F460493

General Info

Members Datasets Scaffolds Average Seq Length
534 143 534 182

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10006518|JGI24740J21852_100065184
Length 186
Sequence MSSLFRASTLFVVVAALALALAGCNREEHHDRAKPIGETVPAGESPDTIFPGSSTPPPLDPRAALYDNNANAISKGQQLYLQMNCVGCHSHGGGGMGPPLMDDQWRYGGRIDQIATTIAEGRPNGMPSWRGKLTEDQIWDLAAYVRSLSGLPSKDAVSSRSEGMSAGTPQTLTPHAEPKNSDAPQQ

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
114 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
115 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
116 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
121 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
122 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
123 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
142 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
143 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.62
Rhizosphere 96.44
Stem 0
Stem Tuber 0
Unclassified 0.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10006518 3300001979 Bacteria 4823
2 JGI24744J21845_10001590 3300002077 Bacteria 4532
3 rootH2_10157166 3300003320 Bacteria 1272
4 rootL2_10228040 3300003322 Bacteria 1279
5 Ga0070658_10003485 3300005327 Bacteria 12923
6 Ga0070658_10072842 3300005327 Bacteria 2816
7 Ga0070658_10076380 3300005327 Bacteria 2747
8 Ga0070658_10080517 3300005327 Bacteria 2675
9 Ga0070658_10123825 3300005327 Bacteria 2150
10 Ga0070658_10886730 3300005327 Bacteria 775
11 Ga0070658_11200425 3300005327 Bacteria 659
12 Ga0070683_100004273 3300005329 Bacteria 11728
13 Ga0070683_100029407 3300005329 Bacteria 4974
14 Ga0070683_100089116 3300005329 Bacteria 2895
15 Ga0070683_100183661 3300005329 Bacteria 1985
16 Ga0070683_100249701 3300005329 Bacteria 1687
17 Ga0070683_100296201 3300005329 Bacteria 1539
18 Ga0070677_10040075 3300005333 Bacteria 1841
19 Ga0068869_100052082 3300005334 Bacteria 2971
20 Ga0070680_100000726 3300005336 Bacteria 22931
21 Ga0070680_100001419 3300005336 Bacteria 17329
22 Ga0070680_100012806 3300005336 Bacteria 6524
23 Ga0070680_100015719 3300005336 Bacteria 5941
24 Ga0070680_100107520 3300005336 Bacteria 2320
25 Ga0070680_100157614 3300005336 Bacteria 1907
26 Ga0070682_100118859 3300005337 Bacteria 1771
27 Ga0070682_100154965 3300005337 Bacteria 1576
28 Ga0070682_100219766 3300005337 Bacteria 1351
29 Ga0070682_100658190 3300005337 Bacteria 835
30 Ga0068868_100321937 3300005338 Bacteria 1317
31 Ga0070660_100006487 3300005339 Bacteria 8114
32 Ga0070660_100019124 3300005339 Bacteria 5014
33 Ga0070660_100112907 3300005339 Bacteria 2163
34 Ga0070660_100203791 3300005339 Bacteria 1605
35 Ga0070660_100290937 3300005339 Bacteria 1338
36 Ga0070660_100316890 3300005339 Bacteria 1280
37 Ga0070660_100409154 3300005339 Bacteria 1122
38 Ga0070691_10013203 3300005341 Bacteria 3785
39 Ga0070687_100371741 3300005343 Bacteria 929
40 Ga0070661_100012056 3300005344 Bacteria 6040
41 Ga0070661_100014531 3300005344 Bacteria 5548
42 Ga0070661_100018468 3300005344 Bacteria 4957
43 Ga0070661_100025508 3300005344 Bacteria 4249
44 Ga0070661_100050888 3300005344 Bacteria 3032
45 Ga0070661_100286399 3300005344 Bacteria 1279
46 Ga0070661_100327558 3300005344 Bacteria 1197
47 Ga0070661_100342542 3300005344 Bacteria 1171
48 Ga0070661_100790901 3300005344 Bacteria 778
49 Ga0070692_10087674 3300005345 Bacteria 1687
50 Ga0070692_10128269 3300005345 Bacteria 1423
51 Ga0070692_10484796 3300005345 Bacteria 798
52 Ga0070671_100027205 3300005355 Bacteria 4705
53 Ga0070671_100393312 3300005355 Bacteria 1185
54 Ga0070674_100012733 3300005356 Bacteria 5174
55 Ga0070673_100085675 3300005364 Bacteria 2566
56 Ga0070673_100496472 3300005364 Bacteria 1103
57 Ga0070659_100023915 3300005366 Bacteria 4680
58 Ga0070659_100040272 3300005366 Bacteria 3650
59 Ga0070659_100053624 3300005366 Bacteria 3174
60 Ga0070659_100123880 3300005366 Bacteria 2096
61 Ga0070714_100004093 3300005435 Bacteria 10964
62 Ga0070714_100078706 3300005435 Bacteria 2866
63 Ga0070714_100118088 3300005435 Bacteria 2356
64 Ga0070714_100609122 3300005435 Unclassified 1049
65 Ga0070714_100609545 3300005435 Unclassified 1049
66 Ga0070713_100381652 3300005436 Bacteria 1313
67 Ga0070663_100015732 3300005455 Bacteria 4894
68 Ga0070663_100147420 3300005455 Bacteria 1801
69 Ga0070663_100157255 3300005455 Bacteria 1747
70 Ga0070663_100856608 3300005455 Bacteria 782
71 Ga0070678_100281078 3300005456 Bacteria 1407
72 Ga0070662_100031120 3300005457 Bacteria 3742
73 Ga0070662_100037465 3300005457 Bacteria 3438
74 Ga0070662_100296907 3300005457 Bacteria 1311
75 Ga0070662_100430364 3300005457 Bacteria 1093
76 Ga0070662_100490079 3300005457 Bacteria 1024
77 Ga0070681_10029686 3300005458 Bacteria 5490
78 Ga0070681_10063915 3300005458 Bacteria 3652
79 Ga0070681_10233303 3300005458 Bacteria 1754
80 Ga0068867_100028347 3300005459 Bacteria 4032
81 Ga0070679_100039518 3300005530 Bacteria 4689
82 Ga0070679_100087961 3300005530 Bacteria 3094
83 Ga0070679_100122030 3300005530 Bacteria 2590
84 Ga0070679_101166072 3300005530 Bacteria 715
85 Ga0070679_101384756 3300005530 Bacteria 649
86 Ga0070684_100000841 3300005535 Bacteria 21613
87 Ga0070684_100015169 3300005535 Bacteria 6266
88 Ga0070684_100049222 3300005535 Bacteria 3657
89 Ga0070684_100146723 3300005535 Bacteria 2136
90 Ga0068853_100013803 3300005539 Bacteria 6602
91 Ga0068853_100033347 3300005539 Bacteria 4368
92 Ga0068853_100062843 3300005539 Bacteria 3214
93 Ga0068853_100117557 3300005539 Bacteria 2368
94 Ga0068853_100128015 3300005539 Bacteria 2270
95 Ga0068853_100229322 3300005539 Bacteria 1698
96 Ga0068853_100588838 3300005539 Bacteria 1056
97 Ga0070693_100058350 3300005547 Bacteria 2234
98 Ga0070693_100200070 3300005547 Bacteria 1297
99 Ga0070693_100228817 3300005547 Bacteria 1222
100 Ga0068855_100048349 3300005563 Bacteria 5020
101 Ga0068855_100071433 3300005563 Bacteria 4036
102 Ga0068855_100218164 3300005563 Bacteria 2140
103 Ga0068855_100572723 3300005563 Bacteria 1220
104 Ga0068855_100626353 3300005563 Bacteria 1158
105 Ga0068855_101052916 3300005563 Bacteria 852
106 Ga0068855_101093513 3300005563 Bacteria 834
107 Ga0070664_100046267 3300005564 Bacteria 3675
108 Ga0070664_100091474 3300005564 Bacteria 2633
109 Ga0070664_100151360 3300005564 Bacteria 2048
110 Ga0070664_100230841 3300005564 Bacteria 1659
111 Ga0068857_100043692 3300005577 Bacteria 3974
112 Ga0068857_100080922 3300005577 Bacteria 2900
113 Ga0068857_100151480 3300005577 Bacteria 2101
114 Ga0068857_100300528 3300005577 Bacteria 1479
115 Ga0068857_100407965 3300005577 Bacteria 1265
116 Ga0068857_100780503 3300005577 Bacteria 911
117 Ga0068854_100002843 3300005578 Bacteria 10755
118 Ga0068854_100018367 3300005578 Bacteria 4693
119 Ga0068854_100031872 3300005578 Bacteria 3664
120 Ga0068854_100105633 3300005578 Bacteria 2117
121 Ga0068854_100115975 3300005578 Bacteria 2026
122 Ga0068854_100226563 3300005578 Bacteria 1481
123 Ga0068856_100011171 3300005614 Bacteria 8718
124 Ga0068856_100020003 3300005614 Bacteria 6499
125 Ga0068856_100048132 3300005614 Bacteria 4200
126 Ga0068856_100057044 3300005614 Bacteria 3855
127 Ga0068856_100120445 3300005614 Bacteria 2625
128 Ga0068856_100242563 3300005614 Bacteria 1817
129 Ga0068856_100403429 3300005614 Bacteria 1387
130 Ga0068856_100432438 3300005614 Bacteria 1336
131 Ga0068856_100488113 3300005614 Bacteria 1253
132 Ga0068856_100714845 3300005614 Bacteria 1022
133 Ga0068852_100000947 3300005616 Bacteria 19091
134 Ga0068852_100003378 3300005616 Bacteria 11139
135 Ga0068852_100014143 3300005616 Bacteria 6129
136 Ga0068852_100015776 3300005616 Bacteria 5873
137 Ga0068852_100048459 3300005616 Bacteria 3630
138 Ga0068852_100063305 3300005616 Bacteria 3221
139 Ga0068852_100080246 3300005616 Bacteria 2892
140 Ga0068852_100099075 3300005616 Bacteria 2626
141 Ga0068852_100304991 3300005616 Bacteria 1542
142 Ga0068852_100413065 3300005616 Bacteria 1330
143 Ga0068852_101180098 3300005616 Bacteria 786
144 Ga0068866_10011888 3300005718 Bacteria 3782
145 Ga0068851_10024332 3300005834 Bacteria 2965
146 Ga0068851_10053972 3300005834 Bacteria 2047
147 Ga0068851_10079724 3300005834 Bacteria 1708
148 Ga0068851_10384762 3300005834 Bacteria 823
149 Ga0068871_100948976 3300006358 Bacteria 799
150 Ga0105240_10016062 3300009093 Bacteria 10146
151 Ga0105240_10018278 3300009093 Bacteria 9423
152 Ga0105240_10120067 3300009093 Bacteria 3166
153 Ga0105240_10601596 3300009093 Bacteria 1210
154 Ga0105245_10067776 3300009098 Bacteria 3232
155 Ga0105241_10053037 3300009174 Bacteria 3099
156 Ga0105241_10071716 3300009174 Bacteria 2690
157 Ga0105241_10258883 3300009174 Bacteria 1478
158 Ga0105242_10064691 3300009176 Bacteria 3015
159 Ga0105248_10027779 3300009177 Bacteria 6301
160 Ga0105248_10177259 3300009177 Bacteria 2402
161 Ga0105237_10057101 3300009545 Bacteria 3906
162 Ga0105237_10632635 3300009545 Unclassified 1077
163 Ga0105238_10006524 3300009551 Bacteria 11613
164 Ga0105238_10014286 3300009551 Bacteria 8025
165 Ga0105238_10045184 3300009551 Bacteria 4449
166 Ga0105238_10403021 3300009551 Bacteria 1361
167 Ga0105239_10012441 3300010375 Bacteria 9479
168 Ga0157373_10007965 3300013100 Bacteria 7878
169 Ga0157373_10018163 3300013100 Bacteria 5122
170 Ga0157373_10043400 3300013100 Bacteria 3211
171 Ga0157373_10078780 3300013100 Bacteria 2324
172 Ga0157373_10115236 3300013100 Bacteria 1889
173 Ga0157373_10127943 3300013100 Bacteria 1786
174 Ga0157373_10194970 3300013100 Bacteria 1427
175 Ga0157373_10430542 3300013100 Bacteria 948
176 Ga0157371_10010300 3300013102 Bacteria 7294
177 Ga0157371_10047393 3300013102 Bacteria 3056
178 Ga0157371_10076610 3300013102 Bacteria 2368
179 Ga0157371_10114117 3300013102 Bacteria 1919
180 Ga0157371_10118026 3300013102 Bacteria 1886
181 Ga0157371_10126885 3300013102 Bacteria 1815
182 Ga0157371_10154691 3300013102 Bacteria 1636
183 Ga0157371_10200425 3300013102 Bacteria 1431
184 Ga0157371_10200501 3300013102 Bacteria 1430
185 Ga0157370_10016192 3300013104 Bacteria 7557
186 Ga0157370_10044351 3300013104 Bacteria 4275
187 Ga0157370_10052326 3300013104 Bacteria 3899
188 Ga0157370_10161622 3300013104 Bacteria 2083
189 Ga0157370_10211936 3300013104 Bacteria 1795
190 Ga0157370_10289815 3300013104 Bacteria 1512
191 Ga0157370_10439093 3300013104 Bacteria 1200
192 Ga0157369_10013940 3300013105 Bacteria 9084
193 Ga0157369_10043310 3300013105 Bacteria 4906
194 Ga0157369_10064383 3300013105 Bacteria 3949
195 Ga0157369_10097870 3300013105 Bacteria 3129
196 Ga0157369_10127969 3300013105 Bacteria 2692
197 Ga0157369_10141301 3300013105 Bacteria 2548
198 Ga0157369_10147588 3300013105 Bacteria 2486
199 Ga0157369_10153339 3300013105 Bacteria 2435
200 Ga0157369_10258490 3300013105 Bacteria 1816
201 Ga0157369_10268386 3300013105 Bacteria 1779
202 Ga0157369_10299663 3300013105 Bacteria 1672
203 Ga0157369_10859414 3300013105 Bacteria 931
204 Ga0157369_11022349 3300013105 Bacteria 846
205 Ga0157369_11266898 3300013105 Bacteria 752
206 Ga0157372_10025303 3300013307 Bacteria 6451
207 Ga0157372_10032904 3300013307 Bacteria 5690
208 Ga0157372_10085950 3300013307 Bacteria 3568
209 Ga0157372_10197101 3300013307 Bacteria 2333
210 Ga0157372_10240020 3300013307 Bacteria 2103
211 Ga0157372_10297589 3300013307 Bacteria 1877
212 Ga0157372_10439938 3300013307 Bacteria 1520
213 Ga0157372_10635706 3300013307 Bacteria 1243
214 Ga0163163_10704207 3300014325 Bacteria 1073
215 Ga0206356_10588867 3300020070 Bacteria 851
216 Ga0206356_11011314 3300020070 Bacteria 1435
217 Ga0206354_10573897 3300020081 Unclassified 809
218 Ga0206353_12048510 3300020082 Bacteria 1877
219 Ga0213876_10054977 3300021384 Bacteria 2101
220 Ga0207656_10051526 3300025321 Bacteria 1780
221 Ga0207656_10074323 3300025321 Bacteria 1516
222 Ga0207656_10288037 3300025321 Bacteria 811
223 Ga0207682_10020876 3300025893 Bacteria 2574
224 Ga0207647_10000435 3300025904 Bacteria 34176
225 Ga0207647_10008447 3300025904 Bacteria 7383
226 Ga0207647_10012170 3300025904 Bacteria 6001
227 Ga0207647_10243090 3300025904 Bacteria 1033
228 Ga0207645_10127975 3300025907 Bacteria 1652
229 Ga0207705_10011975 3300025909 Bacteria 6267
230 Ga0207705_10017597 3300025909 Bacteria 5115
231 Ga0207705_10020381 3300025909 Bacteria 4740
232 Ga0207705_10026518 3300025909 Bacteria 4132
233 Ga0207705_10064432 3300025909 Bacteria 2648
234 Ga0207705_10151628 3300025909 Bacteria 1737
235 Ga0207705_10252035 3300025909 Bacteria 1346
236 Ga0207705_10676183 3300025909 Unclassified 803
237 Ga0207654_10218097 3300025911 Bacteria 1264
238 Ga0207707_10041920 3300025912 Bacteria 3996
239 Ga0207707_10086763 3300025912 Bacteria 2734
240 Ga0207707_10093264 3300025912 Bacteria 2630
241 Ga0207707_10128778 3300025912 Bacteria 2213
242 Ga0207707_10522782 3300025912 Bacteria 1010
243 Ga0207695_10040720 3300025913 Bacteria 4978
244 Ga0207671_10148791 3300025914 Bacteria 1808
245 Ga0207660_10001632 3300025917 Bacteria 15038
246 Ga0207660_10005431 3300025917 Bacteria 8272
247 Ga0207660_10062709 3300025917 Bacteria 2678
248 Ga0207660_10089680 3300025917 Bacteria 2276
249 Ga0207660_10234897 3300025917 Bacteria 1442
250 Ga0207660_10663805 3300025917 Bacteria 850
251 Ga0207662_10126083 3300025918 Bacteria 1610
252 Ga0207657_10003139 3300025919 Bacteria 17676
253 Ga0207657_10003144 3300025919 Bacteria 17663
254 Ga0207657_10008723 3300025919 Bacteria 10263
255 Ga0207657_10013074 3300025919 Bacteria 8158
256 Ga0207657_10030142 3300025919 Bacteria 4929
257 Ga0207657_10030645 3300025919 Bacteria 4880
258 Ga0207657_10051861 3300025919 Bacteria 3564
259 Ga0207657_10090364 3300025919 Bacteria 2556
260 Ga0207657_10097996 3300025919 Bacteria 2437
261 Ga0207657_10167273 3300025919 Bacteria 1783
262 Ga0207657_10172758 3300025919 Bacteria 1750
263 Ga0207657_10195776 3300025919 Bacteria 1628
264 Ga0207657_10201307 3300025919 Bacteria 1601
265 Ga0207649_10040004 3300025920 Bacteria 2846
266 Ga0207649_10044973 3300025920 Bacteria 2705
267 Ga0207649_10077217 3300025920 Bacteria 2145
268 Ga0207649_10403587 3300025920 Bacteria 1023
269 Ga0207649_10519938 3300025920 Unclassified 907
270 Ga0207649_10956200 3300025920 Bacteria 673
271 Ga0207652_10019846 3300025921 Bacteria 5533
272 Ga0207652_10024871 3300025921 Bacteria 4970
273 Ga0207652_10079818 3300025921 Bacteria 2859
274 Ga0207652_10098688 3300025921 Bacteria 2576
275 Ga0207652_10531114 3300025921 Bacteria 1058
276 Ga0207652_10570437 3300025921 Bacteria 1016
277 Ga0207652_11248378 3300025921 Unclassified 645
278 Ga0207694_10008012 3300025924 Bacteria 7989
279 Ga0207694_10036055 3300025924 Bacteria 3794
280 Ga0207694_10164859 3300025924 Bacteria 1791
281 Ga0207694_10179908 3300025924 Bacteria 1714
282 Ga0207694_10342609 3300025924 Bacteria 1236
283 Ga0207659_10665544 3300025926 Bacteria 890
284 Ga0207700_10959053 3300025928 Bacteria 765
285 Ga0207664_10064472 3300025929 Bacteria 2930
286 Ga0207664_10090469 3300025929 Bacteria 2508
287 Ga0207664_10098711 3300025929 Bacteria 2409
288 Ga0207664_10688649 3300025929 Unclassified 919
289 Ga0207664_10711876 3300025929 Unclassified 903
290 Ga0207644_10055773 3300025931 Bacteria 2849
291 Ga0207644_10065985 3300025931 Bacteria 2633
292 Ga0207644_10341120 3300025931 Bacteria 1215
293 Ga0207690_10003155 3300025932 Bacteria 9899
294 Ga0207690_10010133 3300025932 Bacteria 5598
295 Ga0207690_10012998 3300025932 Bacteria 4992
296 Ga0207690_10022672 3300025932 Bacteria 3908
297 Ga0207690_10158742 3300025932 Bacteria 1684
298 Ga0207690_10259603 3300025932 Bacteria 1345
299 Ga0207690_10384944 3300025932 Bacteria 1115
300 Ga0207706_10004614 3300025933 Bacteria 12925
301 Ga0207706_10019891 3300025933 Bacteria 6035
302 Ga0207706_10030885 3300025933 Bacteria 4777
303 Ga0207706_10281361 3300025933 Bacteria 1451
304 Ga0207706_10357474 3300025933 Bacteria 1269
305 Ga0207706_10424636 3300025933 Bacteria 1151
306 Ga0207669_10109645 3300025937 Bacteria 1846
307 Ga0207691_10027333 3300025940 Bacteria 5349
308 Ga0207689_10047296 3300025942 Bacteria 3553
309 Ga0207661_10053891 3300025944 Bacteria 3220
310 Ga0207661_10073034 3300025944 Bacteria 2808
311 Ga0207661_10077647 3300025944 Bacteria 2731
312 Ga0207661_10502019 3300025944 Unclassified 1108
313 Ga0207661_11674625 3300025944 Unclassified 581
314 Ga0207679_10071943 3300025945 Bacteria 2610
315 Ga0207679_10158922 3300025945 Bacteria 1848
316 Ga0207679_10174849 3300025945 Bacteria 1771
317 Ga0207679_10199800 3300025945 Bacteria 1669
318 Ga0207679_10485468 3300025945 Bacteria 1100
319 Ga0207667_10025694 3300025949 Bacteria 6443
320 Ga0207667_10103495 3300025949 Bacteria 2936
321 Ga0207667_10184175 3300025949 Bacteria 2144
322 Ga0207667_10405897 3300025949 Bacteria 1387
323 Ga0207667_10424636 3300025949 Bacteria 1352
324 Ga0207667_10534197 3300025949 Bacteria 1187
325 Ga0207667_10795651 3300025949 Bacteria 943
326 Ga0207667_10951744 3300025949 Bacteria 848
327 Ga0207651_10006978 3300025960 Bacteria 5979
328 Ga0207640_10008246 3300025981 Bacteria 5778
329 Ga0207640_10015539 3300025981 Bacteria 4409
330 Ga0207640_10035600 3300025981 Bacteria 3117
331 Ga0207640_10056157 3300025981 Bacteria 2582
332 Ga0207640_10099527 3300025981 Bacteria 2035
333 Ga0207640_10464429 3300025981 Bacteria 1046
334 Ga0207658_10507690 3300025986 Unclassified 1075
335 Ga0207639_10000136 3300026041 Bacteria 54387
336 Ga0207639_10019066 3300026041 Bacteria 4885
337 Ga0207639_10044228 3300026041 Bacteria 3348
338 Ga0207639_10059698 3300026041 Bacteria 2939
339 Ga0207639_10416807 3300026041 Bacteria 1213
340 Ga0207639_10920055 3300026041 Bacteria 818
341 Ga0207678_10005448 3300026067 Bacteria 11386
342 Ga0207678_10008116 3300026067 Bacteria 9256
343 Ga0207678_10069475 3300026067 Bacteria 3020
344 Ga0207678_10082049 3300026067 Bacteria 2759
345 Ga0207678_10094186 3300026067 Bacteria 2559
346 Ga0207678_10102116 3300026067 Bacteria 2448
347 Ga0207702_10014122 3300026078 Bacteria 6632
348 Ga0207702_10116948 3300026078 Bacteria 2380
349 Ga0207702_10156476 3300026078 Bacteria 2078
350 Ga0207702_10168240 3300026078 Bacteria 2007
351 Ga0207702_10319501 3300026078 Bacteria 1478
352 Ga0207702_10514279 3300026078 Bacteria 1168
353 Ga0207702_10671234 3300026078 Bacteria 1020
354 Ga0207648_10001590 3300026089 Bacteria 24892
355 Ga0207676_10579240 3300026095 Bacteria 1076
356 Ga0207674_10001045 3300026116 Bacteria 36002
357 Ga0207674_10003719 3300026116 Bacteria 18629
358 Ga0207674_10004817 3300026116 Bacteria 16165
359 Ga0207674_10007483 3300026116 Bacteria 12729
360 Ga0207674_10012221 3300026116 Bacteria 9604
361 Ga0207674_10364657 3300026116 Bacteria 1396
362 Ga0207675_100232711 3300026118 Bacteria 1778
363 Ga0207683_10015108 3300026121 Bacteria 6570
364 Ga0207698_10001262 3300026142 Bacteria 14777
365 Ga0207698_10002123 3300026142 Bacteria 11689
366 Ga0207698_10002489 3300026142 Bacteria 10925
367 Ga0207698_10009041 3300026142 Bacteria 6327
368 Ga0207698_10023166 3300026142 Bacteria 4333
369 Ga0207698_10067204 3300026142 Bacteria 2826
370 Ga0207698_10258157 3300026142 Bacteria 1599
371 Ga0207698_10496120 3300026142 Bacteria 1187
372 Ga0207698_10707743 3300026142 Bacteria 1003
373 Ga0307416_100002551 3300032002 Bacteria 10499
374 Ga0307416_100101119 3300032002 Bacteria 2510
375 Ga0307416_100562682 3300032002 Bacteria 1215
376 Ga0307415_100011779 3300032126 Bacteria 5023
377 Ga0373930_0023557 3300034816 Bacteria 1225
378 Ga0373943_0005760 3300035170 Bacteria 5563
379 Ga0373946_0029838 3300035171 Bacteria 2174
380 Ga0373942_0161744 3300035207 Bacteria 724
381 Ga0373937_0557697 3300036401 Bacteria 1088
382 Ga0373925_0637057 3300037068 Unclassified 878
383 Ga0395899_0000211 3300037312 Bacteria 85166
384 Ga0395899_0002851 3300037312 Bacteria 13919
385 Ga0395899_0031334 3300037312 Bacteria 3996
386 Ga0395899_0036093 3300037312 Bacteria 3710
387 Ga0395899_0056703 3300037312 Bacteria 2895
388 Ga0395899_0113311 3300037312 Bacteria 1948
389 Ga0395899_0115054 3300037312 Bacteria 1931
390 Ga0395899_0122546 3300037312 Bacteria 1861
391 Ga0395899_0126615 3300037312 Bacteria 1826
392 Ga0395899_0132750 3300037312 Bacteria 1777
393 Ga0395899_0194557 3300037312 Bacteria 1417
394 Ga0395899_0228495 3300037312 Bacteria 1286
395 Ga0395900_0003001 3300037418 Bacteria 18354
396 Ga0395900_0013554 3300037418 Bacteria 8326
397 Ga0395900_0035451 3300037418 Bacteria 5139
398 Ga0395900_0043235 3300037418 Bacteria 4643
399 Ga0395900_0049466 3300037418 Bacteria 4331
400 Ga0395900_0053683 3300037418 Bacteria 4148
401 Ga0395900_0068633 3300037418 Bacteria 3643
402 Ga0395900_0078179 3300037418 Bacteria 3399
403 Ga0395900_0143007 3300037418 Bacteria 2448
404 Ga0395900_0158679 3300037418 Bacteria 2308
405 Ga0395900_0212593 3300037418 Bacteria 1952
406 Ga0395900_0252362 3300037418 Bacteria 1765
407 Ga0395900_0262890 3300037418 Bacteria 1722
408 Ga0395900_0373852 3300037418 Bacteria 1394
409 Ga0395900_0535577 3300037418 Bacteria 1117
410 Ga0395900_0627130 3300037418 Bacteria 1013
411 Ga0395900_0634784 3300037418 Unclassified 1006
412 Ga0395900_0780966 3300037418 Bacteria 884
413 Ga0395900_1007141 3300037418 Unclassified 753
414 Ga0395898_0000087 3300037466 Bacteria 239211
415 Ga0395898_0015270 3300037466 Bacteria 7878
416 Ga0395898_0021682 3300037466 Bacteria 6511
417 Ga0395898_0036324 3300037466 Bacteria 4892
418 Ga0395898_0037370 3300037466 Bacteria 4817
419 Ga0395898_0046357 3300037466 Bacteria 4270
420 Ga0395898_0062542 3300037466 Bacteria 3614
421 Ga0395898_0073900 3300037466 Bacteria 3294
422 Ga0395898_0103659 3300037466 Bacteria 2729
423 Ga0395898_0262905 3300037466 Bacteria 1646
424 Ga0395898_0270884 3300037466 Bacteria 1619
425 Ga0395898_0372727 3300037466 Unclassified 1361
426 Ga0395905_0000005 3300037471 Bacteria 557808
427 Ga0395905_0003658 3300037471 Bacteria 16310
428 Ga0395905_0005030 3300037471 Bacteria 13619
429 Ga0395905_0020385 3300037471 Bacteria 6281
430 Ga0395905_0021790 3300037471 Bacteria 6060
431 Ga0395905_0049474 3300037471 Bacteria 3939
432 Ga0395905_0051004 3300037471 Bacteria 3875
433 Ga0395905_0075366 3300037471 Bacteria 3162
434 Ga0395905_0078210 3300037471 Bacteria 3099
435 Ga0395905_0090374 3300037471 Bacteria 2870
436 Ga0395905_0163057 3300037471 Bacteria 2095
437 Ga0395905_0170025 3300037471 Bacteria 2047
438 Ga0395905_0293211 3300037471 Bacteria 1513
439 Ga0395905_0295925 3300037471 Bacteria 1505
440 Ga0395905_0363213 3300037471 Bacteria 1340
441 Ga0395905_0607621 3300037471 Bacteria 995
442 Ga0395905_1054208 3300037471 Bacteria 716
443 Ga0395901_0001643 3300038443 Bacteria 23126
444 Ga0395901_0015808 3300038443 Bacteria 7690
445 Ga0395901_0025412 3300038443 Bacteria 6079
446 Ga0395901_0030902 3300038443 Bacteria 5519
447 Ga0395901_0034792 3300038443 Bacteria 5203
448 Ga0395901_0108276 3300038443 Bacteria 2917
449 Ga0395901_0115686 3300038443 Bacteria 2817
450 Ga0395901_0121558 3300038443 Bacteria 2744
451 Ga0395901_0226004 3300038443 Bacteria 1955
452 Ga0395901_0332192 3300038443 Bacteria 1571
453 Ga0395901_0791264 3300038443 Bacteria 938
454 Ga0395901_0993255 3300038443 Unclassified 816
455 Ga0395901_1197882 3300038443 Bacteria 725
456 Ga0395901_1541061 3300038443 Bacteria 619
457 Ga0436365_0782179 3300039437 Bacteria 37690
458 Ga0436363_0609573 3300039450 Bacteria 1646
459 Ga0439448_0005624 3300042005 Bacteria 3574
460 Ga0466969_0085482 3300044656 Bacteria 1500
461 Ga0466972_0063007 3300044658 Bacteria 1776
462 Ga0466965_0159345 3300044683 Bacteria 1183
463 Ga0466966_0099585 3300044684 Bacteria 1798
464 Ga0466961_0007771 3300044693 Bacteria 6826
465 Ga0466961_0053526 3300044693 Bacteria 2575
466 Ga0466961_0177174 3300044693 Bacteria 1324
467 Ga0466963_0009505 3300044694 Bacteria 5855
468 Ga0466963_0010381 3300044694 Bacteria 5637
469 Ga0466963_0023424 3300044694 Bacteria 3922
470 Ga0466963_0069732 3300044694 Bacteria 2363
471 Ga0466963_0101016 3300044694 Bacteria 1974
472 Ga0466963_0125463 3300044694 Bacteria 1769
473 Ga0466963_0161724 3300044694 Bacteria 1558
474 Ga0466963_0217497 3300044694 Bacteria 1338
475 Ga0466963_0247663 3300044694 Bacteria 1250
476 Ga0466963_0344353 3300044694 Unclassified 1049
477 Ga0466963_0357371 3300044694 Bacteria 1029
478 Ga0466963_0385813 3300044694 Unclassified 987
479 Ga0466963_0537813 3300044694 Bacteria 825
480 Ga0466964_0005303 3300044706 Bacteria 4784
481 Ga0466971_0333332 3300044719 Unclassified 732
482 Ga0466968_0017286 3300044735 Bacteria 2881
483 Ga0466970_0102190 3300044765 Bacteria 1561
484 Ga0466957_0000249 3300044842 Bacteria 25796
485 Ga0466957_0008287 3300044842 Bacteria 5909
486 Ga0466957_0075728 3300044842 Bacteria 2088
487 Ga0466957_0175917 3300044842 Bacteria 1396
488 Ga0466957_0347017 3300044842 Bacteria 1006
489 Ga0466957_0393021 3300044842 Bacteria 947
490 Ga0466960_0041649 3300044901 Bacteria 2177
491 Ga0466959_0039002 3300045049 Bacteria 3510
492 Ga0466959_0088597 3300045049 Bacteria 2224
493 Ga0466958_0038384 3300045836 Bacteria 2873
494 Ga0466958_0092171 3300045836 Bacteria 1876
495 Ga0466958_0111738 3300045836 Bacteria 1706
496 Ga0466958_0239008 3300045836 Unclassified 1160
497 Ga0466958_0275372 3300045836 Bacteria 1078
498 Ga0466967_0050056 3300045976 Bacteria 3657
499 Ga0466967_0055135 3300045976 Bacteria 3501
500 Ga0466967_0057330 3300045976 Bacteria 3438
501 Ga0466967_0070856 3300045976 Bacteria 3119
502 Ga0466967_0075599 3300045976 Bacteria 3027
503 Ga0466967_0080071 3300045976 Bacteria 2947
504 Ga0466967_0095685 3300045976 Bacteria 2707
505 Ga0466967_0095695 3300045976 Bacteria 2707
506 Ga0466967_0114573 3300045976 Bacteria 2482
507 Ga0466967_0126159 3300045976 Bacteria 2371
508 Ga0466967_0159554 3300045976 Bacteria 2115
509 Ga0466967_0221250 3300045976 Bacteria 1799
510 Ga0466967_0244966 3300045976 Bacteria 1710
511 Ga0466967_0500568 3300045976 Bacteria 1192
512 Ga0466967_0532007 3300045976 Bacteria 1156
513 Ga0466967_0604149 3300045976 Bacteria 1083
514 Ga0466967_0695465 3300045976 Bacteria 1007
515 Ga0466967_0769114 3300045976 Unclassified 955
516 Ga0496101_0350032 3300048904 Bacteria 1161
517 Ga0496102_0060702 3300048905 Bacteria 3459
518 Ga0496103_0339844 3300048906 Bacteria 965
519 Ga0496104_0507453 3300048907 Bacteria 1117
520 Ga0496106_0409394 3300048909 Bacteria 1090
521 Ga0496107_0158643 3300048910 Bacteria 1676
522 Ga0496108_0506223 3300048911 Bacteria 1054
523 Ga0496109_0164491 3300048912 Bacteria 2079
524 Ga0496110_0025949 3300048913 Bacteria 5009
525 Ga0496110_0133012 3300048913 Bacteria 2247
526 Ga0496111_0596859 3300048914 Bacteria 808
527 Ga0496112_0027160 3300048915 Bacteria 5518
528 Ga0496112_0160391 3300048915 Bacteria 2215
529 Ga0496113_0219866 3300048916 Bacteria 1513
530 Ga0501067_0046433 3300049583 Bacteria 2411
531 Ga0501067_0440687 3300049583 Bacteria 727
532 Ga0501069_0041107 3300049585 Bacteria 2555
533 Ga0466962_0091537 3300061719 Bacteria 1457
534 Ga0466962_0345920 3300061719 Bacteria 740

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_1541061 Ga0395901_1541061_39_494 151
2 3300013102 Ga0157371_10200501 Ga0157371_102005012 153
3 3300005344 Ga0070661_100050888 Ga0070661_1000508883 154
4 3300025920 Ga0207649_10403587 Ga0207649_104035872 154
5 3300044842 Ga0466957_0393021 Ga0466957_0393021_240_707 155
6 3300005336 Ga0070680_100012806 Ga0070680_1000128066 158
7 3300005458 Ga0070681_10063915 Ga0070681_100639153 158
8 3300005530 Ga0070679_100039518 Ga0070679_1000395185 158
9 3300005539 Ga0068853_100128015 Ga0068853_1001280152 158
10 3300005614 Ga0068856_100242563 Ga0068856_1002425632 158
11 3300005616 Ga0068852_100304991 Ga0068852_1003049912 158
12 3300013307 Ga0157372_10085950 Ga0157372_100859501 158
13 3300020070 Ga0206356_10588867 Ga0206356_105888672 158
14 3300025912 Ga0207707_10086763 Ga0207707_100867632 158
15 3300025917 Ga0207660_10005431 Ga0207660_100054316 158
16 3300025949 Ga0207667_10534197 Ga0207667_105341972 158
17 3300026142 Ga0207698_10001262 Ga0207698_1000126211 158
18 3300026142 Ga0207698_10258157 Ga0207698_102581572 164
19 3300035207 Ga0373942_0161744 Ga0373942_0161744_90_587 165
20 3300044842 Ga0466957_0347017 Ga0466957_0347017_226_780 165
21 3300005435 Ga0070714_100078706 Ga0070714_1000787063 166
22 3300025929 Ga0207664_10098711 Ga0207664_100987113 166
23 3300037418 Ga0395900_0780966 Ga0395900_0780966_13_567 166
24 3300037312 Ga0395899_0036093 Ga0395899_0036093_3136_3642 167
25 3300037418 Ga0395900_0049466 Ga0395900_0049466_339_845 167
26 3300037466 Ga0395898_0046357 Ga0395898_0046357_197_703 167
27 3300037471 Ga0395905_0049474 Ga0395905_0049474_1931_2437 167
28 3300038443 Ga0395901_0025412 Ga0395901_0025412_2960_3466 167
29 3300045976 Ga0466967_0050056 Ga0466967_0050056_741_1262 167
30 3300045976 Ga0466967_0055135 Ga0466967_0055135_2222_2752 167
31 3300045976 Ga0466967_0095695 Ga0466967_0095695_606_1109 167
32 3300009093 Ga0105240_10120067 Ga0105240_101200673 168
33 3300013100 Ga0157373_10043400 Ga0157373_100434003 168
34 3300013104 Ga0157370_10016192 Ga0157370_100161928 168
35 3300013105 Ga0157369_10141301 Ga0157369_101413012 168
36 3300037466 Ga0395898_0073900 Ga0395898_0073900_2207_2713 168
37 3300045976 Ga0466967_0114573 Ga0466967_0114573_627_1157 170
38 3300013105 Ga0157369_11266898 Ga0157369_112668981 171
39 3300013307 Ga0157372_10240020 Ga0157372_102400202 171
40 3300037418 Ga0395900_0212593 Ga0395900_0212593_1177_1692 171
41 3300044656 Ga0466969_0085482 Ga0466969_0085482_109_624 171
42 3300044684 Ga0466966_0099585 Ga0466966_0099585_638_1153 171
43 3300044693 Ga0466961_0177174 Ga0466961_0177174_510_1025 171
44 3300045049 Ga0466959_0088597 Ga0466959_0088597_1319_1834 171
45 3300048904 Ga0496101_0350032 Ga0496101_0350032_108_626 172
46 3300013100 Ga0157373_10430542 Ga0157373_104305422 173
47 3300037312 Ga0395899_0132750 Ga0395899_0132750_1101_1622 173
48 3300037418 Ga0395900_0035451 Ga0395900_0035451_2509_3030 173
49 3300037466 Ga0395898_0036324 Ga0395898_0036324_2987_3508 173
50 3300037471 Ga0395905_0005030 Ga0395905_0005030_12326_12847 173
51 3300038443 Ga0395901_0115686 Ga0395901_0115686_1940_2461 173
52 3300038443 Ga0395901_0121558 Ga0395901_0121558_1683_2204 173
53 3300034816 Ga0373930_0023557 Ga0373930_0023557_323_847 174
54 3300025924 Ga0207694_10179908 Ga0207694_101799082 176
55 3300037471 Ga0395905_0163057 Ga0395905_0163057_473_1027 179
56 3300037471 Ga0395905_0075366 Ga0395905_0075366_1350_1892 180
57 3300005435 Ga0070714_100118088 Ga0070714_1001180883 182
58 3300005436 Ga0070713_100381652 Ga0070713_1003816522 182
59 3300044694 Ga0466963_0385813 Ga0466963_0385813_255_803 182
60 3300045836 Ga0466958_0038384 Ga0466958_0038384_167_715 182
61 3300045976 Ga0466967_0159554 Ga0466967_0159554_1400_1948 182
62 3300045976 Ga0466967_0532007 Ga0466967_0532007_383_931 182
63 3300025949 Ga0207667_10424636 Ga0207667_104246362 183
64 3300037312 Ga0395899_0031334 Ga0395899_0031334_822_1373 183
65 3300037312 Ga0395899_0113311 Ga0395899_0113311_46_597 183
66 3300037418 Ga0395900_0043235 Ga0395900_0043235_3540_4091 183
67 3300037418 Ga0395900_0535577 Ga0395900_0535577_99_650 183
68 3300037466 Ga0395898_0037370 Ga0395898_0037370_3784_4335 183
69 3300037471 Ga0395905_0090374 Ga0395905_0090374_1679_2230 183
70 3300037471 Ga0395905_0293211 Ga0395905_0293211_546_1097 183
71 3300038443 Ga0395901_0030902 Ga0395901_0030902_565_1116 183
72 3300045976 Ga0466967_0080071 Ga0466967_0080071_283_834 183
73 3300049585 Ga0501069_0041107 Ga0501069_0041107_265_816 183
74 3300002077 JGI24744J21845_10001590 JGI24744J21845_100015902 184
75 3300003320 rootH2_10157166 rootH2_101571662 184
76 3300003322 rootL2_10228040 rootL2_102280402 184
77 3300005327 Ga0070658_10003485 Ga0070658_1000348512 184
78 3300005327 Ga0070658_10072842 Ga0070658_100728422 184
79 3300005327 Ga0070658_10076380 Ga0070658_100763802 184
80 3300005327 Ga0070658_10080517 Ga0070658_100805172 184
81 3300005327 Ga0070658_10123825 Ga0070658_101238252 184
82 3300005327 Ga0070658_10886730 Ga0070658_108867301 184
83 3300005327 Ga0070658_11200425 Ga0070658_112004251 184
84 3300005329 Ga0070683_100004273 Ga0070683_1000042733 184
85 3300005329 Ga0070683_100089116 Ga0070683_1000891162 184
86 3300005329 Ga0070683_100183661 Ga0070683_1001836612 184
87 3300005329 Ga0070683_100249701 Ga0070683_1002497012 184
88 3300005329 Ga0070683_100296201 Ga0070683_1002962012 184
89 3300005333 Ga0070677_10040075 Ga0070677_100400752 184
90 3300005334 Ga0068869_100052082 Ga0068869_1000520821 184
91 3300005336 Ga0070680_100000726 Ga0070680_10000072620 184
92 3300005336 Ga0070680_100001419 Ga0070680_10000141912 184
93 3300005336 Ga0070680_100107520 Ga0070680_1001075203 184
94 3300005336 Ga0070680_100157614 Ga0070680_1001576142 184
95 3300005337 Ga0070682_100118859 Ga0070682_1001188592 184
96 3300005337 Ga0070682_100219766 Ga0070682_1002197662 184
97 3300005337 Ga0070682_100658190 Ga0070682_1006581902 184
98 3300005338 Ga0068868_100321937 Ga0068868_1003219372 184
99 3300005339 Ga0070660_100006487 Ga0070660_1000064878 184
100 3300005339 Ga0070660_100112907 Ga0070660_1001129073 184
101 3300005339 Ga0070660_100203791 Ga0070660_1002037912 184
102 3300005339 Ga0070660_100290937 Ga0070660_1002909372 184
103 3300005339 Ga0070660_100316890 Ga0070660_1003168901 184
104 3300005339 Ga0070660_100409154 Ga0070660_1004091541 184
105 3300005343 Ga0070687_100371741 Ga0070687_1003717411 184
106 3300005344 Ga0070661_100012056 Ga0070661_1000120564 184
107 3300005344 Ga0070661_100018468 Ga0070661_1000184683 184
108 3300005344 Ga0070661_100025508 Ga0070661_1000255082 184
109 3300005344 Ga0070661_100286399 Ga0070661_1002863992 184
110 3300005344 Ga0070661_100327558 Ga0070661_1003275581 184
111 3300005344 Ga0070661_100342542 Ga0070661_1003425421 184
112 3300005344 Ga0070661_100790901 Ga0070661_1007909011 184
113 3300005345 Ga0070692_10087674 Ga0070692_100876741 184
114 3300005345 Ga0070692_10128269 Ga0070692_101282692 184
115 3300005345 Ga0070692_10484796 Ga0070692_104847961 184
116 3300005355 Ga0070671_100027205 Ga0070671_1000272055 184
117 3300005355 Ga0070671_100393312 Ga0070671_1003933122 184
118 3300005356 Ga0070674_100012733 Ga0070674_1000127333 184
119 3300005364 Ga0070673_100085675 Ga0070673_1000856752 184
120 3300005364 Ga0070673_100496472 Ga0070673_1004964722 184
121 3300005366 Ga0070659_100023915 Ga0070659_1000239154 184
122 3300005366 Ga0070659_100040272 Ga0070659_1000402721 184
123 3300005366 Ga0070659_100053624 Ga0070659_1000536242 184
124 3300005366 Ga0070659_100123880 Ga0070659_1001238802 184
125 3300005435 Ga0070714_100004093 Ga0070714_1000040932 184
126 3300005435 Ga0070714_100609122 Ga0070714_1006091222 184
127 3300005435 Ga0070714_100609545 Ga0070714_1006095452 184
128 3300005455 Ga0070663_100147420 Ga0070663_1001474201 184
129 3300005455 Ga0070663_100157255 Ga0070663_1001572552 184
130 3300005455 Ga0070663_100856608 Ga0070663_1008566082 184
131 3300005456 Ga0070678_100281078 Ga0070678_1002810782 184
132 3300005457 Ga0070662_100031120 Ga0070662_1000311202 184
133 3300005457 Ga0070662_100037465 Ga0070662_1000374653 184
134 3300005457 Ga0070662_100296907 Ga0070662_1002969072 184
135 3300005457 Ga0070662_100490079 Ga0070662_1004900792 184
136 3300005458 Ga0070681_10029686 Ga0070681_100296863 184
137 3300005458 Ga0070681_10233303 Ga0070681_102333032 184
138 3300005459 Ga0068867_100028347 Ga0068867_1000283473 184
139 3300005530 Ga0070679_100087961 Ga0070679_1000879612 184
140 3300005530 Ga0070679_100122030 Ga0070679_1001220302 184
141 3300005530 Ga0070679_101166072 Ga0070679_1011660721 184
142 3300005530 Ga0070679_101384756 Ga0070679_1013847561 184
143 3300005535 Ga0070684_100000841 Ga0070684_10000084111 184
144 3300005535 Ga0070684_100015169 Ga0070684_1000151697 184
145 3300005535 Ga0070684_100049222 Ga0070684_1000492222 184
146 3300005535 Ga0070684_100146723 Ga0070684_1001467232 184
147 3300005539 Ga0068853_100033347 Ga0068853_1000333473 184
148 3300005539 Ga0068853_100062843 Ga0068853_1000628433 184
149 3300005539 Ga0068853_100117557 Ga0068853_1001175572 184
150 3300005539 Ga0068853_100229322 Ga0068853_1002293221 184
151 3300005539 Ga0068853_100588838 Ga0068853_1005888382 184
152 3300005547 Ga0070693_100058350 Ga0070693_1000583502 184
153 3300005547 Ga0070693_100200070 Ga0070693_1002000702 184
154 3300005547 Ga0070693_100228817 Ga0070693_1002288171 184
155 3300005563 Ga0068855_100048349 Ga0068855_1000483492 184
156 3300005563 Ga0068855_100071433 Ga0068855_1000714334 184
157 3300005563 Ga0068855_100218164 Ga0068855_1002181642 184
158 3300005563 Ga0068855_100626353 Ga0068855_1006263532 184
159 3300005563 Ga0068855_101052916 Ga0068855_1010529162 184
160 3300005563 Ga0068855_101093513 Ga0068855_1010935132 184
161 3300005564 Ga0070664_100046267 Ga0070664_1000462672 184
162 3300005564 Ga0070664_100091474 Ga0070664_1000914742 184
163 3300005564 Ga0070664_100151360 Ga0070664_1001513603 184
164 3300005564 Ga0070664_100230841 Ga0070664_1002308412 184
165 3300005577 Ga0068857_100080922 Ga0068857_1000809223 184
166 3300005577 Ga0068857_100151480 Ga0068857_1001514803 184
167 3300005577 Ga0068857_100300528 Ga0068857_1003005282 184
168 3300005577 Ga0068857_100407965 Ga0068857_1004079652 184
169 3300005577 Ga0068857_100780503 Ga0068857_1007805032 184
170 3300005578 Ga0068854_100018367 Ga0068854_1000183672 184
171 3300005578 Ga0068854_100031872 Ga0068854_1000318722 184
172 3300005578 Ga0068854_100105633 Ga0068854_1001056332 184
173 3300005578 Ga0068854_100115975 Ga0068854_1001159752 184
174 3300005578 Ga0068854_100226563 Ga0068854_1002265632 184
175 3300005614 Ga0068856_100011171 Ga0068856_10001117110 184
176 3300005614 Ga0068856_100020003 Ga0068856_1000200034 184
177 3300005614 Ga0068856_100048132 Ga0068856_1000481323 184
178 3300005614 Ga0068856_100120445 Ga0068856_1001204452 184
179 3300005614 Ga0068856_100403429 Ga0068856_1004034292 184
180 3300005614 Ga0068856_100432438 Ga0068856_1004324382 184
181 3300005614 Ga0068856_100488113 Ga0068856_1004881132 184
182 3300005614 Ga0068856_100714845 Ga0068856_1007148451 184
183 3300005616 Ga0068852_100000947 Ga0068852_10000094712 184
184 3300005616 Ga0068852_100003378 Ga0068852_1000033783 184
185 3300005616 Ga0068852_100014143 Ga0068852_1000141433 184
186 3300005616 Ga0068852_100015776 Ga0068852_1000157764 184
187 3300005616 Ga0068852_100063305 Ga0068852_1000633052 184
188 3300005616 Ga0068852_100080246 Ga0068852_1000802462 184
189 3300005616 Ga0068852_100099075 Ga0068852_1000990753 184
190 3300005616 Ga0068852_100413065 Ga0068852_1004130652 184
191 3300005616 Ga0068852_101180098 Ga0068852_1011800981 184
192 3300005718 Ga0068866_10011888 Ga0068866_100118883 184
193 3300005834 Ga0068851_10053972 Ga0068851_100539723 184
194 3300005834 Ga0068851_10079724 Ga0068851_100797242 184
195 3300005834 Ga0068851_10384762 Ga0068851_103847622 184
196 3300006358 Ga0068871_100948976 Ga0068871_1009489761 184
197 3300009093 Ga0105240_10016062 Ga0105240_100160628 184
198 3300009093 Ga0105240_10601596 Ga0105240_106015962 184
199 3300009098 Ga0105245_10067776 Ga0105245_100677762 184
200 3300009174 Ga0105241_10053037 Ga0105241_100530372 184
201 3300009174 Ga0105241_10258883 Ga0105241_102588832 184
202 3300009176 Ga0105242_10064691 Ga0105242_100646912 184
203 3300009177 Ga0105248_10027779 Ga0105248_100277792 184
204 3300009177 Ga0105248_10177259 Ga0105248_101772592 184
205 3300009545 Ga0105237_10057101 Ga0105237_100571013 184
206 3300009545 Ga0105237_10632635 Ga0105237_106326352 184
207 3300009551 Ga0105238_10006524 Ga0105238_100065246 184
208 3300009551 Ga0105238_10045184 Ga0105238_100451845 184
209 3300009551 Ga0105238_10403021 Ga0105238_104030212 184
210 3300010375 Ga0105239_10012441 Ga0105239_100124416 184
211 3300013100 Ga0157373_10018163 Ga0157373_100181635 184
212 3300013100 Ga0157373_10078780 Ga0157373_100787803 184
213 3300013100 Ga0157373_10115236 Ga0157373_101152362 184
214 3300013100 Ga0157373_10127943 Ga0157373_101279432 184
215 3300013100 Ga0157373_10194970 Ga0157373_101949702 184
216 3300013102 Ga0157371_10010300 Ga0157371_100103003 184
217 3300013102 Ga0157371_10047393 Ga0157371_100473933 184
218 3300013102 Ga0157371_10076610 Ga0157371_100766102 184
219 3300013102 Ga0157371_10114117 Ga0157371_101141172 184
220 3300013102 Ga0157371_10118026 Ga0157371_101180262 184
221 3300013102 Ga0157371_10126885 Ga0157371_101268852 184
222 3300013102 Ga0157371_10154691 Ga0157371_101546912 184
223 3300013102 Ga0157371_10200425 Ga0157371_102004252 184
224 3300013104 Ga0157370_10044351 Ga0157370_100443513 184
225 3300013104 Ga0157370_10052326 Ga0157370_100523262 184
226 3300013104 Ga0157370_10161622 Ga0157370_101616222 184
227 3300013104 Ga0157370_10211936 Ga0157370_102119362 184
228 3300013104 Ga0157370_10289815 Ga0157370_102898152 184
229 3300013104 Ga0157370_10439093 Ga0157370_104390932 184
230 3300013105 Ga0157369_10013940 Ga0157369_100139407 184
231 3300013105 Ga0157369_10043310 Ga0157369_100433103 184
232 3300013105 Ga0157369_10064383 Ga0157369_100643832 184
233 3300013105 Ga0157369_10097870 Ga0157369_100978702 184
234 3300013105 Ga0157369_10127969 Ga0157369_101279693 184
235 3300013105 Ga0157369_10147588 Ga0157369_101475882 184
236 3300013105 Ga0157369_10153339 Ga0157369_101533392 184
237 3300013105 Ga0157369_10258490 Ga0157369_102584902 184
238 3300013105 Ga0157369_10268386 Ga0157369_102683863 184
239 3300013105 Ga0157369_10299663 Ga0157369_102996632 184
240 3300013105 Ga0157369_10859414 Ga0157369_108594142 184
241 3300013105 Ga0157369_11022349 Ga0157369_110223492 184
242 3300013307 Ga0157372_10025303 Ga0157372_100253033 184
243 3300013307 Ga0157372_10197101 Ga0157372_101971012 184
244 3300013307 Ga0157372_10297589 Ga0157372_102975892 184
245 3300013307 Ga0157372_10439938 Ga0157372_104399382 184
246 3300013307 Ga0157372_10635706 Ga0157372_106357062 184
247 3300014325 Ga0163163_10704207 Ga0163163_107042071 184
248 3300020082 Ga0206353_12048510 Ga0206353_120485102 184
249 3300021384 Ga0213876_10054977 Ga0213876_100549773 184
250 3300025321 Ga0207656_10074323 Ga0207656_100743232 184
251 3300025321 Ga0207656_10288037 Ga0207656_102880372 184
252 3300025893 Ga0207682_10020876 Ga0207682_100208762 184
253 3300025904 Ga0207647_10008447 Ga0207647_100084474 184
254 3300025904 Ga0207647_10012170 Ga0207647_100121705 184
255 3300025904 Ga0207647_10243090 Ga0207647_102430902 184
256 3300025907 Ga0207645_10127975 Ga0207645_101279752 184
257 3300025909 Ga0207705_10011975 Ga0207705_100119755 184
258 3300025909 Ga0207705_10017597 Ga0207705_100175973 184
259 3300025909 Ga0207705_10020381 Ga0207705_100203816 184
260 3300025909 Ga0207705_10026518 Ga0207705_100265183 184
261 3300025909 Ga0207705_10064432 Ga0207705_100644322 184
262 3300025909 Ga0207705_10252035 Ga0207705_102520352 184
263 3300025909 Ga0207705_10676183 Ga0207705_106761831 184
264 3300025911 Ga0207654_10218097 Ga0207654_102180972 184
265 3300025912 Ga0207707_10041920 Ga0207707_100419204 184
266 3300025912 Ga0207707_10093264 Ga0207707_100932643 184
267 3300025912 Ga0207707_10128778 Ga0207707_101287782 184
268 3300025912 Ga0207707_10522782 Ga0207707_105227822 184
269 3300025914 Ga0207671_10148791 Ga0207671_101487912 184
270 3300025917 Ga0207660_10001632 Ga0207660_1000163216 184
271 3300025917 Ga0207660_10062709 Ga0207660_100627093 184
272 3300025917 Ga0207660_10089680 Ga0207660_100896802 184
273 3300025917 Ga0207660_10234897 Ga0207660_102348972 184
274 3300025917 Ga0207660_10663805 Ga0207660_106638052 184
275 3300025918 Ga0207662_10126083 Ga0207662_101260831 184
276 3300025919 Ga0207657_10003139 Ga0207657_1000313916 184
277 3300025919 Ga0207657_10008723 Ga0207657_1000872310 184
278 3300025919 Ga0207657_10013074 Ga0207657_100130742 184
279 3300025919 Ga0207657_10030142 Ga0207657_100301423 184
280 3300025919 Ga0207657_10030645 Ga0207657_100306455 184
281 3300025919 Ga0207657_10051861 Ga0207657_100518612 184
282 3300025919 Ga0207657_10090364 Ga0207657_100903642 184
283 3300025919 Ga0207657_10097996 Ga0207657_100979962 184
284 3300025919 Ga0207657_10167273 Ga0207657_101672732 184
285 3300025919 Ga0207657_10172758 Ga0207657_101727582 184
286 3300025919 Ga0207657_10195776 Ga0207657_101957762 184
287 3300025919 Ga0207657_10201307 Ga0207657_102013072 184
288 3300025920 Ga0207649_10040004 Ga0207649_100400043 184
289 3300025920 Ga0207649_10044973 Ga0207649_100449732 184
290 3300025920 Ga0207649_10077217 Ga0207649_100772172 184
291 3300025920 Ga0207649_10956200 Ga0207649_109562002 184
292 3300025921 Ga0207652_10019846 Ga0207652_100198463 184
293 3300025921 Ga0207652_10024871 Ga0207652_100248714 184
294 3300025921 Ga0207652_10079818 Ga0207652_100798183 184
295 3300025921 Ga0207652_10098688 Ga0207652_100986882 184
296 3300025921 Ga0207652_10531114 Ga0207652_105311142 184
297 3300025921 Ga0207652_10570437 Ga0207652_105704372 184
298 3300025921 Ga0207652_11248378 Ga0207652_112483781 184
299 3300025924 Ga0207694_10008012 Ga0207694_100080122 184
300 3300025924 Ga0207694_10036055 Ga0207694_100360552 184
301 3300025924 Ga0207694_10342609 Ga0207694_103426092 184
302 3300025926 Ga0207659_10665544 Ga0207659_106655442 184
303 3300025928 Ga0207700_10959053 Ga0207700_109590532 184
304 3300025929 Ga0207664_10064472 Ga0207664_100644722 184
305 3300025929 Ga0207664_10090469 Ga0207664_100904692 184
306 3300025929 Ga0207664_10688649 Ga0207664_106886492 184
307 3300025929 Ga0207664_10711876 Ga0207664_107118762 184
308 3300025931 Ga0207644_10055773 Ga0207644_100557732 184
309 3300025931 Ga0207644_10065985 Ga0207644_100659853 184
310 3300025931 Ga0207644_10341120 Ga0207644_103411202 184
311 3300025932 Ga0207690_10003155 Ga0207690_100031552 184
312 3300025932 Ga0207690_10010133 Ga0207690_100101333 184
313 3300025932 Ga0207690_10022672 Ga0207690_100226722 184
314 3300025932 Ga0207690_10158742 Ga0207690_101587422 184
315 3300025932 Ga0207690_10259603 Ga0207690_102596032 184
316 3300025932 Ga0207690_10384944 Ga0207690_103849442 184
317 3300025933 Ga0207706_10004614 Ga0207706_1000461413 184
318 3300025933 Ga0207706_10019891 Ga0207706_100198913 184
319 3300025933 Ga0207706_10030885 Ga0207706_100308853 184
320 3300025933 Ga0207706_10281361 Ga0207706_102813612 184
321 3300025933 Ga0207706_10357474 Ga0207706_103574742 184
322 3300025933 Ga0207706_10424636 Ga0207706_104246362 184
323 3300025937 Ga0207669_10109645 Ga0207669_101096451 184
324 3300025940 Ga0207691_10027333 Ga0207691_100273333 184
325 3300025942 Ga0207689_10047296 Ga0207689_100472963 184
326 3300025944 Ga0207661_10053891 Ga0207661_100538912 184
327 3300025944 Ga0207661_10073034 Ga0207661_100730342 184
328 3300025944 Ga0207661_10077647 Ga0207661_100776473 184
329 3300025944 Ga0207661_11674625 Ga0207661_116746251 184
330 3300025945 Ga0207679_10071943 Ga0207679_100719433 184
331 3300025945 Ga0207679_10158922 Ga0207679_101589221 184
332 3300025945 Ga0207679_10174849 Ga0207679_101748492 184
333 3300025945 Ga0207679_10199800 Ga0207679_101998002 184
334 3300025945 Ga0207679_10485468 Ga0207679_104854682 184
335 3300025949 Ga0207667_10103495 Ga0207667_101034951 184
336 3300025949 Ga0207667_10184175 Ga0207667_101841753 184
337 3300025949 Ga0207667_10405897 Ga0207667_104058972 184
338 3300025949 Ga0207667_10795651 Ga0207667_107956512 184
339 3300025949 Ga0207667_10951744 Ga0207667_109517442 184
340 3300025960 Ga0207651_10006978 Ga0207651_100069786 184
341 3300025981 Ga0207640_10015539 Ga0207640_100155394 184
342 3300025981 Ga0207640_10035600 Ga0207640_100356002 184
343 3300025981 Ga0207640_10056157 Ga0207640_100561573 184
344 3300025981 Ga0207640_10099527 Ga0207640_100995272 184
345 3300025981 Ga0207640_10464429 Ga0207640_104644291 184
346 3300025986 Ga0207658_10507690 Ga0207658_105076902 184
347 3300026041 Ga0207639_10000136 Ga0207639_1000013640 184
348 3300026041 Ga0207639_10044228 Ga0207639_100442282 184
349 3300026041 Ga0207639_10059698 Ga0207639_100596982 184
350 3300026041 Ga0207639_10416807 Ga0207639_104168072 184
351 3300026041 Ga0207639_10920055 Ga0207639_109200552 184
352 3300026067 Ga0207678_10005448 Ga0207678_1000544812 184
353 3300026067 Ga0207678_10008116 Ga0207678_100081163 184
354 3300026067 Ga0207678_10069475 Ga0207678_100694753 184
355 3300026067 Ga0207678_10094186 Ga0207678_100941863 184
356 3300026067 Ga0207678_10102116 Ga0207678_101021163 184
357 3300026078 Ga0207702_10014122 Ga0207702_100141225 184
358 3300026078 Ga0207702_10116948 Ga0207702_101169482 184
359 3300026078 Ga0207702_10156476 Ga0207702_101564762 184
360 3300026078 Ga0207702_10168240 Ga0207702_101682402 184
361 3300026078 Ga0207702_10319501 Ga0207702_103195012 184
362 3300026078 Ga0207702_10514279 Ga0207702_105142792 184
363 3300026078 Ga0207702_10671234 Ga0207702_106712342 184
364 3300026089 Ga0207648_10001590 Ga0207648_1000159013 184
365 3300026095 Ga0207676_10579240 Ga0207676_105792402 184
366 3300026116 Ga0207674_10003719 Ga0207674_100037194 184
367 3300026116 Ga0207674_10004817 Ga0207674_1000481716 184
368 3300026116 Ga0207674_10007483 Ga0207674_100074838 184
369 3300026116 Ga0207674_10012221 Ga0207674_100122213 184
370 3300026116 Ga0207674_10364657 Ga0207674_103646572 184
371 3300026118 Ga0207675_100232711 Ga0207675_1002327112 184
372 3300026121 Ga0207683_10015108 Ga0207683_100151083 184
373 3300026142 Ga0207698_10002489 Ga0207698_100024896 184
374 3300026142 Ga0207698_10009041 Ga0207698_100090414 184
375 3300026142 Ga0207698_10023166 Ga0207698_100231662 184
376 3300026142 Ga0207698_10067204 Ga0207698_100672042 184
377 3300026142 Ga0207698_10496120 Ga0207698_104961202 184
378 3300026142 Ga0207698_10707743 Ga0207698_107077432 184
379 3300032002 Ga0307416_100002551 Ga0307416_1000025513 184
380 3300032002 Ga0307416_100101119 Ga0307416_1001011192 184
381 3300032002 Ga0307416_100562682 Ga0307416_1005626822 184
382 3300032126 Ga0307415_100011779 Ga0307415_1000117792 184
383 3300035170 Ga0373943_0005760 Ga0373943_0005760_627_1181 184
384 3300035171 Ga0373946_0029838 Ga0373946_0029838_103_657 184
385 3300036401 Ga0373937_0557697 Ga0373937_0557697_141_695 184
386 3300037068 Ga0373925_0637057 Ga0373925_0637057_115_669 184
387 3300037312 Ga0395899_0000211 Ga0395899_0000211_52891_53454 184
388 3300037312 Ga0395899_0002851 Ga0395899_0002851_1884_2438 184
389 3300037312 Ga0395899_0056703 Ga0395899_0056703_10_564 184
390 3300037312 Ga0395899_0115054 Ga0395899_0115054_647_1201 184
391 3300037312 Ga0395899_0122546 Ga0395899_0122546_1145_1699 184
392 3300037312 Ga0395899_0126615 Ga0395899_0126615_542_1096 184
393 3300037312 Ga0395899_0228495 Ga0395899_0228495_257_811 184
394 3300037418 Ga0395900_0003001 Ga0395900_0003001_1181_1744 184
395 3300037418 Ga0395900_0013554 Ga0395900_0013554_1042_1596 184
396 3300037418 Ga0395900_0053683 Ga0395900_0053683_3282_3836 184
397 3300037418 Ga0395900_0068633 Ga0395900_0068633_451_1005 184
398 3300037418 Ga0395900_0078179 Ga0395900_0078179_20_574 184
399 3300037418 Ga0395900_0143007 Ga0395900_0143007_1607_2161 184
400 3300037418 Ga0395900_0252362 Ga0395900_0252362_735_1289 184
401 3300037418 Ga0395900_0262890 Ga0395900_0262890_595_1149 184
402 3300037418 Ga0395900_0373852 Ga0395900_0373852_438_992 184
403 3300037418 Ga0395900_0627130 Ga0395900_0627130_343_897 184
404 3300037418 Ga0395900_0634784 Ga0395900_0634784_240_794 184
405 3300037418 Ga0395900_1007141 Ga0395900_1007141_131_685 184
406 3300037466 Ga0395898_0000087 Ga0395898_0000087_188816_189379 184
407 3300037466 Ga0395898_0015270 Ga0395898_0015270_351_905 184
408 3300037466 Ga0395898_0062542 Ga0395898_0062542_2460_3014 184
409 3300037466 Ga0395898_0103659 Ga0395898_0103659_740_1294 184
410 3300037466 Ga0395898_0262905 Ga0395898_0262905_360_914 184
411 3300037466 Ga0395898_0270884 Ga0395898_0270884_850_1404 184
412 3300037466 Ga0395898_0372727 Ga0395898_0372727_684_1238 184
413 3300037471 Ga0395905_0000005 Ga0395905_0000005_188816_189379 184
414 3300037471 Ga0395905_0003658 Ga0395905_0003658_67_621 184
415 3300037471 Ga0395905_0020385 Ga0395905_0020385_1742_2296 184
416 3300037471 Ga0395905_0021790 Ga0395905_0021790_1655_2209 184
417 3300037471 Ga0395905_0051004 Ga0395905_0051004_1787_2341 184
418 3300037471 Ga0395905_0078210 Ga0395905_0078210_668_1222 184
419 3300037471 Ga0395905_0170025 Ga0395905_0170025_1400_1954 184
420 3300037471 Ga0395905_0363213 Ga0395905_0363213_227_781 184
421 3300037471 Ga0395905_0607621 Ga0395905_0607621_346_900 184
422 3300037471 Ga0395905_1054208 Ga0395905_1054208_112_666 184
423 3300038443 Ga0395901_0001643 Ga0395901_0001643_5720_6283 184
424 3300038443 Ga0395901_0015808 Ga0395901_0015808_6096_6650 184
425 3300038443 Ga0395901_0034792 Ga0395901_0034792_4299_4853 184
426 3300038443 Ga0395901_0108276 Ga0395901_0108276_295_849 184
427 3300038443 Ga0395901_0226004 Ga0395901_0226004_66_620 184
428 3300038443 Ga0395901_0332192 Ga0395901_0332192_139_693 184
429 3300038443 Ga0395901_0791264 Ga0395901_0791264_339_893 184
430 3300038443 Ga0395901_0993255 Ga0395901_0993255_243_797 184
431 3300038443 Ga0395901_1197882 Ga0395901_1197882_149_703 184
432 3300039437 Ga0436365_0782179 Ga0436365_0782179_2140_2694 184
433 3300039450 Ga0436363_0609573 Ga0436363_0609573_656_1210 184
434 3300042005 Ga0439448_0005624 Ga0439448_0005624_789_1343 184
435 3300044658 Ga0466972_0063007 Ga0466972_0063007_448_1002 184
436 3300044683 Ga0466965_0159345 Ga0466965_0159345_278_835 184
437 3300044693 Ga0466961_0007771 Ga0466961_0007771_306_860 184
438 3300044693 Ga0466961_0053526 Ga0466961_0053526_1298_1852 184
439 3300044694 Ga0466963_0009505 Ga0466963_0009505_120_674 184
440 3300044694 Ga0466963_0010381 Ga0466963_0010381_929_1483 184
441 3300044694 Ga0466963_0023424 Ga0466963_0023424_2518_3072 184
442 3300044694 Ga0466963_0069732 Ga0466963_0069732_23_577 184
443 3300044694 Ga0466963_0101016 Ga0466963_0101016_1192_1746 184
444 3300044694 Ga0466963_0125463 Ga0466963_0125463_911_1465 184
445 3300044694 Ga0466963_0161724 Ga0466963_0161724_740_1294 184
446 3300044694 Ga0466963_0217497 Ga0466963_0217497_475_1029 184
447 3300044694 Ga0466963_0247663 Ga0466963_0247663_300_854 184
448 3300044694 Ga0466963_0344353 Ga0466963_0344353_230_784 184
449 3300044694 Ga0466963_0357371 Ga0466963_0357371_302_856 184
450 3300044694 Ga0466963_0537813 Ga0466963_0537813_261_815 184
451 3300044706 Ga0466964_0005303 Ga0466964_0005303_50_604 184
452 3300044719 Ga0466971_0333332 Ga0466971_0333332_123_677 184
453 3300044735 Ga0466968_0017286 Ga0466968_0017286_441_995 184
454 3300044765 Ga0466970_0102190 Ga0466970_0102190_446_1000 184
455 3300044842 Ga0466957_0000249 Ga0466957_0000249_3098_3652 184
456 3300044842 Ga0466957_0008287 Ga0466957_0008287_4357_4914 184
457 3300044842 Ga0466957_0075728 Ga0466957_0075728_1455_2009 184
458 3300044842 Ga0466957_0175917 Ga0466957_0175917_801_1355 184
459 3300044901 Ga0466960_0041649 Ga0466960_0041649_229_783 184
460 3300045049 Ga0466959_0039002 Ga0466959_0039002_353_907 184
461 3300045836 Ga0466958_0092171 Ga0466958_0092171_361_915 184
462 3300045836 Ga0466958_0111738 Ga0466958_0111738_629_1183 184
463 3300045836 Ga0466958_0239008 Ga0466958_0239008_115_669 184
464 3300045836 Ga0466958_0275372 Ga0466958_0275372_166_720 184
465 3300045976 Ga0466967_0057330 Ga0466967_0057330_2139_2693 184
466 3300045976 Ga0466967_0070856 Ga0466967_0070856_1468_2022 184
467 3300045976 Ga0466967_0075599 Ga0466967_0075599_1546_2103 184
468 3300045976 Ga0466967_0095685 Ga0466967_0095685_2075_2629 184
469 3300045976 Ga0466967_0126159 Ga0466967_0126159_1467_2021 184
470 3300045976 Ga0466967_0221250 Ga0466967_0221250_57_611 184
471 3300045976 Ga0466967_0244966 Ga0466967_0244966_478_1032 184
472 3300045976 Ga0466967_0500568 Ga0466967_0500568_22_576 184
473 3300045976 Ga0466967_0604149 Ga0466967_0604149_395_949 184
474 3300045976 Ga0466967_0695465 Ga0466967_0695465_117_671 184
475 3300045976 Ga0466967_0769114 Ga0466967_0769114_313_867 184
476 3300048905 Ga0496102_0060702 Ga0496102_0060702_1321_1875 184
477 3300048906 Ga0496103_0339844 Ga0496103_0339844_97_651 184
478 3300048907 Ga0496104_0507453 Ga0496104_0507453_105_659 184
479 3300048909 Ga0496106_0409394 Ga0496106_0409394_216_770 184
480 3300048910 Ga0496107_0158643 Ga0496107_0158643_1077_1631 184
481 3300048911 Ga0496108_0506223 Ga0496108_0506223_105_659 184
482 3300048912 Ga0496109_0164491 Ga0496109_0164491_1483_2037 184
483 3300048913 Ga0496110_0025949 Ga0496110_0025949_2199_2753 184
484 3300048913 Ga0496110_0133012 Ga0496110_0133012_976_1530 184
485 3300048914 Ga0496111_0596859 Ga0496111_0596859_195_749 184
486 3300048915 Ga0496112_0027160 Ga0496112_0027160_2537_3091 184
487 3300048915 Ga0496112_0160391 Ga0496112_0160391_534_1088 184
488 3300048916 Ga0496113_0219866 Ga0496113_0219866_414_968 184
489 3300049583 Ga0501067_0046433 Ga0501067_0046433_1082_1636 184
490 3300049583 Ga0501067_0440687 Ga0501067_0440687_158_712 184
491 3300061719 Ga0466962_0091537 Ga0466962_0091537_94_648 184
492 3300061719 Ga0466962_0345920 Ga0466962_0345920_146_700 184
493 3300001979 JGI24740J21852_10006518 JGI24740J21852_100065184 186
494 3300005329 Ga0070683_100029407 Ga0070683_1000294073 186
495 3300005336 Ga0070680_100015719 Ga0070680_1000157196 186
496 3300005337 Ga0070682_100154965 Ga0070682_1001549652 186
497 3300005339 Ga0070660_100019124 Ga0070660_1000191242 186
498 3300005341 Ga0070691_10013203 Ga0070691_100132032 186
499 3300005344 Ga0070661_100014531 Ga0070661_1000145312 186
500 3300005455 Ga0070663_100015732 Ga0070663_1000157322 186
501 3300005457 Ga0070662_100430364 Ga0070662_1004303641 186
502 3300005539 Ga0068853_100013803 Ga0068853_1000138033 186
503 3300005563 Ga0068855_100572723 Ga0068855_1005727232 186
504 3300005577 Ga0068857_100043692 Ga0068857_1000436922 186
505 3300005578 Ga0068854_100002843 Ga0068854_1000028434 186
506 3300005614 Ga0068856_100057044 Ga0068856_1000570443 186
507 3300005616 Ga0068852_100048459 Ga0068852_1000484592 186
508 3300005834 Ga0068851_10024332 Ga0068851_100243322 186
509 3300009093 Ga0105240_10018278 Ga0105240_100182783 186
510 3300009174 Ga0105241_10071716 Ga0105241_100717162 186
511 3300009551 Ga0105238_10014286 Ga0105238_100142866 186
512 3300013100 Ga0157373_10007965 Ga0157373_100079657 186
513 3300013307 Ga0157372_10032904 Ga0157372_100329042 186
514 3300020070 Ga0206356_11011314 Ga0206356_110113142 186
515 3300020081 Ga0206354_10573897 Ga0206354_105738972 186
516 3300025321 Ga0207656_10051526 Ga0207656_100515262 186
517 3300025904 Ga0207647_10000435 Ga0207647_1000043514 186
518 3300025909 Ga0207705_10151628 Ga0207705_101516282 186
519 3300025913 Ga0207695_10040720 Ga0207695_100407203 186
520 3300025919 Ga0207657_10003144 Ga0207657_1000314413 186
521 3300025920 Ga0207649_10519938 Ga0207649_105199382 186
522 3300025924 Ga0207694_10164859 Ga0207694_101648592 186
523 3300025932 Ga0207690_10012998 Ga0207690_100129984 186
524 3300025944 Ga0207661_10502019 Ga0207661_105020192 186
525 3300025949 Ga0207667_10025694 Ga0207667_100256945 186
526 3300025981 Ga0207640_10008246 Ga0207640_100082467 186
527 3300026041 Ga0207639_10019066 Ga0207639_100190662 186
528 3300026067 Ga0207678_10082049 Ga0207678_100820493 186
529 3300026116 Ga0207674_10001045 Ga0207674_1000104510 186
530 3300026142 Ga0207698_10002123 Ga0207698_100021236 186
531 3300037312 Ga0395899_0194557 Ga0395899_0194557_71_631 186
532 3300037418 Ga0395900_0158679 Ga0395900_0158679_280_840 186
533 3300037466 Ga0395898_0021682 Ga0395898_0021682_1167_1727 186
534 3300037471 Ga0395905_0295925 Ga0395905_0295925_625_1185 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

71

145

0.91

PF00034

Cytochrom_C

Cytochrome c

73

149

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o38-assembly1.cif.gz_A cytochrome c kustc0562 from kuenenia stuttgartiensis 0.7252 98 149
4eid-assembly1.cif.gz_A crystal structure of cytochrome c6 q57v mutant from synechococcus sp. pcc 7002 0.6544 73 149
7vzr-assembly1.cif.gz_C structure of the acidobacteria homodimeric reaction center bound with cytochrome c (the smaller form) 0.6516 59 150
5mxy-assembly1.cif.gz_A kustc0563 c-type cytochrome 0.6395 76 148
5mxz-assembly1.cif.gz_A kustc0563 y40f mutant 0.6328 75 148
ID Description Score Start End Superfamily
4eicA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.632 73 149 1.10.760.10
2d0wB00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6256 66 146 1.10.760.10
2zboK00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6201 73 149 1.10.760.10
2v08B00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6199 73 149 1.10.760.10
4eifA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6123 75 149 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A1Q3GZZ4-F1-model_v4 Cytochrome c domain-containing protein 0.6893 68 150 GO:0005506
GO:0009055
GO:0016020
GO:0020037
AF-A0A7Y5WAU3-F1-model_v4 C-type cytochrome 0.686 57 152 GO:0009055
GO:0016020
GO:0020037
GO:0046872
AF-A1ZN76-F1-model_v4 Cytochrome-c oxidase FixP chain 0.6827 68 156 GO:0005506
GO:0009055
GO:0016020
GO:0020037
AF-A0A3C0I9J2-F1-model_v4 Cytochrome oxidase subunit III 0.6805 67 156 GO:0005506
GO:0009055
GO:0016020
GO:0020037
AF-A0A855X9A8-F1-model_v4 Cytochrome c domain-containing protein 0.6771 69 150 GO:0009055
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
61.56 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map