623 214
149 3300013307 Ga0157372_10412569 Ga0157372_104125692 214
150 3300013308 Ga0157375_10005944 Ga0157375_100059446 214
151 3300014325 Ga0163163_10053471 Ga0163163_100534713 214
152 3300014325 Ga0163163_10116498 Ga0163163_101164981 214
153 3300014745 Ga0157377_10000059 Ga0157377_1000005923 214
154 3300014745 Ga0157377_10001123 Ga0157377_100011237 214
155 3300014969 Ga0157376_10004096 Ga0157376_100040967 214
156 3300015262 Ga0182007_10068579 Ga0182007_100685791 214
157 3300025908 Ga0207643_10316007 Ga0207643_103160072 214
158 3300025911 Ga0207654_10046822 Ga0207654_100468223 214
159 3300025912 Ga0207707_10242083 Ga0207707_102420831 214
160 3300025917 Ga0207660_10033324 Ga0207660_100333242 214
161 3300025918 Ga0207662_10021681 Ga0207662_100216812 214
162 3300025919 Ga0207657_10036380 Ga0207657_100363804 214
163 3300025920 Ga0207649_10006807 Ga0207649_100068073 214
164 3300025923 Ga0207681_10303472 Ga0207681_103034721 214
165 3300025925 Ga0207650_10010564 Ga0207650_100105643 214
166 3300025926 Ga0207659_10007570 Ga0207659_100075705 214
167 3300025927 Ga0207687_10025397 Ga0207687_100253973 214
168 3300025933 Ga0207706_10004331 Ga0207706_100043315 214
169 3300025936 Ga0207670_10106439 Ga0207670_101064393 214
170 3300025940 Ga0207691_10065499 Ga0207691_100654993 214
171 3300025941 Ga0207711_10079844 Ga0207711_100798443 214
172 3300025942 Ga0207689_10002615 Ga0207689_100026156 214
173 3300025944 Ga0207661_10024610 Ga0207661_100246103 214
174 3300025945 Ga0207679_10007391 Ga0207679_100073913 214
175 3300025960 Ga0207651_10139148 Ga0207651_101391482 214
176 3300026023 Ga0207677_10166277 Ga0207677_101662772 214
177 3300026035 Ga0207703_10590266 Ga0207703_105902661 214
178 3300026041 Ga0207639_10177291 Ga0207639_101772912 214
179 3300026078 Ga0207702_10004929 Ga0207702_1000492910 214
180 3300026095 Ga0207676_10008189 Ga0207676_100081893 214
181 3300026116 Ga0207674_10001215 Ga0207674_1000121530 214
182 3300026118 Ga0207675_100480264 Ga0207675_1004802642 214
183 3300026121 Ga0207683_10455215 Ga0207683_104552152 214
184 3300026142 Ga0207698_10012930 Ga0207698_100129303 214
185 3300027907 Ga0207428_10622383 Ga0207428_106223831 214
186 3300028381 Ga0268264_10035571 Ga0268264_100355713 214
187 3300031731 Ga0307405_10399455 Ga0307405_103994552 214
188 3300031852 Ga0307410_10548840 Ga0307410_105488401 214
189 3300031901 Ga0307406_10261568 Ga0307406_102615682 214
190 3300031911 Ga0307412_10175522 Ga0307412_101755221 214
191 3300035691 Ga0373931_0002737 Ga0373931_0002737_1905_2624 214
192 3300045051 Ga0451576_0211343 Ga0451576_0211343_563_1282 214
193 3300048911 Ga0496108_0498735 Ga0496108_0498735_157_876 214
194 3300048915 Ga0496112_0003264 Ga0496112_0003264_11832_12551 214
195 3300050511 nmdc:mga08y16_259330_c1 nmdc:mga08y16_259330_c1_1044_1721 214
196 3300005329 Ga0070683_100000027 Ga0070683_10000002778 215
197 3300005331 Ga0070670_100000025 Ga0070670_10000002595 215
198 3300005337 Ga0070682_100130364 Ga0070682_1001303642 215
199 3300005338 Ga0068868_100000266 Ga0068868_1000002661 215
200 3300005345 Ga0070692_10001788 Ga0070692_100017885 215
201 3300005535 Ga0070684_100000051 Ga0070684_1000000519 215
202 3300005535 Ga0070684_100380830 Ga0070684_1003808302 215
203 3300005536 Ga0070697_100460737 Ga0070697_1004607371 215
204 3300005578 Ga0068854_100160484 Ga0068854_1001604842 215
205 3300006237 Ga0097621_100593574 Ga0097621_1005935742 215
206 3300006358 Ga0068871_100161685 Ga0068871_1001616851 215
207 3300006844 Ga0075428_100000133 Ga0075428_1000001332 215
208 3300009094 Ga0111539_10001970 Ga0111539_1000197029 215
209 3300009098 Ga0105245_10000052 Ga0105245_1000005238 215
210 3300013105 Ga0157369_10000431 Ga0157369_1000043124 215
211 3300013307 Ga0157372_10470618 Ga0157372_104706182 215
212 3300013308 Ga0157375_10000185 Ga0157375_1000018515 215
213 3300021384 Ga0213876_10000151 Ga0213876_1000015150 215
214 3300025925 Ga0207650_10000079 Ga0207650_100000798 215
215 3300025927 Ga0207687_10000005 Ga0207687_1000000579 215
216 3300025931 Ga0207644_10482427 Ga0207644_104824271 215
217 3300025944 Ga0207661_10000015 Ga0207661_10000015107 215
218 3300025981 Ga0207640_10006449 Ga0207640_100064492 215
219 3300026023 Ga0207677_10000086 Ga0207677_1000008646 215
220 3300035111 Ga0373923_0015495 Ga0373923_0015495_576_1277 215
221 3300035119 Ga0373956_0072245 Ga0373956_0072245_668_1369 215
222 3300035172 Ga0373955_0000789 Ga0373955_0000789_10488_11189 215
223 3300035724 Ga0373933_0000245 Ga0373933_0000245_10766_11467 215
224 3300036401 Ga0373937_0000452 Ga0373937_0000452_21220_21921 215
225 3300037068 Ga0373925_0137251 Ga0373925_0137251_1092_1793 215
226 3300039437 Ga0436365_0039397 Ga0436365_0039397_1760_2422 215
227 3300039437 Ga0436365_0076143 Ga0436365_0076143_26776_27480 215
228 3300039453 Ga0436362_0782701 Ga0436362_0782701_1058_1762 215
229 3300046454 Ga0495592_0006789 Ga0495592_0006789_574_1275 215
230 3300046459 Ga0495629_0124471 Ga0495629_0124471_944_1645 215
231 3300046462 Ga0495651_0000069 Ga0495651_0000069_46400_47101 215
232 3300046463 Ga0495653_0000278 Ga0495653_0000278_24243_24944 215
233 3300046472 Ga0495580_0080198 Ga0495580_0080198_952_1602 215
234 3300046477 Ga0495664_0011043 Ga0495664_0011043_207_908 215
235 3300046511 Ga0495608_0001281 Ga0495608_0001281_16109_16810 215
236 3300046516 Ga0495628_0000685 Ga0495628_0000685_352_1053 215
237 3300046517 Ga0495630_0033254 Ga0495630_0033254_2088_2789 215
238 3300046529 Ga0495652_0000422 Ga0495652_0000422_19922_20623 215
239 3300046536 Ga0495587_0000165 Ga0495587_0000165_12603_13304 215
240 3300046543 Ga0495645_0000317 Ga0495645_0000317_9204_9905 215
241 3300046642 Ga0495634_0085026 Ga0495634_0085026_309_1010 215
242 3300046663 Ga0495635_0001959 Ga0495635_0001959_3206_3907 215
243 3300046675 Ga0495657_0000540 Ga0495657_0000540_9044_9745 215
244 3300046678 Ga0495599_0001255 Ga0495599_0001255_165_866 215
245 3300046679 Ga0495623_0000272 Ga0495623_0000272_4658_5359 215
246 3300046680 Ga0495646_0000361 Ga0495646_0000361_12524_13225 215
247 3300046689 Ga0495613_0043765 Ga0495613_0043765_57_758 215
248 3300047317 Ga0495604_0000028 Ga0495604_0000028_118247_118948 215
249 3300047319 Ga0495674_0003785 Ga0495674_0003785_474_1175 215
250 3300047322 Ga0495680_0001253 Ga0495680_0001253_2491_3192 215
251 3300047444 Ga0495675_0014131 Ga0495675_0014131_2431_3132 215
252 3300047471 Ga0495684_0000044 Ga0495684_0000044_66656_67357 215
253 3300048088 Ga0495602_0000294 Ga0495602_0000294_2650_3351 215
254 3300050512 nmdc:mga0n895_80243_c1 nmdc:mga0n895_80243_c1_13_684 215
255 3300050513 nmdc:mga0rr50_10508_c1 nmdc:mga0rr50_10508_c1_1145_1816 215
256 3300050514 nmdc:mga08x19_7725_c1 nmdc:mga08x19_7725_c1_5635_6357 215
257 3300053077 Ga0495601_0065040 Ga0495601_0065040_747_1448 215
258 3300053078 Ga0495612_0000242 Ga0495612_0000242_9390_10091 215
259 3300053084 Ga0495595_0026679 Ga0495595_0026679_1520_2221 215
260 3300005289 Ga0065704_10161587 Ga0065704_101615871 216
261 3300005295 Ga0065707_10001855 Ga0065707_100018551 216
262 3300005327 Ga0070658_10017251 Ga0070658_100172515 216
263 3300005330 Ga0070690_100000146 Ga0070690_10000014622 216
264 3300005334 Ga0068869_100006829 Ga0068869_1000068298 216
265 3300005334 Ga0068869_100081504 Ga0068869_1000815043 216
266 3300005334 Ga0068869_100314165 Ga0068869_1003141652 216
267 3300005335 Ga0070666_10002161 Ga0070666_100021612 216
268 3300005336 Ga0070680_100125827 Ga0070680_1001258271 216
269 3300005340 Ga0070689_100009333 Ga0070689_1000093332 216
270 3300005344 Ga0070661_100228621 Ga0070661_1002286212 216
271 3300005364 Ga0070673_100441753 Ga0070673_1004417532 216
272 3300005367 Ga0070667_100000282 Ga0070667_10000028224 216
273 3300005435 Ga0070714_100016282 Ga0070714_1000162823 216
274 3300005435 Ga0070714_100671017 Ga0070714_1006710171 216
275 3300005436 Ga0070713_100390201 Ga0070713_1003902012 216
276 3300005439 Ga0070711_100420922 Ga0070711_1004209222 216
277 3300005445 Ga0070708_100504670 Ga0070708_1005046701 216
278 3300005455 Ga0070663_100016928 Ga0070663_1000169283 216
279 3300005459 Ga0068867_100022753 Ga0068867_1000227533 216
280 3300005471 Ga0070698_100656466 Ga0070698_1006564662 216
281 3300005518 Ga0070699_101021502 Ga0070699_1010215021 216
282 3300005530 Ga0070679_100021771 Ga0070679_1000217714 216
283 3300005539 Ga0068853_100159055 Ga0068853_1001590553 216
284 3300005539 Ga0068853_100304228 Ga0068853_1003042282 216
285 3300005544 Ga0070686_100021930 Ga0070686_1000219303 216
286 3300005548 Ga0070665_100285902 Ga0070665_1002859022 216
287 3300005549 Ga0070704_100009596 Ga0070704_1000095963 216
288 3300005563 Ga0068855_100144577 Ga0068855_1001445773 216
289 3300005564 Ga0070664_100128366 Ga0070664_1001283663 216
290 3300005577 Ga0068857_100509806 Ga0068857_1005098061 216
291 3300005578 Ga0068854_100162967 Ga0068854_1001629671 216
292 3300005614 Ga0068856_100001651 Ga0068856_1000016519 216
293 3300005615 Ga0070702_100008920 Ga0070702_1000089202 216
294 3300005617 Ga0068859_100002112 Ga0068859_1000021128 216
295 3300005841 Ga0068863_100221561 Ga0068863_1002215612 216
296 3300005842 Ga0068858_100000871 Ga0068858_10000087111 216
297 3300005843 Ga0068860_100000830 Ga0068860_10000083014 216
298 3300006175 Ga0070712_100043193 Ga0070712_1000431932 216
299 3300006237 Ga0097621_100019644 Ga0097621_1000196445 216
300 3300006358 Ga0068871_100025225 Ga0068871_1000252252 216
301 3300006358 Ga0068871_100045603 Ga0068871_1000456032 216
302 3300006844 Ga0075428_100006115 Ga0075428_1000061157 216
303 3300006844 Ga0075428_100032736 Ga0075428_1000327363 216
304 3300006846 Ga0075430_100368523 Ga0075430_1003685232 216
305 3300006847 Ga0075431_100240068 Ga0075431_1002400682 216
306 3300006852 Ga0075433_10031847 Ga0075433_100318474 216
307 3300006852 Ga0075433_10560283 Ga0075433_105602832 216
308 3300006871 Ga0075434_100027372 Ga0075434_1000273722 216
309 3300006871 Ga0075434_100050410 Ga0075434_1000504102 216
310 3300006871 Ga0075434_100275492 Ga0075434_1002754921 216
311 3300006914 Ga0075436_100009356 Ga0075436_1000093562 216
312 3300006914 Ga0075436_100180802 Ga0075436_1001808021 216
313 3300006931 Ga0097620_100002112 Ga0097620_1000021128 216
314 3300007076 Ga0075435_100220970 Ga0075435_1002209702 216
315 3300007076 Ga0075435_100347460 Ga0075435_1003474602 216
316 3300009094 Ga0111539_10000956 Ga0111539_1000095630 216
317 3300009147 Ga0114129_10024087 Ga0114129_100240873 216
318 3300009174 Ga0105241_10037191 Ga0105241_100371912 216
319 3300009174 Ga0105241_10571033 Ga0105241_105710331 216
320 3300009177 Ga0105248_10001890 Ga0105248_100018909 216
321 3300009545 Ga0105237_10237252 Ga0105237_102372521 216
322 3300009551 Ga0105238_10780517 Ga0105238_107805171 216
323 3300011119 Ga0105246_10037011 Ga0105246_100370111 216
324 3300013104 Ga0157370_10013271 Ga0157370_100132712 216
325 3300013297 Ga0157378_10173448 Ga0157378_101734482 216
326 3300013297 Ga0157378_10829227 Ga0157378_108292272 216
327 3300013308 Ga0157375_10000010 Ga0157375_10000010251 216
328 3300013308 Ga0157375_10004658 Ga0157375_100046583 216
329 3300014968 Ga0157379_10007306 Ga0157379_100073067 216
330 3300014969 Ga0157376_10014892 Ga0157376_100148922 216
331 3300014969 Ga0157376_10049209 Ga0157376_100492092 216
332 3300020069 Ga0197907_10622141 Ga0197907_106221412 216
333 3300020070 Ga0206356_11009395 Ga0206356_110093951 216
334 3300020070 Ga0206356_11242621 Ga0206356_112426211 216
335 3300020081 Ga0206354_11555495 Ga0206354_115554951 216
336 3300025903 Ga0207680_10000344 Ga0207680_100003447 216
337 3300025910 Ga0207684_10405718 Ga0207684_104057182 216
338 3300025911 Ga0207654_10515191 Ga0207654_105151911 216
339 3300025912 Ga0207707_10012424 Ga0207707_100124243 216
340 3300025912 Ga0207707_10029212 Ga0207707_100292122 216
341 3300025913 Ga0207695_10064878 Ga0207695_100648782 216
342 3300025913 Ga0207695_10098109 Ga0207695_100981092 216
343 3300025915 Ga0207693_10051212 Ga0207693_100512123 216
344 3300025916 Ga0207663_10108523 Ga0207663_101085231 216
345 3300025916 Ga0207663_10336153 Ga0207663_103361532 216
346 3300025920 Ga0207649_10022301 Ga0207649_100223013 216
347 3300025921 Ga0207652_10095136 Ga0207652_100951362 216
348 3300025921 Ga0207652_10311354 Ga0207652_103113542 216
349 3300025929 Ga0207664_10445493 Ga0207664_104454932 216
350 3300025935 Ga0207709_10097459 Ga0207709_100974592 216
351 3300025936 Ga0207670_10005533 Ga0207670_100055335 216
352 3300025940 Ga0207691_10011126 Ga0207691_100111264 216
353 3300025941 Ga0207711_10000705 Ga0207711_1000070513 216
354 3300025942 Ga0207689_10140770 Ga0207689_101407702 216
355 3300025942 Ga0207689_10321678 Ga0207689_103216782 216
356 3300025945 Ga0207679_10151974 Ga0207679_101519742 216
357 3300025981 Ga0207640_10065628 Ga0207640_100656282 216
358 3300026035 Ga0207703_10002356 Ga0207703_100023562 216
359 3300026041 Ga0207639_10126613 Ga0207639_101266133 216
360 3300026067 Ga0207678_10029502 Ga0207678_100295022 216
361 3300026078 Ga0207702_10088898 Ga0207702_100888982 216
362 3300026088 Ga0207641_10031186 Ga0207641_100311863 216
363 3300027907 Ga0207428_10098935 Ga0207428_100989351 216
364 3300028379 Ga0268266_10010928 Ga0268266_100109283 216
365 3300028381 Ga0268264_10001110 Ga0268264_100011109 216
366 3300030521 Ga0307511_10023640 Ga0307511_100236401 216
367 3300031731 Ga0307405_10155536 Ga0307405_101555363 216
368 3300035086 Ga0373934_0009753 Ga0373934_0009753_294_989 216
369 3300035086 Ga0373934_0172825 Ga0373934_0172825_28_678 216
370 3300035089 Ga0373944_0005005 Ga0373944_0005005_364_1071 216
371 3300035089 Ga0373944_0074698 Ga0373944_0074698_396_1046 216
372 3300035111 Ga0373923_0016230 Ga0373923_0016230_22_717 216
373 3300035111 Ga0373923_0069073 Ga0373923_0069073_701_1351 216
374 3300035116 Ga0373945_0079063 Ga0373945_0079063_160_855 216
375 3300035118 Ga0373954_0021358 Ga0373954_0021358_790_1485 216
376 3300035119 Ga0373956_0201063 Ga0373956_0201063_227_922 216
377 3300035170 Ga0373943_0033782 Ga0373943_0033782_1464_2114 216
378 3300035170 Ga0373943_0232480 Ga0373943_0232480_82_777 216
379 3300035170 Ga0373943_0350854 Ga0373943_0350854_108_815 216
380 3300035171 Ga0373946_0022309 Ga0373946_0022309_1801_2451 216
381 3300035171 Ga0373946_0040949 Ga0373946_0040949_741_1448 216
382 3300035172 Ga0373955_0045131 Ga0373955_0045131_292_987 216
383 3300035410 Ga0373924_0013674 Ga0373924_0013674_1678_2328 216
384 3300035692 Ga0373935_0039629 Ga0373935_0039629_78_728 216
385 3300035692 Ga0373935_0046096 Ga0373935_0046096_2004_2699 216
386 3300035692 Ga0373935_0218688 Ga0373935_0218688_588_1295 216
387 3300035725 Ga0373947_0005772 Ga0373947_0005772_2358_3008 216
388 3300036401 Ga0373937_0424243 Ga0373937_0424243_444_1139 216
389 3300037068 Ga0373925_0005514 Ga0373925_0005514_3891_4541 216
390 3300037068 Ga0373925_0057229 Ga0373925_0057229_610_1305 216
391 3300044684 Ga0466966_0229158 Ga0466966_0229158_257_991 216
392 3300045049 Ga0466959_0140726 Ga0466959_0140726_956_1690 216
393 3300045976 Ga0466967_0053224 Ga0466967_0053224_1163_1894 216
394 3300046454 Ga0495592_0017704 Ga0495592_0017704_2310_3005 216
395 3300046455 Ga0495603_0015058 Ga0495603_0015058_697_1404 216
396 3300046459 Ga0495629_0220221 Ga0495629_0220221_273_980 216
397 3300046472 Ga0495580_0007205 Ga0495580_0007205_7839_8534 216
398 3300046473 Ga0495582_0002775 Ga0495582_0002775_3094_3798 216
399 3300046473 Ga0495582_0006186 Ga0495582_0006186_5488_6195 216
400 3300046475 Ga0495639_0039161 Ga0495639_0039161_470_1177 216
401 3300046477 Ga0495664_0147843 Ga0495664_0147843_152_847 216
402 3300046499 Ga0495594_0025929 Ga0495594_0025929_282_977 216
403 3300046511 Ga0495608_0072816 Ga0495608_0072816_940_1635 216
404 3300046514 Ga0495618_0138808 Ga0495618_0138808_114_809 216
405 3300046515 Ga0495620_0055283 Ga0495620_0055283_829_1479 216
406 3300046517 Ga0495630_0001791 Ga0495630_0001791_13816_14523 216
407 3300046526 Ga0495666_0006745 Ga0495666_0006745_1940_2635 216
408 3300046526 Ga0495666_0206100 Ga0495666_0206100_43_750 216
409 3300046531 Ga0495665_0003789 Ga0495665_0003789_5491_6186 216
410 3300046531 Ga0495665_0020783 Ga0495665_0020783_2789_3496 216
411 3300046531 Ga0495665_0207182 Ga0495665_0207182_47_751 216
412 3300046533 Ga0495640_0133215 Ga0495640_0133215_510_1205 216
413 3300046536 Ga0495587_0022373 Ga0495587_0022373_1730_2425 216
414 3300046537 Ga0495598_0077904 Ga0495598_0077904_235_939 216
415 3300046543 Ga0495645_0005395 Ga0495645_0005395_3996_4691 216
416 3300046557 Ga0495622_0249502 Ga0495622_0249502_14_721 216
417 3300046559 Ga0495667_0007967 Ga0495667_0007967_193_888 216
418 3300046642 Ga0495634_0311258 Ga0495634_0311258_151_846 216
419 3300046674 Ga0495588_0037688 Ga0495588_0037688_1281_1988 216
420 3300046678 Ga0495599_0008791 Ga0495599_0008791_3492_4187 216
421 3300046683 Ga0495658_0000148 Ga0495658_0000148_37956_38663 216
422 3300046683 Ga0495658_0025803 Ga0495658_0025803_655_1359 216
423 3300046684 Ga0495669_0009802 Ga0495669_0009802_70_720 216
424 3300046689 Ga0495613_0175459 Ga0495613_0175459_266_973 216
425 3300046809 Ga0495600_0104582 Ga0495600_0104582_269_964 216
426 3300047315 Ga0495581_0052073 Ga0495581_0052073_1308_2015 216
427 3300047315 Ga0495581_0094643 Ga0495581_0094643_753_1448 216
428 3300047319 Ga0495674_0079231 Ga0495674_0079231_436_1131 216
429 3300047321 Ga0495676_0257973 Ga0495676_0257973_289_996 216
430 3300047322 Ga0495680_0063685 Ga0495680_0063685_1570_2265 216
431 3300047444 Ga0495675_0013685 Ga0495675_0013685_3501_4196 216
432 3300047471 Ga0495684_0005572 Ga0495684_0005572_6573_7268 216
433 3300047471 Ga0495684_0022733 Ga0495684_0022733_1797_2492 216
434 3300047673 Ga0495593_0000211 Ga0495593_0000211_29539_30246 216
435 3300047673 Ga0495593_0184385 Ga0495593_0184385_56_706 216
436 3300048089 Ga0495614_0000092 Ga0495614_0000092_434_1141 216
437 3300048903 Ga0496100_0106982 Ga0496100_0106982_1208_1876 216
438 3300048904 Ga0496101_0028966 Ga0496101_0028966_3117_3767 216
439 3300048905 Ga0496102_0004034 Ga0496102_0004034_10963_11631 216
440 3300048907 Ga0496104_0174090 Ga0496104_0174090_335_1003 216
441 3300048908 Ga0496105_0196408 Ga0496105_0196408_85_753 216
442 3300048909 Ga0496106_0000937 Ga0496106_0000937_4055_4723 216
443 3300048910 Ga0496107_0003384 Ga0496107_0003384_236_904 216
444 3300048911 Ga0496108_0073222 Ga0496108_0073222_312_980 216
445 3300048913 Ga0496110_0088223 Ga0496110_0088223_200_850 216
446 3300048914 Ga0496111_0110355 Ga0496111_0110355_608_1276 216
447 3300048916 Ga0496113_0629283 Ga0496113_0629283_12_680 216
448 3300049568 Ga0501031_0223997 Ga0501031_0223997_406_1080 216
449 3300049591 Ga0501075_0180732 Ga0501075_0180732_635_1309 216
450 3300050507 nmdc:mga05p37_51832_c1 nmdc:mga05p37_51832_c1_1749_2399 216
451 3300050510 nmdc:mga06r32_680126_c1 nmdc:mga06r32_680126_c1_172_861 216
452 3300050512 nmdc:mga0n895_46773_c1 nmdc:mga0n895_46773_c1_3511_4161 216
453 3300050512 nmdc:mga0n895_6608_c1 nmdc:mga0n895_6608_c1_583_1233 216
454 3300050513 nmdc:mga0rr50_166244_c1 nmdc:mga0rr50_166244_c1_647_1297 216
455 3300050513 nmdc:mga0rr50_332765_c1 nmdc:mga0rr50_332765_c1_403_1053 216
456 3300050514 nmdc:mga08x19_1565_c1 nmdc:mga08x19_1565_c1_4971_5678 216
457 3300050515 nmdc:mga0a205_2302_c1 nmdc:mga0a205_2302_c1_12463_13113 216
458 3300053077 Ga0495601_0056696 Ga0495601_0056696_1074_1769 216
459 3300053078 Ga0495612_0040626 Ga0495612_0040626_136_831 216
460 3300053084 Ga0495595_0129273 Ga0495595_0129273_433_1128 216
461 3300053085 Ga0495619_0014895 Ga0495619_0014895_4138_4833 216
462 3300053085 Ga0495619_0076635 Ga0495619_0076635_1144_1839 216
463 3300060353 Ga0501082_0731350 Ga0501082_0731350_153_803 216
464 3300061734 Ga0530510_0292077 Ga0530510_0292077_543_1193 216
465 3300005333 Ga0070677_10010457 Ga0070677_100104571 217
466 3300005344 Ga0070661_100199635 Ga0070661_1001996352 217
467 3300005353 Ga0070669_100021825 Ga0070669_1000218253 217
468 3300005354 Ga0070675_100086523 Ga0070675_1000865232 217
469 3300005354 Ga0070675_100103884 Ga0070675_1001038841 217
470 3300005365 Ga0070688_100004044 Ga0070688_1000040442 217
471 3300005366 Ga0070659_100330395 Ga0070659_1003303951 217
472 3300005549 Ga0070704_100525999 Ga0070704_1005259991 217
473 3300005577 Ga0068857_100141279 Ga0068857_1001412793 217
474 3300005616 Ga0068852_100566160 Ga0068852_1005661601 217
475 3300005617 Ga0068859_100058825 Ga0068859_1000588252 217
476 3300005840 Ga0068870_10004852 Ga0068870_100048522 217
477 3300005842 Ga0068858_100225875 Ga0068858_1002258752 217
478 3300006237 Ga0097621_100024466 Ga0097621_1000244665 217
479 3300006358 Ga0068871_100000568 Ga0068871_10000056816 217
480 3300006846 Ga0075430_100237846 Ga0075430_1002378462 217
481 3300006852 Ga0075433_10152275 Ga0075433_101522751 217
482 3300006852 Ga0075433_10176837 Ga0075433_101768371 217
483 3300006880 Ga0075429_100202902 Ga0075429_1002029022 217
484 3300006931 Ga0097620_100058819 Ga0097620_1000588193 217
485 3300009094 Ga0111539_10010341 Ga0111539_100103412 217
486 3300009147 Ga0114129_10032311 Ga0114129_100323115 217
487 3300009147 Ga0114129_10924043 Ga0114129_109240431 217
488 3300013297 Ga0157378_10003882 Ga0157378_1000388210 217
489 3300013308 Ga0157375_10066702 Ga0157375_100667022 217
490 3300014969 Ga0157376_10384146 Ga0157376_103841461 217
491 3300025893 Ga0207682_10007718 Ga0207682_100077182 217
492 3300025908 Ga0207643_10003261 Ga0207643_100032612 217
493 3300025918 Ga0207662_10114186 Ga0207662_101141861 217
494 3300025920 Ga0207649_10341944 Ga0207649_103419441 217
495 3300025926 Ga0207659_10025236 Ga0207659_100252362 217
496 3300025926 Ga0207659_10247572 Ga0207659_102475722 217
497 3300025932 Ga0207690_10387316 Ga0207690_103873161 217
498 3300025940 Ga0207691_10040017 Ga0207691_100400172 217
499 3300025960 Ga0207651_10111121 Ga0207651_101111212 217
500 3300025986 Ga0207658_10086647 Ga0207658_100866472 217
501 3300026035 Ga0207703_10204833 Ga0207703_102048332 217
502 3300026116 Ga0207674_10297296 Ga0207674_102972962 217
503 3300026142 Ga0207698_10944844 Ga0207698_109448441 217
504 3300027907 Ga0207428_10008928 Ga0207428_100089282 217
505 3300031548 Ga0307408_100140514 Ga0307408_1001405142 217
506 3300031824 Ga0307413_10072892 Ga0307413_100728922 217
507 3300031995 Ga0307409_100030756 Ga0307409_1000307565 217
508 3300031995 Ga0307409_100226557 Ga0307409_1002265572 217
509 3300032002 Ga0307416_100501436 Ga0307416_1005014362 217
510 3300032004 Ga0307414_10667579 Ga0307414_106675791 217
511 3300035172 Ga0373955_0349155 Ga0373955_0349155_34_702 217
512 3300046472 Ga0495580_0111667 Ga0495580_0111667_190_858 217
513 3300046475 Ga0495639_0027751 Ga0495639_0027751_1006_1674 217
514 3300049572 Ga0501036_0373206 Ga0501036_0373206_410_1108 217
515 3300050507 nmdc:mga05p37_35759_c1 nmdc:mga05p37_35759_c1_4778_5464 217
516 3300050508 nmdc:mga09592_429532_c1 nmdc:mga09592_429532_c1_326_1012 217
517 3300050509 nmdc:mga0qj67_40649_c1 nmdc:mga0qj67_40649_c1_1596_2282 217
518 3300050510 nmdc:mga06r32_200449_c1 nmdc:mga06r32_200449_c1_1194_1880 217
519 3300050511 nmdc:mga08y16_196514_c1 nmdc:mga08y16_196514_c1_437_1123 217
520 3300050515 nmdc:mga0a205_76227_c1 nmdc:mga0a205_76227_c1_1193_1879 217
521 2162886012 MBSR1b_contig_7673102 MBSR1b_0828.00005970 218
522 3300005293 Ga0065715_10116800 Ga0065715_101168002 218
523 3300005459 Ga0068867_100065081 Ga0068867_1000650812 218
524 3300005543 Ga0070672_100000420 Ga0070672_10000042016 218
525 3300005618 Ga0068864_100000580 Ga0068864_10000058013 218
526 3300006871 Ga0075434_100995973 Ga0075434_1009959731 218
527 3300006881 Ga0068865_100159279 Ga0068865_1001592793 218
528 3300013308 Ga0157375_10000018 Ga0157375_100000183 218
529 3300014326 Ga0157380_10015824 Ga0157380_100158246 218
530 3300025938 Ga0207704_10123885 Ga0207704_101238852 218
531 3300025940 Ga0207691_10001597 Ga0207691_100015978 218
532 3300026089 Ga0207648_10086949 Ga0207648_100869492 218
533 3300026095 Ga0207676_10000278 Ga0207676_1000027812 218
534 3300050513 nmdc:mga0rr50_211288_c1 nmdc:mga0rr50_211288_c1_30_704 218

Structural Annotation

Top 5 Hits

ID Description Score Start End
8es5-assembly1.cif.gz_B aha1 domain protein from pseudomonas aeruginosa 0.8594 118 210
1xn6-assembly1.cif.gz_A solution structure of northeast structural genomics target protein bcr68 encoded in gene q816v6 of b. cereus 0.8485 118 218
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.8448 118 214
4fpw-assembly3.cif.gz_A crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8434 116 212
3ni8-assembly1.cif.gz_A crystal structure of pfc0360w, an hsp90 activator from plasmodium falciparum 0.8429 118 217
ID Description Score Start End Superfamily
af_Q93168_208_339_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8743 116 217 3.30.530.20
af_Q8BK64_207_336_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.864 118 217 3.30.530.20
af_I6X666_8_157_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8517 118 217 3.30.530.20
af_Q9V9Q4_218_347_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8513 116 217 3.30.530.20
af_Q94K52_78_219_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8508 119 215 3.30.530.20
ID Description Score Start End GO Terms
AF-K0IL34-F1-model_v4 Uncharacterized protein 0.9976 120 214
AF-A0A7W0NMC5-F1-model_v4 Activator of Hsp90 ATPase 1 family protein 0.9769 120 217
AF-A0A7L9BMI3-F1-model_v4 SRPBCC domain-containing protein 0.9607 117 217
AF-A0A357KTS4-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9602 116 218
AF-A0A6M4IVS3-F1-model_v4 Uncharacterized protein 0.9586 115 217

Feature Viewer

pLDDT pTM Quality
89.96 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map