F460503

General Info

Members Datasets Scaffolds Average Seq Length
534 221 534 141

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100047154|Ga0070680_1000471544
Length 152
Sequence LSFSSRRNKSMAKQVKANLKMKIRGGQASAAPPVGSTLGQYGVNMMDFINPFNEATKEMQGQEVTAHITIYDDRTMDFRVVGTPTDDLIRNKLGIQKGSGRPNSEKIAKKLSDKDLTEIAEAKAKDMNAEDVEAIKKMVAGTARSMGVEVEG

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
127 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
128 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
129 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
130 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
131 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
132 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
133 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
136 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
137 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
138 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
139 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
140 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
141 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
142 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
143 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
151 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
152 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
159 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
192 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
193 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
197 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
200 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
201 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
202 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
203 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
204 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
205 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
206 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
207 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
208 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
209 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
210 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
211 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
212 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
213 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
214 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
215 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
216 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0.94
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.36
Nodule 0
Rhizoplane 1.12
Rhizosphere 89.33
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1013380 3300001904 Bacteria 1325
2 JGI24742J22300_10000008 3300002244 Bacteria 35034
3 Ga0065712_10532958 3300005290 Bacteria 628
4 Ga0070658_10000012 3300005327 Bacteria 277871
5 Ga0070658_10000118 3300005327 Bacteria 71171
6 Ga0070658_10000133 3300005327 Bacteria 65613
7 Ga0070658_10002966 3300005327 Bacteria 14062
8 Ga0070658_10004235 3300005327 Bacteria 11730
9 Ga0070658_10019878 3300005327 Bacteria 5380
10 Ga0070658_10096036 3300005327 Bacteria 2447
11 Ga0070658_10662774 3300005327 Bacteria 905
12 Ga0070658_10669758 3300005327 Bacteria 900
13 Ga0070676_10027327 3300005328 Unclassified 3235
14 Ga0070676_10045348 3300005328 Bacteria 2561
15 Ga0070683_100385392 3300005329 Bacteria 1336
16 Ga0070683_100539502 3300005329 Bacteria 1115
17 Ga0070683_102282814 3300005329 Bacteria 519
18 Ga0070690_100003465 3300005330 Bacteria 8629
19 Ga0070670_100016224 3300005331 Bacteria 6395
20 Ga0068869_100748667 3300005334 Bacteria 836
21 Ga0070680_100000260 3300005336 Bacteria 34804
22 Ga0070680_100010821 3300005336 Bacteria 7044
23 Ga0070680_100047154 3300005336 Bacteria 3508
24 Ga0070680_100290612 3300005336 Bacteria 1385
25 Ga0070680_100334545 3300005336 Unclassified 1286
26 Ga0070680_101671259 3300005336 Bacteria 552
27 Ga0070682_100000552 3300005337 Bacteria 23228
28 Ga0070682_100239242 3300005337 Unclassified 1302
29 Ga0070682_100352814 3300005337 Bacteria 1097
30 Ga0070660_100000333 3300005339 Bacteria 31211
31 Ga0070660_100001027 3300005339 Bacteria 18741
32 Ga0070660_100005971 3300005339 Bacteria 8417
33 Ga0070660_100315053 3300005339 Bacteria 1284
34 Ga0070691_10003109 3300005341 Bacteria 7443
35 Ga0070661_100032335 3300005344 Bacteria 3788
36 Ga0070668_100757023 3300005347 Unclassified 860
37 Ga0070675_101475291 3300005354 Bacteria 627
38 Ga0070671_100000001 3300005355 Bacteria 1228151
39 Ga0070671_100099357 3300005355 Bacteria 2441
40 Ga0070671_100907510 3300005355 Bacteria 770
41 Ga0070671_101330525 3300005355 Bacteria 634
42 Ga0070674_100033506 3300005356 Bacteria 3420
43 Ga0070674_101413290 3300005356 Bacteria 623
44 Ga0070673_100001258 3300005364 Bacteria 14720
45 Ga0070688_100239375 3300005365 Bacteria 1287
46 Ga0070659_100002754 3300005366 Bacteria 12506
47 Ga0070659_100170136 3300005366 Bacteria 1784
48 Ga0070659_101553554 3300005366 Unclassified 590
49 Ga0070667_100000001 3300005367 Bacteria 1108638
50 Ga0070667_100008028 3300005367 Bacteria 8755
51 Ga0070667_100153122 3300005367 Bacteria 2027
52 Ga0070714_100000655 3300005435 Bacteria 24551
53 Ga0070678_100000962 3300005456 Bacteria 14844
54 Ga0070678_100048777 3300005456 Bacteria 3052
55 Ga0070681_10012754 3300005458 Bacteria 8339
56 Ga0070681_10016002 3300005458 Bacteria 7479
57 Ga0070681_10278078 3300005458 Bacteria 1585
58 Ga0070681_10401738 3300005458 Bacteria 1281
59 Ga0070681_10582976 3300005458 Bacteria 1032
60 Ga0068867_100084245 3300005459 Bacteria 2401
61 Ga0070685_10000179 3300005466 Bacteria 42215
62 Ga0070685_10014551 3300005466 Unclassified 4169
63 Ga0070679_100000670 3300005530 Bacteria 29193
64 Ga0070679_100007895 3300005530 Bacteria 9984
65 Ga0070679_100015098 3300005530 Bacteria 7422
66 Ga0070679_100024364 3300005530 Bacteria 5929
67 Ga0070679_100050426 3300005530 Bacteria 4147
68 Ga0070679_100061302 3300005530 Unclassified 3749
69 Ga0070679_100788703 3300005530 Unclassified 893
70 Ga0070679_100883065 3300005530 Bacteria 837
71 Ga0070679_101081640 3300005530 Bacteria 746
72 Ga0070679_101200498 3300005530 Bacteria 704
73 Ga0070684_100601669 3300005535 Bacteria 1022
74 Ga0070684_101052379 3300005535 Unclassified 764
75 Ga0068853_100028949 3300005539 Bacteria 4663
76 Ga0068853_100178249 3300005539 Unclassified 1926
77 Ga0070686_100009484 3300005544 Bacteria 5472
78 Ga0070686_100162625 3300005544 Unclassified 1573
79 Ga0070693_100261359 3300005547 Bacteria 1151
80 Ga0070665_100088146 3300005548 Bacteria 3109
81 Ga0070665_100134298 3300005548 Bacteria 2476
82 Ga0070665_101729602 3300005548 Bacteria 632
83 Ga0068855_100000168 3300005563 Bacteria 83242
84 Ga0068855_100003212 3300005563 Bacteria 19996
85 Ga0068855_100010457 3300005563 Bacteria 11196
86 Ga0068855_100030483 3300005563 Bacteria 6451
87 Ga0068855_100041299 3300005563 Bacteria 5468
88 Ga0068855_100076544 3300005563 Bacteria 3883
89 Ga0068855_100153992 3300005563 Bacteria 2612
90 Ga0068855_100213926 3300005563 Unclassified 2165
91 Ga0068855_100360593 3300005563 Bacteria 1599
92 Ga0068855_100653438 3300005563 Bacteria 1129
93 Ga0068855_102352966 3300005563 Unclassified 532
94 Ga0068857_100000007 3300005577 Bacteria 152197
95 Ga0068857_100006944 3300005577 Bacteria 9741
96 Ga0068857_100046349 3300005577 Bacteria 3858
97 Ga0068857_100102239 3300005577 Bacteria 2572
98 Ga0068857_100164691 3300005577 Bacteria 2013
99 Ga0068857_100615431 3300005577 Bacteria 1027
100 Ga0068856_100000001 3300005614 Bacteria 565602
101 Ga0068856_100004478 3300005614 Bacteria 13899
102 Ga0068856_100015323 3300005614 Bacteria 7409
103 Ga0068856_100497226 3300005614 Unclassified 1240
104 Ga0068852_100250015 3300005616 Bacteria 1698
105 Ga0068864_101741751 3300005618 Bacteria 628
106 Ga0068861_100140091 3300005719 Bacteria 1973
107 Ga0068863_100015791 3300005841 Bacteria 7247
108 Ga0068863_100590701 3300005841 Bacteria 1098
109 Ga0068863_100880801 3300005841 Bacteria 895
110 Ga0068863_102652601 3300005841 Bacteria 510
111 Ga0068860_100160407 3300005843 Unclassified 2168
112 Ga0068860_101680038 3300005843 Unclassified 657
113 Ga0081455_10000003 3300005937 Bacteria 367763
114 Ga0075365_10001969 3300006038 Bacteria 9700
115 Ga0075365_10148163 3300006038 Bacteria 1632
116 Ga0075365_10437129 3300006038 Bacteria 924
117 Ga0075368_10005596 3300006042 Bacteria 4333
118 Ga0075363_100000559 3300006048 Bacteria 12150
119 Ga0075364_10037683 3300006051 Bacteria 3132
120 Ga0075364_10276742 3300006051 Bacteria 1142
121 Ga0075367_10013981 3300006178 Bacteria 4333
122 Ga0075367_10835692 3300006178 Bacteria 587
123 Ga0075369_10000003 3300006186 Bacteria 205269
124 Ga0075369_10312722 3300006186 Bacteria 734
125 Ga0075366_10000005 3300006195 Bacteria 107438
126 Ga0097621_100163420 3300006237 Bacteria 1915
127 Ga0075370_10007562 3300006353 Bacteria 5541
128 Ga0068871_101561252 3300006358 Bacteria 624
129 Ga0075428_100001047 3300006844 Bacteria 29378
130 Ga0075430_100016200 3300006846 Bacteria 6349
131 Ga0068865_100048913 3300006881 Bacteria 2912
132 Ga0097620_100181443 3300006931 Unclassified 2188
133 Ga0105250_10131050 3300009092 Bacteria 1035
134 Ga0105240_10000003 3300009093 Bacteria 1183681
135 Ga0105240_10154212 3300009093 Bacteria 2733
136 Ga0105240_10221294 3300009093 Bacteria 2205
137 Ga0105240_10398207 3300009093 Bacteria 1551
138 Ga0105240_10761085 3300009093 Bacteria 1052
139 Ga0105240_11684608 3300009093 Unclassified 662
140 Ga0111539_10006378 3300009094 Bacteria 15214
141 Ga0105245_10000001 3300009098 Bacteria 939270
142 Ga0105245_10000050 3300009098 Bacteria 128014
143 Ga0105245_10002473 3300009098 Bacteria 16702
144 Ga0105245_10004714 3300009098 Bacteria 12052
145 Ga0105245_10174653 3300009098 Bacteria 2048
146 Ga0105245_10438781 3300009098 Bacteria 1312
147 Ga0105245_11917236 3300009098 Unclassified 646
148 Ga0105243_10000001 3300009148 Bacteria 1156578
149 Ga0105241_10000003 3300009174 Bacteria 839043
150 Ga0105241_10147094 3300009174 Bacteria 1924
151 Ga0105242_10000011 3300009176 Bacteria 149791
152 Ga0105242_10006407 3300009176 Bacteria 9064
153 Ga0105242_10157211 3300009176 Bacteria 1987
154 Ga0105248_10154446 3300009177 Unclassified 2590
155 Ga0105248_10258185 3300009177 Bacteria 1962
156 Ga0105237_10076151 3300009545 Bacteria 3345
157 Ga0105237_10095290 3300009545 Bacteria 2965
158 Ga0105237_10224620 3300009545 Unclassified 1878
159 Ga0105237_11501102 3300009545 Unclassified 681
160 Ga0105238_10001974 3300009551 Bacteria 20667
161 Ga0105238_10050491 3300009551 Bacteria 4187
162 Ga0105238_10861674 3300009551 Bacteria 923
163 Ga0105249_10943570 3300009553 Bacteria 931
164 Ga0105249_12306434 3300009553 Bacteria 611
165 Ga0105028_100118 3300009993 Bacteria 8244
166 Ga0105239_10029375 3300010375 Bacteria 6044
167 Ga0105239_10061240 3300010375 Bacteria 4130
168 Ga0105239_10311588 3300010375 Bacteria 1774
169 Ga0105239_10486668 3300010375 Bacteria 1402
170 Ga0105239_12293229 3300010375 Bacteria 628
171 Ga0157373_10180133 3300013100 Bacteria 1488
172 Ga0157370_10204037 3300013104 Bacteria 1834
173 Ga0157370_10610158 3300013104 Bacteria 999
174 Ga0157369_10012644 3300013105 Bacteria 9572
175 Ga0157369_10201054 3300013105 Unclassified 2091
176 Ga0157369_10381310 3300013105 Bacteria 1463
177 Ga0157374_10000115 3300013296 Bacteria 73739
178 Ga0157374_10048418 3300013296 Bacteria 3944
179 Ga0157374_10161220 3300013296 Bacteria 2184
180 Ga0157374_10361121 3300013296 Unclassified 1444
181 Ga0157374_10509133 3300013296 Bacteria 1209
182 Ga0157378_10098808 3300013297 Bacteria 2662
183 Ga0157378_10753547 3300013297 Bacteria 997
184 Ga0163162_10103871 3300013306 Bacteria 2936
185 Ga0157372_10002139 3300013307 Bacteria 21472
186 Ga0157372_10489963 3300013307 Bacteria 1433
187 Ga0157372_10597685 3300013307 Bacteria 1286
188 Ga0157372_10599942 3300013307 Unclassified 1283
189 Ga0157375_12860054 3300013308 Bacteria 577
190 Ga0163163_10235977 3300014325 Bacteria 1878
191 Ga0163163_10920265 3300014325 Bacteria 938
192 Ga0157380_10313405 3300014326 Bacteria 1451
193 Ga0157379_10029808 3300014968 Unclassified 4852
194 Ga0157376_10000007 3300014969 Bacteria 368004
195 Ga0206356_11428383 3300020070 Bacteria 1452
196 Ga0206355_1300670 3300020076 Bacteria 723
197 Ga0207697_10100860 3300025315 Bacteria 1230
198 Ga0207647_10001958 3300025904 Bacteria 15730
199 Ga0207647_10078916 3300025904 Bacteria 1977
200 Ga0207645_10014493 3300025907 Bacteria 5273
201 Ga0207645_10382661 3300025907 Unclassified 945
202 Ga0207705_10000011 3300025909 Bacteria 517768
203 Ga0207705_10000038 3300025909 Bacteria 193812
204 Ga0207705_10000167 3300025909 Bacteria 71284
205 Ga0207705_10007802 3300025909 Bacteria 7857
206 Ga0207705_10009031 3300025909 Bacteria 7263
207 Ga0207705_10042645 3300025909 Bacteria 3258
208 Ga0207705_10044586 3300025909 Bacteria 3187
209 Ga0207705_10100931 3300025909 Bacteria 2122
210 Ga0207705_10808128 3300025909 Bacteria 728
211 Ga0207654_10000002 3300025911 Bacteria 1460142
212 Ga0207654_10077006 3300025911 Bacteria 1998
213 Ga0207707_10012376 3300025912 Bacteria 7415
214 Ga0207707_10044093 3300025912 Bacteria 3889
215 Ga0207707_10343772 3300025912 Bacteria 1286
216 Ga0207707_10552189 3300025912 Bacteria 978
217 Ga0207707_10747595 3300025912 Bacteria 818
218 Ga0207695_10000005 3300025913 Bacteria 1196715
219 Ga0207695_10086726 3300025913 Bacteria 3156
220 Ga0207695_10498369 3300025913 Bacteria 1100
221 Ga0207671_10072385 3300025914 Bacteria 2572
222 Ga0207671_10201190 3300025914 Bacteria 1556
223 Ga0207660_10007429 3300025917 Bacteria 7090
224 Ga0207660_10016532 3300025917 Bacteria 4884
225 Ga0207660_10091261 3300025917 Bacteria 2259
226 Ga0207660_10105786 3300025917 Bacteria 2109
227 Ga0207660_10410009 3300025917 Unclassified 1092
228 Ga0207660_11276138 3300025917 Bacteria 597
229 Ga0207657_10001264 3300025919 Bacteria 26993
230 Ga0207657_10001852 3300025919 Bacteria 22847
231 Ga0207657_10012344 3300025919 Bacteria 8437
232 Ga0207657_10191614 3300025919 Bacteria 1649
233 Ga0207649_10343922 3300025920 Bacteria 1102
234 Ga0207652_10005490 3300025921 Bacteria 10286
235 Ga0207652_10007222 3300025921 Bacteria 8958
236 Ga0207652_10042986 3300025921 Bacteria 3847
237 Ga0207652_10043364 3300025921 Bacteria 3830
238 Ga0207652_10045321 3300025921 Unclassified 3749
239 Ga0207652_10052064 3300025921 Unclassified 3512
240 Ga0207652_10056634 3300025921 Bacteria 3375
241 Ga0207652_10058343 3300025921 Bacteria 3326
242 Ga0207652_10122913 3300025921 Bacteria 2310
243 Ga0207652_10204828 3300025921 Bacteria 1776
244 Ga0207652_10209652 3300025921 Bacteria 1754
245 Ga0207652_10210206 3300025921 Bacteria 1752
246 Ga0207652_10914263 3300025921 Bacteria 775
247 Ga0207652_11137295 3300025921 Bacteria 682
248 Ga0207694_10033970 3300025924 Unclassified 3909
249 Ga0207694_10365237 3300025924 Bacteria 1196
250 Ga0207694_10984525 3300025924 Unclassified 713
251 Ga0207650_10084149 3300025925 Bacteria 2418
252 Ga0207687_10000030 3300025927 Bacteria 155548
253 Ga0207687_10000117 3300025927 Bacteria 56652
254 Ga0207687_10017391 3300025927 Bacteria 4734
255 Ga0207687_10219994 3300025927 Bacteria 1494
256 Ga0207687_10485182 3300025927 Unclassified 1030
257 Ga0207687_11486723 3300025927 Bacteria 582
258 Ga0207664_10000295 3300025929 Bacteria 37239
259 Ga0207644_10000001 3300025931 Bacteria 1243214
260 Ga0207644_10710995 3300025931 Bacteria 838
261 Ga0207644_10966798 3300025931 Bacteria 714
262 Ga0207690_10006184 3300025932 Bacteria 7090
263 Ga0207690_10263246 3300025932 Bacteria 1337
264 Ga0207686_10000001 3300025934 Bacteria 1169580
265 Ga0207686_10004323 3300025934 Bacteria 7613
266 Ga0207686_10558410 3300025934 Bacteria 896
267 Ga0207709_10000002 3300025935 Bacteria 1171536
268 Ga0207669_10030089 3300025937 Bacteria 3012
269 Ga0207669_10224013 3300025937 Bacteria 1382
270 Ga0207704_10217851 3300025938 Bacteria 1410
271 Ga0207704_10261118 3300025938 Bacteria 1306
272 Ga0207711_10199827 3300025941 Unclassified 1824
273 Ga0207711_10259450 3300025941 Bacteria 1597
274 Ga0207711_10565191 3300025941 Unclassified 1061
275 Ga0207689_10659637 3300025942 Bacteria 882
276 Ga0207661_10583706 3300025944 Bacteria 1025
277 Ga0207661_11934876 3300025944 Bacteria 535
278 Ga0207667_10000339 3300025949 Bacteria 64087
279 Ga0207667_10001896 3300025949 Bacteria 26256
280 Ga0207667_10006376 3300025949 Bacteria 14308
281 Ga0207667_10048777 3300025949 Bacteria 4476
282 Ga0207667_10059507 3300025949 Bacteria 4001
283 Ga0207667_10060856 3300025949 Bacteria 3952
284 Ga0207667_10087542 3300025949 Unclassified 3222
285 Ga0207667_10263588 3300025949 Bacteria 1762
286 Ga0207667_11032672 3300025949 Bacteria 808
287 Ga0207667_11075479 3300025949 Bacteria 789
288 Ga0207651_10019642 3300025960 Bacteria 4055
289 Ga0207712_11290267 3300025961 Bacteria 652
290 Ga0207668_10608865 3300025972 Unclassified 952
291 Ga0207658_10000003 3300025986 Bacteria 1151934
292 Ga0207658_10031028 3300025986 Bacteria 3791
293 Ga0207658_10161602 3300025986 Bacteria 1836
294 Ga0207703_10640007 3300026035 Bacteria 1008
295 Ga0207639_10051853 3300026041 Bacteria 3123
296 Ga0207639_11333120 3300026041 Bacteria 673
297 Ga0207702_10000001 3300026078 Bacteria 895738
298 Ga0207702_10011223 3300026078 Bacteria 7471
299 Ga0207702_10013958 3300026078 Bacteria 6673
300 Ga0207702_10435389 3300026078 Unclassified 1270
301 Ga0207641_10052199 3300026088 Bacteria 3462
302 Ga0207641_10075238 3300026088 Bacteria 2916
303 Ga0207648_10057394 3300026089 Bacteria 3397
304 Ga0207676_11353979 3300026095 Bacteria 707
305 Ga0207674_10000001 3300026116 Bacteria 616581
306 Ga0207674_10014249 3300026116 Bacteria 8786
307 Ga0207674_10059309 3300026116 Bacteria 3873
308 Ga0207674_10141133 3300026116 Bacteria 2368
309 Ga0207674_10283905 3300026116 Bacteria 1604
310 Ga0207674_10574923 3300026116 Unclassified 1088
311 Ga0207674_10644717 3300026116 Bacteria 1023
312 Ga0207674_10982211 3300026116 Bacteria 813
313 Ga0207683_10029174 3300026121 Bacteria 4775
314 Ga0207683_10386958 3300026121 Unclassified 1286
315 Ga0207698_10007011 3300026142 Bacteria 7059
316 Ga0209813_10000154 3300027866 Bacteria 23239
317 Ga0268266_10002329 3300028379 Bacteria 20572
318 Ga0268266_10088619 3300028379 Bacteria 2708
319 Ga0268266_10569046 3300028379 Unclassified 1087
320 Ga0268266_11376636 3300028379 Bacteria 681
321 Ga0268264_10058168 3300028381 Bacteria 3236
322 Ga0268264_10152409 3300028381 Unclassified 2074
323 Ga0268264_11727487 3300028381 Bacteria 636
324 Ga0265337_1000227 3300028556 Bacteria 30136
325 Ga0265337_1000244 3300028556 Bacteria 29586
326 Ga0265337_1002862 3300028556 Bacteria 7703
327 Ga0265337_1029554 3300028556 Bacteria 1638
328 Ga0265337_1057712 3300028556 Bacteria 1080
329 Ga0265326_10000755 3300028558 Bacteria 11977
330 Ga0265326_10003333 3300028558 Bacteria 5294
331 Ga0265326_10005376 3300028558 Unclassified 4036
332 Ga0265326_10011258 3300028558 Bacteria 2640
333 Ga0265326_10015700 3300028558 Bacteria 2193
334 Ga0265319_1016715 3300028563 Bacteria 2808
335 Ga0265319_1075636 3300028563 Unclassified 1074
336 Ga0265319_1078501 3300028563 Bacteria 1050
337 Ga0265319_1143501 3300028563 Unclassified 740
338 Ga0265319_1214409 3300028563 Bacteria 589
339 Ga0265334_10000057 3300028573 Bacteria 80027
340 Ga0265334_10000144 3300028573 Bacteria 44418
341 Ga0265334_10001811 3300028573 Bacteria 10186
342 Ga0265334_10006824 3300028573 Bacteria 4902
343 Ga0265334_10019884 3300028573 Bacteria 2756
344 Ga0265334_10035249 3300028573 Bacteria 1982
345 Ga0265334_10072370 3300028573 Bacteria 1282
346 Ga0265318_10004668 3300028577 Bacteria 6582
347 Ga0265318_10088691 3300028577 Bacteria 1139
348 Ga0265318_10096818 3300028577 Unclassified 1086
349 Ga0265323_10002827 3300028653 Bacteria 7810
350 Ga0265322_10000864 3300028654 Bacteria 10770
351 Ga0265322_10004713 3300028654 Bacteria 4050
352 Ga0265322_10007979 3300028654 Viruses 3088
353 Ga0265336_10001710 3300028666 Bacteria 9655
354 Ga0265336_10003300 3300028666 Bacteria 6359
355 Ga0265336_10007276 3300028666 Bacteria 3942
356 Ga0265336_10007661 3300028666 Bacteria 3831
357 Ga0265338_10000003 3300028800 Bacteria 733923
358 Ga0265338_10000054 3300028800 Bacteria 207383
359 Ga0265338_10000130 3300028800 Bacteria 137739
360 Ga0265338_10000366 3300028800 Bacteria 81024
361 Ga0265338_10000419 3300028800 Bacteria 76060
362 Ga0265338_10000771 3300028800 Bacteria 54581
363 Ga0265338_10000841 3300028800 Bacteria 51708
364 Ga0265338_10001885 3300028800 Bacteria 32838
365 Ga0265338_10002761 3300028800 Bacteria 25703
366 Ga0265338_10008051 3300028800 Bacteria 12892
367 Ga0265338_10008859 3300028800 Bacteria 12132
368 Ga0265338_10036590 3300028800 Bacteria 4694
369 Ga0265338_10049830 3300028800 Unclassified 3791
370 Ga0265338_10087056 3300028800 Bacteria 2597
371 Ga0265338_10157351 3300028800 Bacteria 1759
372 Ga0265338_10424482 3300028800 Bacteria 945
373 Ga0265338_10444798 3300028800 Bacteria 918
374 Ga0265338_10453931 3300028800 Bacteria 907
375 Ga0265324_10007997 3300029957 Bacteria 4237
376 Ga0265324_10010258 3300029957 Bacteria 3620
377 Ga0265324_10034109 3300029957 Bacteria 1773
378 Ga0316179_1001639 3300030734 Unclassified 958
379 Ga0265330_10004460 3300031235 Bacteria 7100
380 Ga0265330_10113046 3300031235 Unclassified 1159
381 Ga0265332_10007896 3300031238 Bacteria 4797
382 Ga0265332_10026194 3300031238 Bacteria 2557
383 Ga0265332_10247034 3300031238 Unclassified 738
384 Ga0265328_10001186 3300031239 Bacteria 12058
385 Ga0265320_10005897 3300031240 Bacteria 7798
386 Ga0265320_10018766 3300031240 Bacteria 3799
387 Ga0265320_10188324 3300031240 Bacteria 923
388 Ga0265325_10003439 3300031241 Bacteria 10329
389 Ga0265325_10085818 3300031241 Bacteria 1559
390 Ga0265329_10003025 3300031242 Bacteria 7465
391 Ga0265340_10002179 3300031247 Bacteria 11205
392 Ga0265340_10014553 3300031247 Bacteria 4105
393 Ga0265339_10007998 3300031249 Bacteria 6779
394 Ga0265339_10171612 3300031249 Bacteria 1085
395 Ga0265339_10208363 3300031249 Unclassified 961
396 Ga0265339_10245439 3300031249 Bacteria 868
397 Ga0265331_10007364 3300031250 Bacteria 6374
398 Ga0265327_10000017 3300031251 Bacteria 445264
399 Ga0265327_10002752 3300031251 Bacteria 17876
400 Ga0265327_10003189 3300031251 Bacteria 16013
401 Ga0265327_10021544 3300031251 Unclassified 3886
402 Ga0265327_10029322 3300031251 Bacteria 3131
403 Ga0265327_10033845 3300031251 Bacteria 2842
404 Ga0265327_10349580 3300031251 Bacteria 646
405 Ga0265316_10013001 3300031344 Bacteria 7427
406 Ga0265316_10029923 3300031344 Bacteria 4471
407 Ga0265316_10046243 3300031344 Bacteria 3450
408 Ga0265316_10385003 3300031344 Bacteria 1011
409 Ga0265316_10402868 3300031344 Bacteria 985
410 Ga0265316_10635197 3300031344 Bacteria 755
411 Ga0265313_10005371 3300031595 Bacteria 9458
412 Ga0265313_10009485 3300031595 Bacteria 6314
413 Ga0265313_10011005 3300031595 Bacteria 5656
414 Ga0265314_10006571 3300031711 Bacteria 10250
415 Ga0265314_10264297 3300031711 Bacteria 981
416 Ga0265314_10609177 3300031711 Unclassified 561
417 Ga0265342_10006215 3300031712 Bacteria 8927
418 Ga0373934_0466448 3300035086 Bacteria 530
419 Ga0373944_0140597 3300035089 Bacteria 845
420 Ga0395899_0009307 3300037312 Bacteria 7544
421 Ga0395899_0200771 3300037312 Unclassified 1391
422 Ga0395899_0418799 3300037312 Bacteria 883
423 Ga0395900_0001880 3300037418 Bacteria 23875
424 Ga0395900_0002167 3300037418 Bacteria 21936
425 Ga0395900_0023300 3300037418 Bacteria 6337
426 Ga0395900_0043498 3300037418 Unclassified 4629
427 Ga0395900_0080917 3300037418 Bacteria 3338
428 Ga0395900_0200518 3300037418 Bacteria 2019
429 Ga0395900_0500788 3300037418 Bacteria 1165
430 Ga0395900_1336473 3300037418 Bacteria 630
431 Ga0395898_0001404 3300037466 Bacteria 34348
432 Ga0395898_0004142 3300037466 Bacteria 15900
433 Ga0395898_0043454 3300037466 Unclassified 4428
434 Ga0395898_0333281 3300037466 Bacteria 1447
435 Ga0395905_0002235 3300037471 Bacteria 21825
436 Ga0395905_0087579 3300037471 Bacteria 2919
437 Ga0395905_0546811 3300037471 Bacteria 1059
438 Ga0395905_1360630 3300037471 Bacteria 614
439 Ga0395901_0001834 3300038443 Bacteria 21960
440 Ga0395901_0009097 3300038443 Bacteria 10057
441 Ga0395901_0019837 3300038443 Bacteria 6877
442 Ga0395901_0035007 3300038443 Bacteria 5189
443 Ga0395901_0200221 3300038443 Bacteria 2093
444 Ga0395901_1029960 3300038443 Unclassified 797
445 Ga0451800_1051778 3300041459 Bacteria 1155
446 Ga0451807_0582546 3300041486 Bacteria 720
447 Ga0451807_1043250 3300041486 Unclassified 913
448 Ga0466963_0193095 3300044694 Bacteria 1423
449 Ga0466967_0255661 3300045976 Unclassified 1675
450 Ga0466967_0994819 3300045976 Bacteria 835
451 Ga0495583_0016469 3300046506 Bacteria 3971
452 Ga0495583_0447445 3300046506 Bacteria 506
453 Ga0495658_0038913 3300046683 Bacteria 2636
454 Ga0495670_0744853 3300046691 Unclassified 534
455 Ga0495649_0000379 3300046694 Bacteria 38623
456 Ga0495672_0000016 3300047320 Bacteria 500601
457 Ga0496100_0487582 3300048903 Bacteria 948
458 Ga0496112_0304724 3300048915 Bacteria 1538
459 Ga0496113_0435169 3300048916 Bacteria 1054
460 Ga0496126_0057535 3300048929 Bacteria 3509
461 Ga0501031_0002235 3300049568 Bacteria 12244
462 Ga0501032_0000394 3300049569 Bacteria 36017
463 Ga0501034_0032705 3300049571 Bacteria 5283
464 Ga0501034_0076194 3300049571 Bacteria 3361
465 Ga0501034_0134594 3300049571 Bacteria 2453
466 Ga0501036_0025601 3300049572 Bacteria 4979
467 Ga0501036_0332363 3300049572 Bacteria 1269
468 Ga0501037_0000133 3300049573 Bacteria 69741
469 Ga0501038_0023026 3300049574 Bacteria 5576
470 Ga0501038_0807084 3300049574 Unclassified 697
471 Ga0501042_0014645 3300049578 Bacteria 5356
472 Ga0501043_0004814 3300049579 Bacteria 10927
473 Ga0501046_0000038 3300049580 Bacteria 159193
474 Ga0501046_0101318 3300049580 Bacteria 2209
475 Ga0501047_0000355 3300049581 Bacteria 51922
476 Ga0501047_0009034 3300049581 Bacteria 9411
477 Ga0501048_0000379 3300049582 Bacteria 30846
478 Ga0501068_1046487 3300049584 Unclassified 539
479 Ga0501069_0262536 3300049585 Unclassified 1008
480 Ga0501070_0046000 3300049586 Bacteria 3629
481 Ga0501070_0209825 3300049586 Bacteria 1599
482 Ga0501073_0072903 3300049589 Bacteria 2391
483 Ga0501073_0484983 3300049589 Bacteria 855
484 Ga0501073_0530035 3300049589 Unclassified 814
485 Ga0501074_0220874 3300049590 Bacteria 1349
486 Ga0501080_0001480 3300049742 Bacteria 19793
487 Ga0501083_0269133 3300049744 Bacteria 1108
488 Ga0501083_0549713 3300049744 Bacteria 751
489 Ga0501035_0001229 3300049822 Bacteria 26660
490 Ga0501035_0002682 3300049822 Bacteria 17322
491 Ga0501044_0110414 3300049823 Bacteria 2759
492 nmdc:mga03683_126162_c1 3300050489 Bacteria 1142
493 nmdc:mga03n38_357_c1 3300050490 Bacteria 11162
494 nmdc:mga0yw44_173902_c1 3300050492 Bacteria 946
495 nmdc:mga0yw44_615_c1 3300050492 Bacteria 12909
496 nmdc:mga0k408_206643_c1 3300050493 Bacteria 673
497 nmdc:mga0k408_36_c1 3300050493 Bacteria 72881
498 nmdc:mga06z11_1_c2 3300050494 Bacteria 4916
499 nmdc:mga04h51_6_c2 3300050495 Bacteria 9547
500 nmdc:mga07m45_60737_c1 3300050496 Unclassified 2140
501 nmdc:mga0qj67_5316_c1 3300050509 Bacteria 9397
502 nmdc:mga0qj67_547461_c1 3300050509 Bacteria 928
503 nmdc:mga0sz30_1656_c1 3300050516 Bacteria 719
504 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
505 nmdc:mga0sz30_205895_c1 3300050516 Bacteria 874
506 Ga0500643_000010 3300053087 Bacteria 408084
507 Ga0500643_000980 3300053087 Bacteria 17591
508 Ga0500644_0001354 3300053088 Bacteria 6562
509 Ga0500646_0000654 3300053090 Bacteria 9905
510 Ga0500583_0001506 3300053092 Bacteria 6705
511 Ga0500583_0046948 3300053092 Bacteria 1988
512 Ga0500651_0000050 3300053093 Bacteria 78674
513 Ga0500651_0016217 3300053093 Bacteria 4580
514 Ga0500651_0179061 3300053093 Bacteria 1260
515 Ga0500650_0000001 3300053098 Bacteria 818797
516 Ga0500555_015286 3300053103 Bacteria 2214
517 Ga0500555_118002 3300053103 Unclassified 664
518 Ga0500562_002352 3300053108 Bacteria 4748
519 Ga0500593_000001 3300053117 Bacteria 784404
520 Ga0500594_0000001 3300053118 Bacteria 1178472
521 Ga0500614_000543 3300053123 Bacteria 9709
522 Ga0500568_0027264 3300053139 Unclassified 2391
523 Ga0500577_0000452 3300053142 Bacteria 10585
524 Ga0500577_0001529 3300053142 Bacteria 5891
525 Ga0500577_0074123 3300053142 Unclassified 1342
526 Ga0500579_019001 3300053143 Bacteria 4452
527 Ga0500604_0029052 3300053151 Bacteria 1609
528 Ga0500570_000007 3300053724 Bacteria 117035
529 Ga0500611_000200 3300053727 Bacteria 7486
530 Ga0501084_0211102 3300054114 Bacteria 1638
531 Ga0587094_006367 3300059513 Bacteria 1413
532 Ga0587067_193745 3300059640 Bacteria 536
533 Ga0587072_154462 3300059643 Bacteria 556
534 Ga0501082_0038970 3300060353 Bacteria 4099

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10002966 Ga0070658_1000296615 123
2 3300005339 Ga0070660_100005971 Ga0070660_10000597110 123
3 3300005341 Ga0070691_10003109 Ga0070691_100031095 123
4 3300005366 Ga0070659_100002754 Ga0070659_1000027549 123
5 3300005458 Ga0070681_10278078 Ga0070681_102780782 123
6 3300005530 Ga0070679_100050426 Ga0070679_1000504263 123
7 3300005563 Ga0068855_100000168 Ga0068855_10000016839 123
8 3300005577 Ga0068857_100000007 Ga0068857_100000007173 123
9 3300020070 Ga0206356_11428383 Ga0206356_114283832 123
10 3300025909 Ga0207705_10007802 Ga0207705_100078029 123
11 3300025912 Ga0207707_10747595 Ga0207707_107475952 123
12 3300025919 Ga0207657_10012344 Ga0207657_100123442 123
13 3300025921 Ga0207652_10056634 Ga0207652_100566344 123
14 3300025932 Ga0207690_10006184 Ga0207690_100061849 123
15 3300025949 Ga0207667_10000339 Ga0207667_1000033969 123
16 3300026116 Ga0207674_10000001 Ga0207674_10000001354 123
17 3300005327 Ga0070658_10000118 Ga0070658_1000011848 124
18 3300025909 Ga0207705_10000167 Ga0207705_1000016740 124
19 3300009174 Ga0105241_10147094 Ga0105241_101470942 129
20 3300025911 Ga0207654_10077006 Ga0207654_100770063 129
21 3300005355 Ga0070671_100099357 Ga0070671_1000993573 131
22 3300005530 Ga0070679_101200498 Ga0070679_1012004981 131
23 3300005618 Ga0068864_101741751 Ga0068864_1017417511 131
24 3300005841 Ga0068863_100015791 Ga0068863_1000157916 131
25 3300009093 Ga0105240_10154212 Ga0105240_101542125 131
26 3300009545 Ga0105237_10224620 Ga0105237_102246203 131
27 3300009551 Ga0105238_10861674 Ga0105238_108616742 131
28 3300026088 Ga0207641_10052199 Ga0207641_100521996 131
29 3300026095 Ga0207676_11353979 Ga0207676_113539791 131
30 3300005339 Ga0070660_100000333 Ga0070660_10000033310 132
31 3300005339 Ga0070660_100315053 Ga0070660_1003150532 132
32 3300005355 Ga0070671_101330525 Ga0070671_1013305251 132
33 3300005356 Ga0070674_101413290 Ga0070674_1014132901 132
34 3300005435 Ga0070714_100000655 Ga0070714_10000065522 132
35 3300025919 Ga0207657_10001264 Ga0207657_1000126424 132
36 3300025929 Ga0207664_10000295 Ga0207664_1000029525 132
37 3300026088 Ga0207641_10075238 Ga0207641_100752385 132
38 3300035086 Ga0373934_0466448 Ga0373934_0466448_30_428 132
39 3300037418 Ga0395900_0500788 Ga0395900_0500788_10_408 132
40 3300046506 Ga0495583_0447445 Ga0495583_0447445_81_479 132
41 3300049574 Ga0501038_0807084 Ga0501038_0807084_278_676 132
42 3300028800 Ga0265338_10000366 Ga0265338_1000036667 140
43 3300028800 Ga0265338_10087056 Ga0265338_100870563 140
44 3300031251 Ga0265327_10000017 Ga0265327_10000017213 140
45 3300002244 JGI24742J22300_10000008 JGI24742J22300_1000000840 141
46 3300005327 Ga0070658_10096036 Ga0070658_100960362 141
47 3300005328 Ga0070676_10027327 Ga0070676_100273271 141
48 3300005329 Ga0070683_100385392 Ga0070683_1003853922 141
49 3300005329 Ga0070683_102282814 Ga0070683_1022828141 141
50 3300005336 Ga0070680_100290612 Ga0070680_1002906122 141
51 3300005336 Ga0070680_101671259 Ga0070680_1016712591 141
52 3300005337 Ga0070682_100239242 Ga0070682_1002392422 141
53 3300005344 Ga0070661_100032335 Ga0070661_1000323354 141
54 3300005366 Ga0070659_101553554 Ga0070659_1015535541 141
55 3300005458 Ga0070681_10401738 Ga0070681_104017382 141
56 3300005458 Ga0070681_10582976 Ga0070681_105829762 141
57 3300005530 Ga0070679_100015098 Ga0070679_1000150985 141
58 3300005530 Ga0070679_100883065 Ga0070679_1008830652 141
59 3300005530 Ga0070679_101081640 Ga0070679_1010816402 141
60 3300005535 Ga0070684_100601669 Ga0070684_1006016692 141
61 3300005535 Ga0070684_101052379 Ga0070684_1010523792 141
62 3300005539 Ga0068853_100028949 Ga0068853_1000289497 141
63 3300005547 Ga0070693_100261359 Ga0070693_1002613593 141
64 3300005548 Ga0070665_101729602 Ga0070665_1017296021 141
65 3300005563 Ga0068855_100010457 Ga0068855_1000104579 141
66 3300005563 Ga0068855_100030483 Ga0068855_1000304832 141
67 3300005563 Ga0068855_100153992 Ga0068855_1001539922 141
68 3300005563 Ga0068855_100360593 Ga0068855_1003605933 141
69 3300005563 Ga0068855_102352966 Ga0068855_1023529661 141
70 3300005577 Ga0068857_100006944 Ga0068857_1000069445 141
71 3300005577 Ga0068857_100102239 Ga0068857_1001022393 141
72 3300005616 Ga0068852_100250015 Ga0068852_1002500152 141
73 3300009093 Ga0105240_10398207 Ga0105240_103982071 141
74 3300009094 Ga0111539_10006378 Ga0111539_1000637813 141
75 3300009098 Ga0105245_10004714 Ga0105245_100047146 141
76 3300013104 Ga0157370_10204037 Ga0157370_102040372 141
77 3300013105 Ga0157369_10012644 Ga0157369_100126445 141
78 3300013105 Ga0157369_10201054 Ga0157369_102010543 141
79 3300013296 Ga0157374_10361121 Ga0157374_103611212 141
80 3300013307 Ga0157372_10597685 Ga0157372_105976852 141
81 3300013307 Ga0157372_10599942 Ga0157372_105999422 141
82 3300014968 Ga0157379_10029808 Ga0157379_100298085 141
83 3300025907 Ga0207645_10014493 Ga0207645_100144931 141
84 3300025909 Ga0207705_10009031 Ga0207705_100090312 141
85 3300025912 Ga0207707_10044093 Ga0207707_100440932 141
86 3300025912 Ga0207707_10343772 Ga0207707_103437722 141
87 3300025913 Ga0207695_10086726 Ga0207695_100867265 141
88 3300025913 Ga0207695_10498369 Ga0207695_104983691 141
89 3300025917 Ga0207660_10016532 Ga0207660_100165324 141
90 3300025917 Ga0207660_10105786 Ga0207660_101057863 141
91 3300025917 Ga0207660_11276138 Ga0207660_112761381 141
92 3300025920 Ga0207649_10343922 Ga0207649_103439222 141
93 3300025921 Ga0207652_10043364 Ga0207652_100433642 141
94 3300025921 Ga0207652_10052064 Ga0207652_100520643 141
95 3300025921 Ga0207652_10058343 Ga0207652_100583435 141
96 3300025921 Ga0207652_10209652 Ga0207652_102096523 141
97 3300025921 Ga0207652_10210206 Ga0207652_102102064 141
98 3300025927 Ga0207687_10219994 Ga0207687_102199942 141
99 3300025938 Ga0207704_10261118 Ga0207704_102611182 141
100 3300025944 Ga0207661_11934876 Ga0207661_119348761 141
101 3300025949 Ga0207667_10001896 Ga0207667_1000189625 141
102 3300025949 Ga0207667_10059507 Ga0207667_100595076 141
103 3300025949 Ga0207667_10060856 Ga0207667_100608565 141
104 3300025949 Ga0207667_10263588 Ga0207667_102635884 141
105 3300025949 Ga0207667_11032672 Ga0207667_110326722 141
106 3300025949 Ga0207667_11075479 Ga0207667_110754792 141
107 3300026116 Ga0207674_10014249 Ga0207674_100142495 141
108 3300026116 Ga0207674_10141133 Ga0207674_101411333 141
109 3300026142 Ga0207698_10007011 Ga0207698_100070118 141
110 3300028379 Ga0268266_11376636 Ga0268266_113766361 141
111 3300028558 Ga0265326_10011258 Ga0265326_100112583 141
112 3300028573 Ga0265334_10006824 Ga0265334_100068247 141
113 3300028654 Ga0265322_10004713 Ga0265322_100047136 141
114 3300028800 Ga0265338_10000419 Ga0265338_1000041921 141
115 3300028800 Ga0265338_10008859 Ga0265338_100088593 141
116 3300028800 Ga0265338_10424482 Ga0265338_104244821 141
117 3300029957 Ga0265324_10007997 Ga0265324_100079976 141
118 3300030734 Ga0316179_1001639 Ga0316179_10016391 141
119 3300031235 Ga0265330_10113046 Ga0265330_101130461 141
120 3300031238 Ga0265332_10247034 Ga0265332_102470342 141
121 3300031240 Ga0265320_10018766 Ga0265320_100187666 141
122 3300031241 Ga0265325_10085818 Ga0265325_100858183 141
123 3300031251 Ga0265327_10002752 Ga0265327_1000275218 141
124 3300031251 Ga0265327_10033845 Ga0265327_100338453 141
125 3300031344 Ga0265316_10013001 Ga0265316_100130013 141
126 3300044694 Ga0466963_0193095 Ga0466963_0193095_625_1056 141
127 3300046506 Ga0495583_0016469 Ga0495583_0016469_710_1138 141
128 3300046691 Ga0495670_0744853 Ga0495670_0744853_50_475 141
129 3300049584 Ga0501068_1046487 Ga0501068_1046487_87_512 141
130 3300049589 Ga0501073_0530035 Ga0501073_0530035_194_619 141
131 3300049742 Ga0501080_0001480 Ga0501080_0001480_7964_8389 141
132 3300053103 Ga0500555_015286 Ga0500555_015286_771_1196 141
133 3300053117 Ga0500593_000001 Ga0500593_000001_535945_536370 141
134 3300053151 Ga0500604_0029052 Ga0500604_0029052_251_679 141
135 3300053724 Ga0500570_000007 Ga0500570_000007_87979_88404 141
136 3300054114 Ga0501084_0211102 Ga0501084_0211102_1164_1589 141
137 3300001904 JGI24736J21556_1013380 JGI24736J21556_10133803 142
138 3300005290 Ga0065712_10532958 Ga0065712_105329581 142
139 3300005327 Ga0070658_10000012 Ga0070658_10000012135 142
140 3300005327 Ga0070658_10000133 Ga0070658_1000013372 142
141 3300005327 Ga0070658_10004235 Ga0070658_1000423512 142
142 3300005327 Ga0070658_10019878 Ga0070658_100198785 142
143 3300005327 Ga0070658_10662774 Ga0070658_106627743 142
144 3300005327 Ga0070658_10669758 Ga0070658_106697582 142
145 3300005328 Ga0070676_10045348 Ga0070676_100453484 142
146 3300005329 Ga0070683_100539502 Ga0070683_1005395022 142
147 3300005330 Ga0070690_100003465 Ga0070690_1000034655 142
148 3300005331 Ga0070670_100016224 Ga0070670_1000162244 142
149 3300005334 Ga0068869_100748667 Ga0068869_1007486671 142
150 3300005336 Ga0070680_100000260 Ga0070680_10000026019 142
151 3300005336 Ga0070680_100010821 Ga0070680_1000108214 142
152 3300005336 Ga0070680_100047154 Ga0070680_1000471544 142
153 3300005336 Ga0070680_100334545 Ga0070680_1003345453 142
154 3300005337 Ga0070682_100000552 Ga0070682_1000005526 142
155 3300005337 Ga0070682_100352814 Ga0070682_1003528142 142
156 3300005339 Ga0070660_100001027 Ga0070660_10000102722 142
157 3300005347 Ga0070668_100757023 Ga0070668_1007570232 142
158 3300005354 Ga0070675_101475291 Ga0070675_1014752912 142
159 3300005355 Ga0070671_100000001 Ga0070671_100000001369 142
160 3300005355 Ga0070671_100907510 Ga0070671_1009075101 142
161 3300005356 Ga0070674_100033506 Ga0070674_1000335065 142
162 3300005364 Ga0070673_100001258 Ga0070673_10000125814 142
163 3300005365 Ga0070688_100239375 Ga0070688_1002393752 142
164 3300005366 Ga0070659_100170136 Ga0070659_1001701362 142
165 3300005367 Ga0070667_100000001 Ga0070667_100000001852 142
166 3300005367 Ga0070667_100008028 Ga0070667_1000080288 142
167 3300005367 Ga0070667_100153122 Ga0070667_1001531225 142
168 3300005456 Ga0070678_100000962 Ga0070678_10000096215 142
169 3300005456 Ga0070678_100048777 Ga0070678_1000487775 142
170 3300005458 Ga0070681_10012754 Ga0070681_100127547 142
171 3300005458 Ga0070681_10016002 Ga0070681_100160028 142
172 3300005459 Ga0068867_100084245 Ga0068867_1000842451 142
173 3300005466 Ga0070685_10000179 Ga0070685_1000017931 142
174 3300005466 Ga0070685_10014551 Ga0070685_100145512 142
175 3300005530 Ga0070679_100000670 Ga0070679_1000006705 142
176 3300005530 Ga0070679_100007895 Ga0070679_10000789513 142
177 3300005530 Ga0070679_100024364 Ga0070679_1000243642 142
178 3300005530 Ga0070679_100061302 Ga0070679_1000613024 142
179 3300005530 Ga0070679_100788703 Ga0070679_1007887032 142
180 3300005539 Ga0068853_100178249 Ga0068853_1001782491 142
181 3300005544 Ga0070686_100009484 Ga0070686_1000094845 142
182 3300005544 Ga0070686_100162625 Ga0070686_1001626252 142
183 3300005548 Ga0070665_100088146 Ga0070665_1000881462 142
184 3300005548 Ga0070665_100134298 Ga0070665_1001342981 142
185 3300005563 Ga0068855_100003212 Ga0068855_1000032128 142
186 3300005563 Ga0068855_100041299 Ga0068855_1000412997 142
187 3300005563 Ga0068855_100076544 Ga0068855_1000765442 142
188 3300005563 Ga0068855_100213926 Ga0068855_1002139263 142
189 3300005563 Ga0068855_100653438 Ga0068855_1006534382 142
190 3300005577 Ga0068857_100046349 Ga0068857_1000463494 142
191 3300005577 Ga0068857_100164691 Ga0068857_1001646911 142
192 3300005577 Ga0068857_100615431 Ga0068857_1006154312 142
193 3300005614 Ga0068856_100000001 Ga0068856_100000001341 142
194 3300005614 Ga0068856_100004478 Ga0068856_10000447811 142
195 3300005614 Ga0068856_100015323 Ga0068856_1000153236 142
196 3300005614 Ga0068856_100497226 Ga0068856_1004972262 142
197 3300005719 Ga0068861_100140091 Ga0068861_1001400913 142
198 3300005841 Ga0068863_100590701 Ga0068863_1005907012 142
199 3300005841 Ga0068863_100880801 Ga0068863_1008808013 142
200 3300005841 Ga0068863_102652601 Ga0068863_1026526011 142
201 3300005843 Ga0068860_100160407 Ga0068860_1001604072 142
202 3300005843 Ga0068860_101680038 Ga0068860_1016800382 142
203 3300005937 Ga0081455_10000003 Ga0081455_10000003245 142
204 3300006038 Ga0075365_10001969 Ga0075365_100019698 142
205 3300006038 Ga0075365_10148163 Ga0075365_101481633 142
206 3300006038 Ga0075365_10437129 Ga0075365_104371293 142
207 3300006042 Ga0075368_10005596 Ga0075368_100055962 142
208 3300006048 Ga0075363_100000559 Ga0075363_10000055911 142
209 3300006051 Ga0075364_10037683 Ga0075364_100376833 142
210 3300006051 Ga0075364_10276742 Ga0075364_102767422 142
211 3300006178 Ga0075367_10013981 Ga0075367_100139813 142
212 3300006178 Ga0075367_10835692 Ga0075367_108356921 142
213 3300006186 Ga0075369_10000003 Ga0075369_10000003116 142
214 3300006186 Ga0075369_10312722 Ga0075369_103127221 142
215 3300006195 Ga0075366_10000005 Ga0075366_1000000561 142
216 3300006237 Ga0097621_100163420 Ga0097621_1001634202 142
217 3300006353 Ga0075370_10007562 Ga0075370_100075623 142
218 3300006358 Ga0068871_101561252 Ga0068871_1015612521 142
219 3300006844 Ga0075428_100001047 Ga0075428_1000010477 142
220 3300006846 Ga0075430_100016200 Ga0075430_1000162005 142
221 3300006881 Ga0068865_100048913 Ga0068865_1000489135 142
222 3300006931 Ga0097620_100181443 Ga0097620_1001814433 142
223 3300009092 Ga0105250_10131050 Ga0105250_101310501 142
224 3300009093 Ga0105240_10000003 Ga0105240_10000003949 142
225 3300009093 Ga0105240_10221294 Ga0105240_102212945 142
226 3300009093 Ga0105240_10761085 Ga0105240_107610852 142
227 3300009093 Ga0105240_11684608 Ga0105240_116846081 142
228 3300009098 Ga0105245_10000001 Ga0105245_10000001287 142
229 3300009098 Ga0105245_10000050 Ga0105245_1000005088 142
230 3300009098 Ga0105245_10002473 Ga0105245_100024735 142
231 3300009098 Ga0105245_10174653 Ga0105245_101746534 142
232 3300009098 Ga0105245_10438781 Ga0105245_104387813 142
233 3300009098 Ga0105245_11917236 Ga0105245_119172361 142
234 3300009148 Ga0105243_10000001 Ga0105243_10000001342 142
235 3300009174 Ga0105241_10000003 Ga0105241_1000000323 142
236 3300009176 Ga0105242_10000011 Ga0105242_10000011109 142
237 3300009176 Ga0105242_10006407 Ga0105242_100064075 142
238 3300009176 Ga0105242_10157211 Ga0105242_101572113 142
239 3300009177 Ga0105248_10154446 Ga0105248_101544462 142
240 3300009177 Ga0105248_10258185 Ga0105248_102581852 142
241 3300009545 Ga0105237_10076151 Ga0105237_100761513 142
242 3300009545 Ga0105237_10095290 Ga0105237_100952905 142
243 3300009545 Ga0105237_11501102 Ga0105237_115011022 142
244 3300009551 Ga0105238_10001974 Ga0105238_100019745 142
245 3300009551 Ga0105238_10050491 Ga0105238_100504914 142
246 3300009553 Ga0105249_10943570 Ga0105249_109435701 142
247 3300009553 Ga0105249_12306434 Ga0105249_123064341 142
248 3300009993 Ga0105028_100118 Ga0105028_1001184 142
249 3300010375 Ga0105239_10029375 Ga0105239_100293754 142
250 3300010375 Ga0105239_10061240 Ga0105239_100612404 142
251 3300010375 Ga0105239_10311588 Ga0105239_103115883 142
252 3300010375 Ga0105239_10486668 Ga0105239_104866682 142
253 3300010375 Ga0105239_12293229 Ga0105239_122932291 142
254 3300013100 Ga0157373_10180133 Ga0157373_101801331 142
255 3300013104 Ga0157370_10610158 Ga0157370_106101582 142
256 3300013105 Ga0157369_10381310 Ga0157369_103813103 142
257 3300013296 Ga0157374_10000115 Ga0157374_100001159 142
258 3300013296 Ga0157374_10048418 Ga0157374_100484186 142
259 3300013296 Ga0157374_10161220 Ga0157374_101612204 142
260 3300013296 Ga0157374_10509133 Ga0157374_105091332 142
261 3300013297 Ga0157378_10098808 Ga0157378_100988081 142
262 3300013297 Ga0157378_10753547 Ga0157378_107535472 142
263 3300013306 Ga0163162_10103871 Ga0163162_101038712 142
264 3300013307 Ga0157372_10002139 Ga0157372_1000213910 142
265 3300013307 Ga0157372_10489963 Ga0157372_104899633 142
266 3300013308 Ga0157375_12860054 Ga0157375_128600541 142
267 3300014325 Ga0163163_10235977 Ga0163163_102359771 142
268 3300014325 Ga0163163_10920265 Ga0163163_109202651 142
269 3300014326 Ga0157380_10313405 Ga0157380_103134051 142
270 3300014969 Ga0157376_10000007 Ga0157376_10000007365 142
271 3300020076 Ga0206355_1300670 Ga0206355_13006701 142
272 3300025315 Ga0207697_10100860 Ga0207697_101008602 142
273 3300025904 Ga0207647_10001958 Ga0207647_1000195815 142
274 3300025904 Ga0207647_10078916 Ga0207647_100789162 142
275 3300025907 Ga0207645_10382661 Ga0207645_103826612 142
276 3300025909 Ga0207705_10000011 Ga0207705_10000011363 142
277 3300025909 Ga0207705_10000038 Ga0207705_10000038102 142
278 3300025909 Ga0207705_10042645 Ga0207705_100426455 142
279 3300025909 Ga0207705_10044586 Ga0207705_100445862 142
280 3300025909 Ga0207705_10100931 Ga0207705_101009313 142
281 3300025909 Ga0207705_10808128 Ga0207705_108081281 142
282 3300025911 Ga0207654_10000002 Ga0207654_100000021186 142
283 3300025912 Ga0207707_10012376 Ga0207707_100123768 142
284 3300025912 Ga0207707_10552189 Ga0207707_105521892 142
285 3300025913 Ga0207695_10000005 Ga0207695_10000005959 142
286 3300025914 Ga0207671_10072385 Ga0207671_100723854 142
287 3300025914 Ga0207671_10201190 Ga0207671_102011901 142
288 3300025917 Ga0207660_10007429 Ga0207660_100074294 142
289 3300025917 Ga0207660_10091261 Ga0207660_100912613 142
290 3300025917 Ga0207660_10410009 Ga0207660_104100091 142
291 3300025919 Ga0207657_10001852 Ga0207657_100018526 142
292 3300025919 Ga0207657_10191614 Ga0207657_101916142 142
293 3300025921 Ga0207652_10005490 Ga0207652_1000549013 142
294 3300025921 Ga0207652_10007222 Ga0207652_100072223 142
295 3300025921 Ga0207652_10042986 Ga0207652_100429861 142
296 3300025921 Ga0207652_10045321 Ga0207652_100453214 142
297 3300025921 Ga0207652_10122913 Ga0207652_101229133 142
298 3300025921 Ga0207652_10204828 Ga0207652_102048284 142
299 3300025921 Ga0207652_10914263 Ga0207652_109142632 142
300 3300025921 Ga0207652_11137295 Ga0207652_111372951 142
301 3300025924 Ga0207694_10033970 Ga0207694_100339702 142
302 3300025924 Ga0207694_10365237 Ga0207694_103652372 142
303 3300025924 Ga0207694_10984525 Ga0207694_109845252 142
304 3300025925 Ga0207650_10084149 Ga0207650_100841493 142
305 3300025927 Ga0207687_10000030 Ga0207687_10000030152 142
306 3300025927 Ga0207687_10000117 Ga0207687_100001175 142
307 3300025927 Ga0207687_10017391 Ga0207687_100173913 142
308 3300025927 Ga0207687_10485182 Ga0207687_104851822 142
309 3300025927 Ga0207687_11486723 Ga0207687_114867231 142
310 3300025931 Ga0207644_10000001 Ga0207644_100000011069 142
311 3300025931 Ga0207644_10710995 Ga0207644_107109952 142
312 3300025931 Ga0207644_10966798 Ga0207644_109667982 142
313 3300025932 Ga0207690_10263246 Ga0207690_102632462 142
314 3300025934 Ga0207686_10000001 Ga0207686_10000001800 142
315 3300025934 Ga0207686_10004323 Ga0207686_100043237 142
316 3300025934 Ga0207686_10558410 Ga0207686_105584102 142
317 3300025935 Ga0207709_10000002 Ga0207709_10000002918 142
318 3300025937 Ga0207669_10030089 Ga0207669_100300894 142
319 3300025937 Ga0207669_10224013 Ga0207669_102240132 142
320 3300025938 Ga0207704_10217851 Ga0207704_102178512 142
321 3300025941 Ga0207711_10199827 Ga0207711_101998273 142
322 3300025941 Ga0207711_10259450 Ga0207711_102594502 142
323 3300025941 Ga0207711_10565191 Ga0207711_105651912 142
324 3300025942 Ga0207689_10659637 Ga0207689_106596372 142
325 3300025944 Ga0207661_10583706 Ga0207661_105837062 142
326 3300025949 Ga0207667_10006376 Ga0207667_1000637614 142
327 3300025949 Ga0207667_10048777 Ga0207667_100487776 142
328 3300025949 Ga0207667_10087542 Ga0207667_100875423 142
329 3300025960 Ga0207651_10019642 Ga0207651_100196424 142
330 3300025961 Ga0207712_11290267 Ga0207712_112902671 142
331 3300025972 Ga0207668_10608865 Ga0207668_106088652 142
332 3300025986 Ga0207658_10000003 Ga0207658_10000003527 142
333 3300025986 Ga0207658_10031028 Ga0207658_100310286 142
334 3300025986 Ga0207658_10161602 Ga0207658_101616024 142
335 3300026035 Ga0207703_10640007 Ga0207703_106400072 142
336 3300026041 Ga0207639_10051853 Ga0207639_100518534 142
337 3300026041 Ga0207639_11333120 Ga0207639_113331202 142
338 3300026078 Ga0207702_10000001 Ga0207702_10000001890 142
339 3300026078 Ga0207702_10011223 Ga0207702_100112233 142
340 3300026078 Ga0207702_10013958 Ga0207702_100139587 142
341 3300026078 Ga0207702_10435389 Ga0207702_104353892 142
342 3300026089 Ga0207648_10057394 Ga0207648_100573943 142
343 3300026116 Ga0207674_10059309 Ga0207674_100593095 142
344 3300026116 Ga0207674_10283905 Ga0207674_102839051 142
345 3300026116 Ga0207674_10574923 Ga0207674_105749232 142
346 3300026116 Ga0207674_10644717 Ga0207674_106447172 142
347 3300026116 Ga0207674_10982211 Ga0207674_109822112 142
348 3300026121 Ga0207683_10029174 Ga0207683_100291745 142
349 3300026121 Ga0207683_10386958 Ga0207683_103869581 142
350 3300027866 Ga0209813_10000154 Ga0209813_1000015416 142
351 3300028379 Ga0268266_10002329 Ga0268266_100023295 142
352 3300028379 Ga0268266_10088619 Ga0268266_100886191 142
353 3300028379 Ga0268266_10569046 Ga0268266_105690462 142
354 3300028381 Ga0268264_10058168 Ga0268264_100581687 142
355 3300028381 Ga0268264_10152409 Ga0268264_101524093 142
356 3300028381 Ga0268264_11727487 Ga0268264_117274871 142
357 3300028556 Ga0265337_1000227 Ga0265337_100022737 142
358 3300028556 Ga0265337_1000244 Ga0265337_100024411 142
359 3300028556 Ga0265337_1002862 Ga0265337_10028624 142
360 3300028556 Ga0265337_1029554 Ga0265337_10295543 142
361 3300028556 Ga0265337_1057712 Ga0265337_10577122 142
362 3300028558 Ga0265326_10000755 Ga0265326_1000075511 142
363 3300028558 Ga0265326_10003333 Ga0265326_100033336 142
364 3300028558 Ga0265326_10005376 Ga0265326_100053766 142
365 3300028558 Ga0265326_10015700 Ga0265326_100157002 142
366 3300028563 Ga0265319_1016715 Ga0265319_10167154 142
367 3300028563 Ga0265319_1075636 Ga0265319_10756362 142
368 3300028563 Ga0265319_1078501 Ga0265319_10785013 142
369 3300028563 Ga0265319_1143501 Ga0265319_11435011 142
370 3300028563 Ga0265319_1214409 Ga0265319_12144091 142
371 3300028573 Ga0265334_10000057 Ga0265334_1000005716 142
372 3300028573 Ga0265334_10000144 Ga0265334_1000014441 142
373 3300028573 Ga0265334_10001811 Ga0265334_100018114 142
374 3300028573 Ga0265334_10019884 Ga0265334_100198843 142
375 3300028573 Ga0265334_10035249 Ga0265334_100352494 142
376 3300028573 Ga0265334_10072370 Ga0265334_100723703 142
377 3300028577 Ga0265318_10004668 Ga0265318_100046684 142
378 3300028577 Ga0265318_10088691 Ga0265318_100886913 142
379 3300028577 Ga0265318_10096818 Ga0265318_100968181 142
380 3300028653 Ga0265323_10002827 Ga0265323_100028279 142
381 3300028654 Ga0265322_10000864 Ga0265322_1000086413 142
382 3300028654 Ga0265322_10007979 Ga0265322_100079792 142
383 3300028666 Ga0265336_10001710 Ga0265336_100017103 142
384 3300028666 Ga0265336_10003300 Ga0265336_100033004 142
385 3300028666 Ga0265336_10007276 Ga0265336_100072762 142
386 3300028666 Ga0265336_10007661 Ga0265336_100076619 142
387 3300028800 Ga0265338_10000003 Ga0265338_10000003531 142
388 3300028800 Ga0265338_10000054 Ga0265338_10000054101 142
389 3300028800 Ga0265338_10000130 Ga0265338_1000013095 142
390 3300028800 Ga0265338_10000771 Ga0265338_1000077119 142
391 3300028800 Ga0265338_10000841 Ga0265338_1000084145 142
392 3300028800 Ga0265338_10001885 Ga0265338_1000188512 142
393 3300028800 Ga0265338_10002761 Ga0265338_1000276112 142
394 3300028800 Ga0265338_10008051 Ga0265338_1000805123 142
395 3300028800 Ga0265338_10036590 Ga0265338_100365904 142
396 3300028800 Ga0265338_10049830 Ga0265338_100498306 142
397 3300028800 Ga0265338_10157351 Ga0265338_101573513 142
398 3300028800 Ga0265338_10444798 Ga0265338_104447983 142
399 3300028800 Ga0265338_10453931 Ga0265338_104539311 142
400 3300029957 Ga0265324_10010258 Ga0265324_100102584 142
401 3300029957 Ga0265324_10034109 Ga0265324_100341092 142
402 3300031235 Ga0265330_10004460 Ga0265330_100044603 142
403 3300031238 Ga0265332_10007896 Ga0265332_100078968 142
404 3300031238 Ga0265332_10026194 Ga0265332_100261943 142
405 3300031239 Ga0265328_10001186 Ga0265328_100011864 142
406 3300031240 Ga0265320_10005897 Ga0265320_100058975 142
407 3300031240 Ga0265320_10188324 Ga0265320_101883241 142
408 3300031241 Ga0265325_10003439 Ga0265325_100034395 142
409 3300031242 Ga0265329_10003025 Ga0265329_100030256 142
410 3300031247 Ga0265340_10002179 Ga0265340_100021799 142
411 3300031247 Ga0265340_10014553 Ga0265340_100145532 142
412 3300031249 Ga0265339_10007998 Ga0265339_100079985 142
413 3300031249 Ga0265339_10171612 Ga0265339_101716121 142
414 3300031249 Ga0265339_10208363 Ga0265339_102083631 142
415 3300031249 Ga0265339_10245439 Ga0265339_102454392 142
416 3300031250 Ga0265331_10007364 Ga0265331_100073645 142
417 3300031251 Ga0265327_10003189 Ga0265327_100031896 142
418 3300031251 Ga0265327_10021544 Ga0265327_100215446 142
419 3300031251 Ga0265327_10029322 Ga0265327_100293224 142
420 3300031251 Ga0265327_10349580 Ga0265327_103495802 142
421 3300031344 Ga0265316_10029923 Ga0265316_100299234 142
422 3300031344 Ga0265316_10046243 Ga0265316_100462438 142
423 3300031344 Ga0265316_10385003 Ga0265316_103850031 142
424 3300031344 Ga0265316_10402868 Ga0265316_104028683 142
425 3300031344 Ga0265316_10635197 Ga0265316_106351971 142
426 3300031595 Ga0265313_10005371 Ga0265313_100053712 142
427 3300031595 Ga0265313_10009485 Ga0265313_100094854 142
428 3300031595 Ga0265313_10011005 Ga0265313_100110055 142
429 3300031711 Ga0265314_10006571 Ga0265314_100065714 142
430 3300031711 Ga0265314_10264297 Ga0265314_102642972 142
431 3300031711 Ga0265314_10609177 Ga0265314_106091772 142
432 3300031712 Ga0265342_10006215 Ga0265342_1000621511 142
433 3300035089 Ga0373944_0140597 Ga0373944_0140597_255_683 142
434 3300037312 Ga0395899_0009307 Ga0395899_0009307_434_862 142
435 3300037312 Ga0395899_0200771 Ga0395899_0200771_295_723 142
436 3300037312 Ga0395899_0418799 Ga0395899_0418799_442_870 142
437 3300037418 Ga0395900_0001880 Ga0395900_0001880_12245_12673 142
438 3300037418 Ga0395900_0002167 Ga0395900_0002167_8462_8890 142
439 3300037418 Ga0395900_0023300 Ga0395900_0023300_3981_4412 142
440 3300037418 Ga0395900_0043498 Ga0395900_0043498_3634_4062 142
441 3300037418 Ga0395900_0080917 Ga0395900_0080917_21_449 142
442 3300037418 Ga0395900_0200518 Ga0395900_0200518_1125_1553 142
443 3300037418 Ga0395900_1336473 Ga0395900_1336473_24_452 142
444 3300037466 Ga0395898_0001404 Ga0395898_0001404_33610_34038 142
445 3300037466 Ga0395898_0004142 Ga0395898_0004142_7132_7560 142
446 3300037466 Ga0395898_0043454 Ga0395898_0043454_2595_3023 142
447 3300037466 Ga0395898_0333281 Ga0395898_0333281_143_571 142
448 3300037471 Ga0395905_0002235 Ga0395905_0002235_6428_6856 142
449 3300037471 Ga0395905_0087579 Ga0395905_0087579_1219_1647 142
450 3300037471 Ga0395905_0546811 Ga0395905_0546811_30_476 142
451 3300037471 Ga0395905_1360630 Ga0395905_1360630_93_521 142
452 3300038443 Ga0395901_0001834 Ga0395901_0001834_12359_12787 142
453 3300038443 Ga0395901_0009097 Ga0395901_0009097_6242_6670 142
454 3300038443 Ga0395901_0019837 Ga0395901_0019837_2465_2893 142
455 3300038443 Ga0395901_0035007 Ga0395901_0035007_4255_4683 142
456 3300038443 Ga0395901_0200221 Ga0395901_0200221_1193_1621 142
457 3300038443 Ga0395901_1029960 Ga0395901_1029960_234_665 142
458 3300041459 Ga0451800_1051778 Ga0451800_1051778_124_552 142
459 3300041486 Ga0451807_0582546 Ga0451807_0582546_223_660 142
460 3300041486 Ga0451807_1043250 Ga0451807_1043250_473_901 142
461 3300045976 Ga0466967_0255661 Ga0466967_0255661_182_610 142
462 3300045976 Ga0466967_0994819 Ga0466967_0994819_292_720 142
463 3300046683 Ga0495658_0038913 Ga0495658_0038913_1374_1802 142
464 3300046694 Ga0495649_0000379 Ga0495649_0000379_30220_30648 142
465 3300047320 Ga0495672_0000016 Ga0495672_0000016_141885_142313 142
466 3300048903 Ga0496100_0487582 Ga0496100_0487582_397_825 142
467 3300048915 Ga0496112_0304724 Ga0496112_0304724_531_959 142
468 3300048916 Ga0496113_0435169 Ga0496113_0435169_81_509 142
469 3300048929 Ga0496126_0057535 Ga0496126_0057535_1346_1774 142
470 3300049568 Ga0501031_0002235 Ga0501031_0002235_7763_8191 142
471 3300049569 Ga0501032_0000394 Ga0501032_0000394_28982_29410 142
472 3300049571 Ga0501034_0032705 Ga0501034_0032705_554_982 142
473 3300049571 Ga0501034_0076194 Ga0501034_0076194_1549_1977 142
474 3300049571 Ga0501034_0134594 Ga0501034_0134594_1145_1573 142
475 3300049572 Ga0501036_0025601 Ga0501036_0025601_2534_2962 142
476 3300049572 Ga0501036_0332363 Ga0501036_0332363_606_1034 142
477 3300049573 Ga0501037_0000133 Ga0501037_0000133_63548_63976 142
478 3300049574 Ga0501038_0023026 Ga0501038_0023026_3860_4288 142
479 3300049578 Ga0501042_0014645 Ga0501042_0014645_1314_1742 142
480 3300049579 Ga0501043_0004814 Ga0501043_0004814_4944_5372 142
481 3300049580 Ga0501046_0000038 Ga0501046_0000038_86213_86641 142
482 3300049580 Ga0501046_0101318 Ga0501046_0101318_1552_1980 142
483 3300049581 Ga0501047_0000355 Ga0501047_0000355_49164_49592 142
484 3300049581 Ga0501047_0009034 Ga0501047_0009034_6051_6479 142
485 3300049582 Ga0501048_0000379 Ga0501048_0000379_5609_6037 142
486 3300049585 Ga0501069_0262536 Ga0501069_0262536_214_642 142
487 3300049586 Ga0501070_0046000 Ga0501070_0046000_1954_2382 142
488 3300049586 Ga0501070_0209825 Ga0501070_0209825_76_504 142
489 3300049589 Ga0501073_0072903 Ga0501073_0072903_643_1071 142
490 3300049589 Ga0501073_0484983 Ga0501073_0484983_228_656 142
491 3300049590 Ga0501074_0220874 Ga0501074_0220874_537_965 142
492 3300049744 Ga0501083_0269133 Ga0501083_0269133_284_712 142
493 3300049744 Ga0501083_0549713 Ga0501083_0549713_97_525 142
494 3300049822 Ga0501035_0001229 Ga0501035_0001229_19517_19945 142
495 3300049822 Ga0501035_0002682 Ga0501035_0002682_11055_11483 142
496 3300049823 Ga0501044_0110414 Ga0501044_0110414_1003_1431 142
497 3300050489 nmdc:mga03683_126162_c1 nmdc:mga03683_126162_c1_36_464 142
498 3300050490 nmdc:mga03n38_357_c1 nmdc:mga03n38_357_c1_8108_8536 142
499 3300050492 nmdc:mga0yw44_173902_c1 nmdc:mga0yw44_173902_c1_69_497 142
500 3300050492 nmdc:mga0yw44_615_c1 nmdc:mga0yw44_615_c1_4765_5193 142
501 3300050493 nmdc:mga0k408_206643_c1 nmdc:mga0k408_206643_c1_197_625 142
502 3300050493 nmdc:mga0k408_36_c1 nmdc:mga0k408_36_c1_53104_53532 142
503 3300050494 nmdc:mga06z11_1_c2 nmdc:mga06z11_1_c2_1118_1546 142
504 3300050495 nmdc:mga04h51_6_c2 nmdc:mga04h51_6_c2_1414_1842 142
505 3300050496 nmdc:mga07m45_60737_c1 nmdc:mga07m45_60737_c1_1161_1589 142
506 3300050509 nmdc:mga0qj67_5316_c1 nmdc:mga0qj67_5316_c1_5530_5958 142
507 3300050509 nmdc:mga0qj67_547461_c1 nmdc:mga0qj67_547461_c1_11_439 142
508 3300050516 nmdc:mga0sz30_1656_c1 nmdc:mga0sz30_1656_c1_85_516 142
509 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_410595_411023 142
510 3300050516 nmdc:mga0sz30_205895_c1 nmdc:mga0sz30_205895_c1_230_658 142
511 3300053087 Ga0500643_000010 Ga0500643_000010_299477_299905 142
512 3300053087 Ga0500643_000980 Ga0500643_000980_4435_4863 142
513 3300053088 Ga0500644_0001354 Ga0500644_0001354_5213_5641 142
514 3300053090 Ga0500646_0000654 Ga0500646_0000654_8213_8641 142
515 3300053092 Ga0500583_0001506 Ga0500583_0001506_653_1081 142
516 3300053092 Ga0500583_0046948 Ga0500583_0046948_1003_1431 142
517 3300053093 Ga0500651_0000050 Ga0500651_0000050_63371_63799 142
518 3300053093 Ga0500651_0016217 Ga0500651_0016217_1641_2069 142
519 3300053093 Ga0500651_0179061 Ga0500651_0179061_271_699 142
520 3300053098 Ga0500650_0000001 Ga0500650_0000001_589487_589915 142
521 3300053103 Ga0500555_118002 Ga0500555_118002_106_534 142
522 3300053108 Ga0500562_002352 Ga0500562_002352_2930_3358 142
523 3300053118 Ga0500594_0000001 Ga0500594_0000001_73051_73479 142
524 3300053123 Ga0500614_000543 Ga0500614_000543_1755_2183 142
525 3300053139 Ga0500568_0027264 Ga0500568_0027264_586_1014 142
526 3300053142 Ga0500577_0000452 Ga0500577_0000452_7487_7915 142
527 3300053142 Ga0500577_0001529 Ga0500577_0001529_2299_2727 142
528 3300053142 Ga0500577_0074123 Ga0500577_0074123_827_1255 142
529 3300053143 Ga0500579_019001 Ga0500579_019001_319_747 142
530 3300053727 Ga0500611_000200 Ga0500611_000200_1914_2342 142
531 3300059513 Ga0587094_006367 Ga0587094_006367_733_1161 142
532 3300059640 Ga0587067_193745 Ga0587067_193745_31_459 142
533 3300059643 Ga0587072_154462 Ga0587072_154462_107_535 142
534 3300060353 Ga0501082_0038970 Ga0501082_0038970_2168_2596 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03946

Ribosomal_L11_N

Ribosomal protein L11, N-terminal domain

19

76

0.97

PF00298

Ribosomal_L11

Ribosomal protein L11, RNA binding domain

82

150

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cjt-assembly4.cif.gz_H ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.977 3 72
3egv-assembly1.cif.gz_B ribosomal protein l11 methyltransferase (prma) in complex with trimethylated ribosomal protein l11 0.9595 3 78
3cjt-assembly4.cif.gz_H ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.9505 3 72
3egv-assembly1.cif.gz_B ribosomal protein l11 methyltransferase (prma) in complex with trimethylated ribosomal protein l11 0.9357 3 78
2bcw-assembly1.cif.gz_A coordinates of the n-terminal domain of ribosomal protein l11,c-terminal domain of ribosomal protein l7/l12 and a portion of the g' domain of elongation factor g, as fitted into cryo-em map of an escherichia coli 70s*ef-g*gdp*fusidic acid complex 0.9149 9 72
ID Description Score Start End Superfamily
af_A0A0R4J4M9_4_71_3.30.1550.10 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9693 3 68 3.30.1550.10
3egvB00 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9595 3 78 3.30.1550.10
4v19K01 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9543 6 70 3.30.1550.10
3egvB00 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9357 3 78 3.30.1550.10
af_A0A0R4J4M9_4_71_3.30.1550.10 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9283 3 68 3.30.1550.10
ID Description Score Start End GO Terms
AF-A0A5C8AR95-F1-model_v4 deleted 0.989 1 72
AF-A0A7J4E0X6-F1-model_v4 deleted 0.9857 1 69
AF-A0A2N2LDD6-F1-model_v4 50S ribosomal protein L11 0.9852 1 72 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A2D7JF69-F1-model_v4 50S ribosomal protein L11 0.9809 1 70 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A5C8AR95-F1-model_v4 deleted 0.9756 1 72

Feature Viewer

pLDDT pTM Quality
82.23 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map