F460439

General Info

Members Datasets Scaffolds Average Seq Length
533 228 1066 142

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0994393|Ga0395898_0994393_133_567
Length 144
Sequence MSLFSAISVGASGMAAQRMRAELLVENLANAETTRTPEGGPYRRKDAVFESAGVNSPFASIFNSELQTANGVGVSDIVVDQTEPERRYLPGHPDADKDGYVAFPKINTAEDMVDLMGAARGYEANISAMSAVKDMIQRSIDLMR

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
86 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
87 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
145 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
148 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
171 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
183 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
201 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
202 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.75
Rhizosphere 93.62
Stem 0
Stem Tuber 0
Unclassified 28.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0994393 3300037466 Bacteria 775
2 Ga0070658_11313311 3300005327 Unclassified 628
3 Ga0070683_100008954 3300005329 Bacteria 8531
4 Ga0070683_100075513 3300005329 Bacteria 3149
5 Ga0070683_100079657 3300005329 Unclassified 3065
6 Ga0070683_100083545 3300005329 Unclassified 2991
7 Ga0070683_100113123 3300005329 Bacteria 2561
8 Ga0070683_100278692 3300005329 Unclassified 1590
9 Ga0070683_101155809 3300005329 Bacteria 744
10 Ga0070666_10821266 3300005335 Unclassified 685
11 Ga0070680_100010100 3300005336 Bacteria 7277
12 Ga0070680_100019351 3300005336 Bacteria 5394
13 Ga0070680_100805757 3300005336 Unclassified 809
14 Ga0070682_100970475 3300005337 Bacteria 703
15 Ga0070682_101152450 3300005337 Unclassified 652
16 Ga0068868_100008488 3300005338 Bacteria 7355
17 Ga0068868_100302047 3300005338 Unclassified 1360
18 Ga0070660_100001895 3300005339 Bacteria 14403
19 Ga0070660_100343613 3300005339 Unclassified 1228
20 Ga0070660_100576413 3300005339 Bacteria 940
21 Ga0070689_100052215 3300005340 Bacteria 3162
22 Ga0070689_100422959 3300005340 Unclassified 1129
23 Ga0070691_10025754 3300005341 Bacteria 2740
24 Ga0070661_100148858 3300005344 Bacteria 1769
25 Ga0070661_100214329 3300005344 Bacteria 1475
26 Ga0070661_100282121 3300005344 Bacteria 1289
27 Ga0070692_10320631 3300005345 Bacteria 953
28 Ga0070669_100283359 3300005353 Unclassified 1328
29 Ga0070675_100056218 3300005354 Unclassified 3242
30 Ga0070671_100016650 3300005355 Bacteria 5943
31 Ga0070671_100175811 3300005355 Bacteria 1811
32 Ga0070671_100595182 3300005355 Unclassified 955
33 Ga0070673_100014652 3300005364 Bacteria 5472
34 Ga0070673_100028759 3300005364 Bacteria 4138
35 Ga0070659_100168281 3300005366 Unclassified 1794
36 Ga0070667_100178010 3300005367 Bacteria 1880
37 Ga0070709_10804304 3300005434 Bacteria 738
38 Ga0070714_100118406 3300005435 Unclassified 2353
39 Ga0070714_100197244 3300005435 Unclassified 1840
40 Ga0070714_100384780 3300005435 Bacteria 1323
41 Ga0070714_100393778 3300005435 Unclassified 1308
42 Ga0070714_102098063 3300005435 Bacteria 551
43 Ga0070713_100001585 3300005436 Bacteria 14568
44 Ga0070713_100003023 3300005436 Bacteria 11042
45 Ga0070713_100010391 3300005436 Bacteria 6725
46 Ga0070713_100161551 3300005436 Bacteria 2000
47 Ga0070701_10339189 3300005438 Bacteria 935
48 Ga0070711_100133630 3300005439 Bacteria 1851
49 Ga0070711_100548313 3300005439 Bacteria 959
50 Ga0070694_101627392 3300005444 Unclassified 548
51 Ga0070663_100079971 3300005455 Unclassified 2400
52 Ga0070663_101118289 3300005455 Unclassified 689
53 Ga0070678_100423811 3300005456 Bacteria 1160
54 Ga0070662_100058092 3300005457 Bacteria 2814
55 Ga0070681_10000972 3300005458 Bacteria 24213
56 Ga0070681_10044226 3300005458 Bacteria 4457
57 Ga0070681_10491717 3300005458 Unclassified 1140
58 Ga0070681_11378396 3300005458 Unclassified 628
59 Ga0068867_100028133 3300005459 Bacteria 4045
60 Ga0068867_100210773 3300005459 Bacteria 1560
61 Ga0068867_101589795 3300005459 Bacteria 611
62 Ga0070707_100995000 3300005468 Bacteria 804
63 Ga0070698_100351707 3300005471 Bacteria 1405
64 Ga0070679_100001636 3300005530 Bacteria 20190
65 Ga0070679_100083758 3300005530 Bacteria 3177
66 Ga0070679_100127468 3300005530 Unclassified 2527
67 Ga0070679_100383637 3300005530 Unclassified 1352
68 Ga0070679_100447057 3300005530 Unclassified 1237
69 Ga0070679_100892816 3300005530 Bacteria 832
70 Ga0070679_101069827 3300005530 Bacteria 751
71 Ga0070684_100001202 3300005535 Bacteria 18601
72 Ga0070684_100059606 3300005535 Bacteria 3337
73 Ga0070684_100656104 3300005535 Unclassified 977
74 Ga0070684_100697083 3300005535 Bacteria 947
75 Ga0068853_100072310 3300005539 Bacteria 3005
76 Ga0068853_100142271 3300005539 Bacteria 2154
77 Ga0068853_100223531 3300005539 Bacteria 1720
78 Ga0068853_100286022 3300005539 Bacteria 1521
79 Ga0068853_100298216 3300005539 Bacteria 1489
80 Ga0068853_100438811 3300005539 Bacteria 1227
81 Ga0070672_100178836 3300005543 Bacteria 1767
82 Ga0070695_100047976 3300005545 Bacteria 2730
83 Ga0070665_100006219 3300005548 Bacteria 12217
84 Ga0070665_100079178 3300005548 Bacteria 3292
85 Ga0070665_100490641 3300005548 Bacteria 1239
86 Ga0068855_100021859 3300005563 Bacteria 7670
87 Ga0068855_100044628 3300005563 Bacteria 5246
88 Ga0068855_100052224 3300005563 Unclassified 4813
89 Ga0068855_100096393 3300005563 Unclassified 3408
90 Ga0068855_100401871 3300005563 Bacteria 1501
91 Ga0068855_100686529 3300005563 Bacteria 1097
92 Ga0068855_100780148 3300005563 Unclassified 1017
93 Ga0070664_100520492 3300005564 Unclassified 1098
94 Ga0068857_100000120 3300005577 Bacteria 46937
95 Ga0068857_100017149 3300005577 Bacteria 6343
96 Ga0068854_100334543 3300005578 Bacteria 1235
97 Ga0068856_100004731 3300005614 Bacteria 13513
98 Ga0068856_100013858 3300005614 Bacteria 7797
99 Ga0068856_100052277 3300005614 Unclassified 4029
100 Ga0068856_100060407 3300005614 Bacteria 3745
101 Ga0068856_100130389 3300005614 Unclassified 2519
102 Ga0068856_100170747 3300005614 Bacteria 2187
103 Ga0068856_100241605 3300005614 Bacteria 1821
104 Ga0068856_100874336 3300005614 Unclassified 918
105 Ga0070702_101192906 3300005615 Unclassified 613
106 Ga0068852_100001736 3300005616 Bacteria 14844
107 Ga0068852_100004881 3300005616 Bacteria 9524
108 Ga0068859_100023291 3300005617 Bacteria 6214
109 Ga0068859_100034564 3300005617 Bacteria 5073
110 Ga0068859_100526321 3300005617 Unclassified 1277
111 Ga0068859_100907137 3300005617 Bacteria 966
112 Ga0068864_100159805 3300005618 Bacteria 2048
113 Ga0068866_10291920 3300005718 Bacteria 1015
114 Ga0068851_10554636 3300005834 Unclassified 695
115 Ga0068870_10086800 3300005840 Bacteria 1741
116 Ga0068863_100084869 3300005841 Unclassified 3001
117 Ga0068863_101734610 3300005841 Bacteria 634
118 Ga0068858_100171904 3300005842 Unclassified 2043
119 Ga0068858_100221481 3300005842 Bacteria 1792
120 Ga0068860_100038588 3300005843 Unclassified 4569
121 Ga0068860_100740510 3300005843 Bacteria 994
122 Ga0068860_100828990 3300005843 Bacteria 939
123 Ga0068862_100778747 3300005844 Bacteria 933
124 Ga0068862_101018092 3300005844 Unclassified 820
125 Ga0081539_10042379 3300005985 Bacteria 2652
126 Ga0070717_10004593 3300006028 Bacteria 9998
127 Ga0070717_10095082 3300006028 Unclassified 2522
128 Ga0070712_100799219 3300006175 Unclassified 809
129 Ga0097621_100001781 3300006237 Bacteria 14775
130 Ga0097621_100009350 3300006237 Bacteria 7114
131 Ga0097621_100017840 3300006237 Bacteria 5404
132 Ga0097621_100046427 3300006237 Unclassified 3514
133 Ga0097621_101450625 3300006237 Unclassified 650
134 Ga0068871_100033219 3300006358 Bacteria 4084
135 Ga0068871_100042453 3300006358 Bacteria 3651
136 Ga0068871_100053848 3300006358 Unclassified 3263
137 Ga0068871_100145867 3300006358 Unclassified 2015
138 Ga0068871_100715566 3300006358 Bacteria 918
139 Ga0068865_100038917 3300006881 Bacteria 3222
140 Ga0097620_100023291 3300006931 Bacteria 6214
141 Ga0097620_100034564 3300006931 Bacteria 5073
142 Ga0097620_100526375 3300006931 Unclassified 1277
143 Ga0097620_100907156 3300006931 Bacteria 966
144 Ga0105240_10002588 3300009093 Bacteria 28968
145 Ga0105240_10047725 3300009093 Bacteria 5417
146 Ga0105240_10196046 3300009093 Unclassified 2371
147 Ga0105240_10204209 3300009093 Bacteria 2314
148 Ga0105240_10499531 3300009093 Bacteria 1353
149 Ga0105240_10542267 3300009093 Bacteria 1288
150 Ga0105245_10002512 3300009098 Bacteria 16536
151 Ga0105245_10006104 3300009098 Bacteria 10594
152 Ga0105245_10007357 3300009098 Bacteria 9640
153 Ga0105245_10072754 3300009098 Unclassified 3124
154 Ga0105247_10311793 3300009101 Unclassified 1095
155 Ga0105247_10365741 3300009101 Bacteria 1018
156 Ga0105243_10226223 3300009148 Bacteria 1657
157 Ga0105243_10294265 3300009148 Bacteria 1468
158 Ga0105243_12958819 3300009148 Unclassified 515
159 Ga0105241_10005924 3300009174 Bacteria 9015
160 Ga0105241_10052868 3300009174 Bacteria 3103
161 Ga0105241_10074928 3300009174 Bacteria 2636
162 Ga0105241_10075553 3300009174 Unclassified 2625
163 Ga0105241_10281271 3300009174 Bacteria 1421
164 Ga0105241_10358458 3300009174 Unclassified 1268
165 Ga0105241_10382727 3300009174 Bacteria 1230
166 Ga0105242_10011197 3300009176 Bacteria 6892
167 Ga0105242_10075099 3300009176 Bacteria 2813
168 Ga0105242_12366722 3300009176 Unclassified 578
169 Ga0105248_10005037 3300009177 Bacteria 14592
170 Ga0105248_10227142 3300009177 Unclassified 2101
171 Ga0105248_10619763 3300009177 Bacteria 1221
172 Ga0105248_11143378 3300009177 Unclassified 880
173 Ga0105248_11210399 3300009177 Bacteria 854
174 Ga0105237_10003514 3300009545 Bacteria 18584
175 Ga0105237_10012348 3300009545 Bacteria 8998
176 Ga0105237_10037065 3300009545 Bacteria 4930
177 Ga0105237_10079700 3300009545 Unclassified 3265
178 Ga0105237_10944301 3300009545 Unclassified 869
179 Ga0105238_10001220 3300009551 Bacteria 25895
180 Ga0105238_10012477 3300009551 Bacteria 8570
181 Ga0105238_10035317 3300009551 Bacteria 5083
182 Ga0105238_10039392 3300009551 Bacteria 4792
183 Ga0105238_10046380 3300009551 Unclassified 4386
184 Ga0105238_10167784 3300009551 Bacteria 2171
185 Ga0105238_11928923 3300009551 Unclassified 624
186 Ga0105249_10066666 3300009553 Bacteria 3315
187 Ga0105239_10009647 3300010375 Bacteria 10857
188 Ga0105239_10049366 3300010375 Bacteria 4615
189 Ga0105239_10069536 3300010375 Bacteria 3868
190 Ga0105239_10202393 3300010375 Bacteria 2224
191 Ga0105239_10381826 3300010375 Unclassified 1593
192 Ga0105239_11644299 3300010375 Bacteria 743
193 Ga0105246_10003495 3300011119 Bacteria 9521
194 Ga0105246_10824469 3300011119 Bacteria 825
195 Ga0105246_12260701 3300011119 Bacteria 530
196 Ga0157373_10261028 3300013100 Bacteria 1226
197 Ga0157371_10460501 3300013102 Unclassified 936
198 Ga0157370_10006696 3300013104 Bacteria 12646
199 Ga0157370_10009232 3300013104 Bacteria 10569
200 Ga0157370_10047330 3300013104 Unclassified 4123
201 Ga0157370_10048458 3300013104 Bacteria 4070
202 Ga0157370_10176881 3300013104 Bacteria 1983
203 Ga0157370_10275392 3300013104 Bacteria 1555
204 Ga0157370_10869594 3300013104 Unclassified 819
205 Ga0157369_10001249 3300013105 Bacteria 31685
206 Ga0157369_10002261 3300013105 Bacteria 23149
207 Ga0157369_10046017 3300013105 Bacteria 4744
208 Ga0157369_10049434 3300013105 Unclassified 4559
209 Ga0157369_10094601 3300013105 Bacteria 3189
210 Ga0157369_10173272 3300013105 Unclassified 2272
211 Ga0157369_10682677 3300013105 Unclassified 1058
212 Ga0157369_11184990 3300013105 Unclassified 780
213 Ga0157369_12121575 3300013105 Unclassified 570
214 Ga0157374_10004785 3300013296 Bacteria 11356
215 Ga0157374_10027006 3300013296 Bacteria 5172
216 Ga0157374_10054415 3300013296 Unclassified 3733
217 Ga0157374_10166372 3300013296 Bacteria 2149
218 Ga0157374_10539844 3300013296 Unclassified 1173
219 Ga0157374_10714422 3300013296 Unclassified 1016
220 Ga0157378_10000777 3300013297 Bacteria 29657
221 Ga0157378_10044072 3300013297 Unclassified 3961
222 Ga0157378_10297370 3300013297 Unclassified 1561
223 Ga0157378_10622059 3300013297 Bacteria 1093
224 Ga0157372_10050431 3300013307 Bacteria 4629
225 Ga0157372_10064289 3300013307 Unclassified 4117
226 Ga0157372_10160692 3300013307 Bacteria 2596
227 Ga0157372_10164244 3300013307 Bacteria 2567
228 Ga0157372_10200984 3300013307 Bacteria 2308
229 Ga0157372_10291709 3300013307 Bacteria 1897
230 Ga0157372_10937350 3300013307 Unclassified 1004
231 Ga0157375_10009841 3300013308 Bacteria 8407
232 Ga0163163_10030604 3300014325 Bacteria 5188
233 Ga0163163_10077736 3300014325 Bacteria 3314
234 Ga0163163_10388055 3300014325 Bacteria 1454
235 Ga0163163_10641464 3300014325 Bacteria 1125
236 Ga0163163_10838383 3300014325 Bacteria 983
237 Ga0163163_11115822 3300014325 Unclassified 852
238 Ga0157380_11619673 3300014326 Unclassified 703
239 Ga0157380_11695241 3300014326 Unclassified 689
240 Ga0157379_10030717 3300014968 Unclassified 4784
241 Ga0157379_10124871 3300014968 Bacteria 2316
242 Ga0157379_10834578 3300014968 Unclassified 871
243 Ga0157379_11710815 3300014968 Bacteria 616
244 Ga0157376_10087275 3300014969 Bacteria 2692
245 Ga0157376_10127955 3300014969 Bacteria 2262
246 Ga0157376_12082211 3300014969 Bacteria 606
247 Ga0213873_10002351 3300021358 Bacteria 3265
248 Ga0213873_10006396 3300021358 Bacteria 2315
249 Ga0213873_10081744 3300021358 Unclassified 905
250 Ga0213872_10047062 3300021361 Bacteria 1962
251 Ga0213874_10002494 3300021377 Bacteria 3970
252 Ga0213874_10017233 3300021377 Bacteria 1934
253 Ga0213874_10162525 3300021377 Bacteria 785
254 Ga0213876_10025313 3300021384 Bacteria 3131
255 Ga0213876_10212035 3300021384 Unclassified 1029
256 Ga0213876_10281541 3300021384 Bacteria 884
257 Ga0213875_10000090 3300021388 Bacteria 105400
258 Ga0213875_10053760 3300021388 Unclassified 1886
259 Ga0213875_10121695 3300021388 Bacteria 1220
260 Ga0213871_10008773 3300021441 Bacteria 2242
261 Ga0207656_10119377 3300025321 Unclassified 1226
262 Ga0207642_10015631 3300025899 Bacteria 2835
263 Ga0207710_10074358 3300025900 Unclassified 1564
264 Ga0207710_10080029 3300025900 Unclassified 1514
265 Ga0207680_10760050 3300025903 Unclassified 695
266 Ga0207645_10040506 3300025907 Bacteria 2983
267 Ga0207643_10035270 3300025908 Bacteria 2804
268 Ga0207705_10033236 3300025909 Unclassified 3685
269 Ga0207654_10010268 3300025911 Bacteria 4768
270 Ga0207654_10031410 3300025911 Bacteria 2924
271 Ga0207654_10073814 3300025911 Bacteria 2034
272 Ga0207654_10113087 3300025911 Bacteria 1692
273 Ga0207654_10216183 3300025911 Unclassified 1269
274 Ga0207707_10004262 3300025912 Bacteria 12657
275 Ga0207707_10165174 3300025912 Bacteria 1935
276 Ga0207707_10368809 3300025912 Bacteria 1235
277 Ga0207695_10003430 3300025913 Bacteria 22374
278 Ga0207695_10004721 3300025913 Bacteria 18458
279 Ga0207695_10017846 3300025913 Bacteria 8226
280 Ga0207695_10059678 3300025913 Bacteria 3954
281 Ga0207695_11164197 3300025913 Bacteria 651
282 Ga0207671_10012071 3300025914 Bacteria 6979
283 Ga0207671_10012283 3300025914 Bacteria 6897
284 Ga0207671_10867697 3300025914 Unclassified 714
285 Ga0207693_10664818 3300025915 Unclassified 809
286 Ga0207663_10069856 3300025916 Bacteria 2261
287 Ga0207663_10120534 3300025916 Bacteria 1796
288 Ga0207660_10417019 3300025917 Unclassified 1082
289 Ga0207657_10000117 3300025919 Bacteria 78715
290 Ga0207657_10063688 3300025919 Bacteria 3151
291 Ga0207657_10244107 3300025919 Unclassified 1433
292 Ga0207649_10262854 3300025920 Bacteria 1248
293 Ga0207652_10007596 3300025921 Bacteria 8730
294 Ga0207652_10663434 3300025921 Bacteria 932
295 Ga0207652_10694938 3300025921 Bacteria 908
296 Ga0207652_10931467 3300025921 Unclassified 766
297 Ga0207652_11262027 3300025921 Unclassified 641
298 Ga0207646_10780101 3300025922 Bacteria 852
299 Ga0207694_10011233 3300025924 Bacteria 6763
300 Ga0207694_10023157 3300025924 Unclassified 4715
301 Ga0207694_10028089 3300025924 Bacteria 4288
302 Ga0207694_10049717 3300025924 Bacteria 3245
303 Ga0207694_10098841 3300025924 Bacteria 2311
304 Ga0207694_10121945 3300025924 Bacteria 2082
305 Ga0207694_10453076 3300025924 Bacteria 1071
306 Ga0207687_10001292 3300025927 Bacteria 17094
307 Ga0207687_10001975 3300025927 Bacteria 14101
308 Ga0207687_10019911 3300025927 Unclassified 4450
309 Ga0207687_10238590 3300025927 Bacteria 1439
310 Ga0207700_10002828 3300025928 Bacteria 9983
311 Ga0207700_10143107 3300025928 Bacteria 1967
312 Ga0207700_10770727 3300025928 Bacteria 860
313 Ga0207664_10307195 3300025929 Bacteria 1397
314 Ga0207644_10081173 3300025931 Bacteria 2396
315 Ga0207644_10202034 3300025931 Viruses 1568
316 Ga0207644_10716556 3300025931 Unclassified 835
317 Ga0207690_10037905 3300025932 Bacteria 3133
318 Ga0207690_10064293 3300025932 Unclassified 2505
319 Ga0207706_10126628 3300025933 Unclassified 2246
320 Ga0207686_10059443 3300025934 Bacteria 2415
321 Ga0207709_10395308 3300025935 Bacteria 1055
322 Ga0207670_10257604 3300025936 Bacteria 1351
323 Ga0207704_10031205 3300025938 Bacteria 2999
324 Ga0207704_11473857 3300025938 Unclassified 584
325 Ga0207711_10002570 3300025941 Bacteria 16148
326 Ga0207711_10032500 3300025941 Bacteria 4411
327 Ga0207711_10561490 3300025941 Unclassified 1065
328 Ga0207689_10042168 3300025942 Unclassified 3776
329 Ga0207661_10005613 3300025944 Bacteria 8844
330 Ga0207661_10008140 3300025944 Bacteria 7483
331 Ga0207661_10031115 3300025944 Unclassified 4118
332 Ga0207661_10348022 3300025944 Bacteria 1336
333 Ga0207661_10771610 3300025944 Unclassified 885
334 Ga0207661_11289778 3300025944 Bacteria 671
335 Ga0207679_10190545 3300025945 Bacteria 1704
336 Ga0207679_10662523 3300025945 Unclassified 945
337 Ga0207679_11718895 3300025945 Unclassified 574
338 Ga0207667_10000558 3300025949 Bacteria 48930
339 Ga0207667_10003914 3300025949 Bacteria 18324
340 Ga0207667_10005583 3300025949 Bacteria 15349
341 Ga0207667_10014928 3300025949 Bacteria 8833
342 Ga0207667_10215036 3300025949 Bacteria 1970
343 Ga0207667_10528722 3300025949 Unclassified 1194
344 Ga0207667_10698849 3300025949 Unclassified 1017
345 Ga0207667_10743271 3300025949 Bacteria 981
346 Ga0207651_10030322 3300025960 Viruses 3442
347 Ga0207712_10021251 3300025961 Bacteria 4260
348 Ga0207640_10215674 3300025981 Bacteria 1465
349 Ga0207658_10172010 3300025986 Bacteria 1785
350 Ga0207677_10006434 3300026023 Bacteria 6444
351 Ga0207677_10131645 3300026023 Bacteria 1900
352 Ga0207677_12277300 3300026023 Unclassified 504
353 Ga0207703_10005046 3300026035 Bacteria 10699
354 Ga0207703_10134541 3300026035 Bacteria 2139
355 Ga0207639_10024898 3300026041 Bacteria 4337
356 Ga0207639_10058000 3300026041 Bacteria 2976
357 Ga0207639_10065260 3300026041 Bacteria 2825
358 Ga0207639_10126812 3300026041 Bacteria 2106
359 Ga0207639_10510573 3300026041 Bacteria 1099
360 Ga0207639_10981922 3300026041 Bacteria 791
361 Ga0207678_10028311 3300026067 Unclassified 4892
362 Ga0207678_11052400 3300026067 Unclassified 720
363 Ga0207702_10003846 3300026078 Bacteria 13539
364 Ga0207702_10037020 3300026078 Unclassified 4082
365 Ga0207702_10083551 3300026078 Unclassified 2778
366 Ga0207702_10194859 3300026078 Unclassified 1875
367 Ga0207702_10416794 3300026078 Unclassified 1298
368 Ga0207702_10429495 3300026078 Bacteria 1279
369 Ga0207702_10627052 3300026078 Bacteria 1056
370 Ga0207641_10202054 3300026088 Bacteria 1833
371 Ga0207648_10034389 3300026089 Bacteria 4467
372 Ga0207648_10454246 3300026089 Bacteria 1167
373 Ga0207676_10189464 3300026095 Bacteria 1809
374 Ga0207676_10881244 3300026095 Unclassified 877
375 Ga0207674_10000063 3300026116 Bacteria 110904
376 Ga0207674_10002195 3300026116 Bacteria 24712
377 Ga0207674_10143497 3300026116 Bacteria 2347
378 Ga0207675_100498306 3300026118 Bacteria 1212
379 Ga0207683_10115529 3300026121 Bacteria 2406
380 Ga0207698_10001811 3300026142 Bacteria 12486
381 Ga0207698_10026694 3300026142 Bacteria 4088
382 Ga0207698_10487845 3300026142 Bacteria 1197
383 Ga0207698_11530523 3300026142 Unclassified 682
384 Ga0268266_10017312 3300028379 Bacteria 6151
385 Ga0268266_10017490 3300028379 Bacteria 6115
386 Ga0268264_10046367 3300028381 Unclassified 3610
387 Ga0268264_10588271 3300028381 Bacteria 1096
388 Ga0265325_10009741 3300031241 Bacteria 5599
389 Ga0265340_10032987 3300031247 Bacteria 2581
390 Ga0265313_10002538 3300031595 Bacteria 15654
391 Ga0265314_10000542 3300031711 Bacteria 48535
392 Ga0373934_0001529 3300035086 Bacteria 8475
393 Ga0373934_0064965 3300035086 Bacteria 1457
394 Ga0373934_0143338 3300035086 Bacteria 977
395 Ga0373923_0011919 3300035111 Unclassified 3202
396 Ga0373936_0312018 3300035113 Bacteria 711
397 Ga0373953_0257684 3300035117 Unclassified 759
398 Ga0373954_0006227 3300035118 Bacteria 5203
399 Ga0373954_0108916 3300035118 Bacteria 1339
400 Ga0373954_0177007 3300035118 Bacteria 1045
401 Ga0373956_0065612 3300035119 Bacteria 1650
402 Ga0373956_0275603 3300035119 Bacteria 800
403 Ga0373943_0372468 3300035170 Bacteria 821
404 Ga0373955_0012279 3300035172 Bacteria 4114
405 Ga0373955_0141892 3300035172 Bacteria 1409
406 Ga0373924_0119492 3300035410 Bacteria 1143
407 Ga0373935_0364265 3300035692 Bacteria 1033
408 Ga0373927_0249244 3300035695 Bacteria 1167
409 Ga0373927_0649748 3300035695 Bacteria 697
410 Ga0373927_0673355 3300035695 Unclassified 684
411 Ga0373927_0771720 3300035695 Bacteria 635
412 Ga0373933_0009208 3300035724 Bacteria 5392
413 Ga0373933_0056366 3300035724 Bacteria 2359
414 Ga0373947_0538132 3300035725 Bacteria 795
415 Ga0373937_0004267 3300036401 Bacteria 12116
416 Ga0373937_0140096 3300036401 Bacteria 2262
417 Ga0373937_0169161 3300036401 Bacteria 2050
418 Ga0373937_0214210 3300036401 Bacteria 1813
419 Ga0373937_0483995 3300036401 Unclassified 1175
420 Ga0373937_0524046 3300036401 Bacteria 1126
421 Ga0373925_0083863 3300037068 Bacteria 2428
422 Ga0395900_1244109 3300037418 Unclassified 659
423 Ga0395898_0245621 3300037466 Bacteria 1707
424 Ga0395898_0343883 3300037466 Unclassified 1423
425 Ga0395905_0544408 3300037471 Unclassified 1062
426 Ga0436364_0150979 3300037853 Bacteria 1545
427 Ga0436364_0197868 3300037853 Unclassified 1939
428 Ga0436364_0309018 3300037853 Bacteria 153512
429 Ga0436364_0365755 3300037853 Bacteria 1880
430 Ga0436364_0736287 3300037853 Bacteria 10739
431 Ga0436364_0835025 3300037853 Bacteria 2117
432 Ga0436364_1033516 3300037853 Bacteria 1008
433 Ga0436364_1052588 3300037853 Bacteria 2375
434 Ga0436364_1059906 3300037853 Bacteria 6133
435 Ga0436364_1176483 3300037853 Bacteria 673
436 Ga0436364_1259297 3300037853 Bacteria 968
437 Ga0436364_1515040 3300037853 Unclassified 615
438 Ga0395901_0493776 3300038443 Bacteria 1247
439 Ga0436365_0045967 3300039437 Bacteria 1011
440 Ga0436365_0123288 3300039437 Bacteria 6863
441 Ga0436365_0928021 3300039437 Bacteria 6578
442 Ga0436365_1690613 3300039437 Bacteria 6504
443 Ga0436360_0017108 3300039438 Bacteria 6359
444 Ga0436361_0693434 3300039447 Bacteria 4059
445 Ga0436363_0362655 3300039450 Bacteria 11417
446 Ga0436363_1110255 3300039450 Bacteria 1325
447 Ga0436363_1196028 3300039450 Unclassified 1057
448 Ga0436363_1700643 3300039450 Bacteria 8730
449 Ga0436362_0280514 3300039453 Unclassified 1233
450 Ga0436362_0692269 3300039453 Bacteria 2286
451 Ga0436362_0715145 3300039453 Bacteria 3278
452 Ga0436362_1052564 3300039453 Bacteria 675
453 Ga0439448_0115624 3300042005 Bacteria 918
454 Ga0451577_0874640 3300042876 Unclassified 810
455 Ga0466966_0087949 3300044684 Bacteria 1931
456 Ga0466961_0181692 3300044693 Bacteria 1306
457 Ga0466963_0061541 3300044694 Bacteria 2510
458 Ga0466963_0224204 3300044694 Bacteria 1317
459 Ga0466960_0027797 3300044901 Unclassified 2584
460 Ga0466959_0641324 3300045049 Bacteria 713
461 Ga0451576_0431762 3300045051 Unclassified 1382
462 Ga0466958_0216965 3300045836 Bacteria 1220
463 Ga0466967_1821866 3300045976 Unclassified 606
464 Ga0495592_0037329 3300046454 Unclassified 3658
465 Ga0495592_0244879 3300046454 Bacteria 1188
466 Ga0495651_0142054 3300046462 Bacteria 1740
467 Ga0495653_0605830 3300046463 Unclassified 673
468 Ga0495580_0051320 3300046472 Bacteria 2916
469 Ga0495580_0355950 3300046472 Unclassified 991
470 Ga0495582_0004835 3300046473 Bacteria 7558
471 Ga0495639_0018401 3300046475 Unclassified 3041
472 Ga0495664_0170370 3300046477 Bacteria 1321
473 Ga0495618_0837484 3300046514 Bacteria 534
474 Ga0495628_1050401 3300046516 Bacteria 558
475 Ga0495630_0202227 3300046517 Bacteria 1516
476 Ga0495652_0084234 3300046529 Bacteria 2615
477 Ga0495665_0055900 3300046531 Unclassified 2084
478 Ga0495586_0003316 3300046535 Bacteria 8640
479 Ga0495586_0072193 3300046535 Unclassified 1887
480 Ga0495586_0183724 3300046535 Bacteria 1183
481 Ga0495587_0001975 3300046536 Bacteria 13684
482 Ga0495645_0008840 3300046543 Bacteria 7036
483 Ga0495645_0239464 3300046543 Bacteria 1211
484 Ga0495667_0195603 3300046559 Bacteria 1295
485 Ga0495634_0034770 3300046642 Unclassified 3456
486 Ga0495635_0767731 3300046663 Bacteria 622
487 Ga0495635_0922108 3300046663 Bacteria 559
488 Ga0495657_0439088 3300046675 Unclassified 765
489 Ga0495599_0002938 3300046678 Bacteria 9907
490 Ga0495599_0600038 3300046678 Unclassified 641
491 Ga0495599_0627235 3300046678 Unclassified 624
492 Ga0495623_0250405 3300046679 Bacteria 996
493 Ga0495646_0623249 3300046680 Unclassified 547
494 Ga0495658_0027167 3300046683 Bacteria 3076
495 Ga0495613_0080580 3300046689 Unclassified 2366
496 Ga0495581_0029805 3300047315 Bacteria 3163
497 Ga0495604_0071369 3300047317 Bacteria 2627
498 Ga0495674_0142903 3300047319 Bacteria 2011
499 Ga0495674_0281178 3300047319 Bacteria 1363
500 Ga0495680_0129135 3300047322 Bacteria 1859
501 Ga0495680_0267121 3300047322 Bacteria 1209
502 Ga0495675_0102655 3300047444 Bacteria 1789
503 Ga0495675_0432671 3300047444 Bacteria 763
504 Ga0495684_0003128 3300047471 Bacteria 12982
505 Ga0495684_0306548 3300047471 Bacteria 1139
506 Ga0495684_0554037 3300047471 Bacteria 782
507 Ga0495602_0001193 3300048088 Bacteria 25517
508 Ga0495602_0066603 3300048088 Bacteria 3102
509 Ga0495602_0370143 3300048088 Unclassified 1029
510 Ga0495602_0606919 3300048088 Bacteria 752
511 Ga0496104_0504158 3300048907 Bacteria 1121
512 Ga0496112_0110741 3300048915 Unclassified 2716
513 Ga0496115_0014573 3300048918 Bacteria 5952
514 Ga0496115_0527873 3300048918 Bacteria 946
515 Ga0496126_0345361 3300048929 Bacteria 1218
516 Ga0501034_0030415 3300049571 Bacteria 5490
517 Ga0501038_0100309 3300049574 Bacteria 2413
518 Ga0501043_0378622 3300049579 Unclassified 1072
519 Ga0501046_0708141 3300049580 Bacteria 709
520 Ga0501047_0007200 3300049581 Bacteria 10458
521 Ga0501047_0205565 3300049581 Bacteria 1828
522 Ga0501070_0112456 3300049586 Bacteria 2250
523 Ga0501070_0473236 3300049586 Bacteria 1008
524 Ga0501073_0736348 3300049589 Bacteria 680
525 Ga0501074_0648434 3300049590 Unclassified 746
526 Ga0501035_0063771 3300049822 Bacteria 3276
527 Ga0501044_0019196 3300049823 Bacteria 7318
528 Ga0501044_0038128 3300049823 Bacteria 5019
529 Ga0501044_0097939 3300049823 Unclassified 2953
530 Ga0501044_0128033 3300049823 Unclassified 2535
531 Ga0495595_0201503 3300053084 Bacteria 991
532 Ga0495619_0256503 3300053085 Bacteria 1212
533 Ga0466962_0384619 3300061719 Unclassified 701
534 Ga0395898_0994393
535 Ga0070658_11313311
536 Ga0070683_100008954
537 Ga0070683_100075513
538 Ga0070683_100079657
539 Ga0070683_100083545
540 Ga0070683_100113123
541 Ga0070683_100278692
542 Ga0070683_101155809
543 Ga0070666_10821266
544 Ga0070680_100010100
545 Ga0070680_100019351
546 Ga0070680_100805757
547 Ga0070682_100970475
548 Ga0070682_101152450
549 Ga0068868_100008488
550 Ga0068868_100302047
551 Ga0070660_100001895
552 Ga0070660_100343613
553 Ga0070660_100576413
554 Ga0070689_100052215
555 Ga0070689_100422959
556 Ga0070691_10025754
557 Ga0070661_100148858
558 Ga0070661_100214329
559 Ga0070661_100282121
560 Ga0070692_10320631
561 Ga0070669_100283359
562 Ga0070675_100056218
563 Ga0070671_100016650
564 Ga0070671_100175811
565 Ga0070671_100595182
566 Ga0070673_100014652
567 Ga0070673_100028759
568 Ga0070659_100168281
569 Ga0070667_100178010
570 Ga0070709_10804304
571 Ga0070714_100118406
572 Ga0070714_100197244
573 Ga0070714_100384780
574 Ga0070714_100393778
575 Ga0070714_102098063
576 Ga0070713_100001585
577 Ga0070713_100003023
578 Ga0070713_100010391
579 Ga0070713_100161551
580 Ga0070701_10339189
581 Ga0070711_100133630
582 Ga0070711_100548313
583 Ga0070694_101627392
584 Ga0070663_100079971
585 Ga0070663_101118289
586 Ga0070678_100423811
587 Ga0070662_100058092
588 Ga0070681_10000972
589 Ga0070681_10044226
590 Ga0070681_10491717
591 Ga0070681_11378396
592 Ga0068867_100028133
593 Ga0068867_100210773
594 Ga0068867_101589795
595 Ga0070707_100995000
596 Ga0070698_100351707
597 Ga0070679_100001636
598 Ga0070679_100083758
599 Ga0070679_100127468
600 Ga0070679_100383637
601 Ga0070679_100447057
602 Ga0070679_100892816
603 Ga0070679_101069827
604 Ga0070684_100001202
605 Ga0070684_100059606
606 Ga0070684_100656104
607 Ga0070684_100697083
608 Ga0068853_100072310
609 Ga0068853_100142271
610 Ga0068853_100223531
611 Ga0068853_100286022
612 Ga0068853_100298216
613 Ga0068853_100438811
614 Ga0070672_100178836
615 Ga0070695_100047976
616 Ga0070665_100006219
617 Ga0070665_100079178
618 Ga0070665_100490641
619 Ga0068855_100021859
620 Ga0068855_100044628
621 Ga0068855_100052224
622 Ga0068855_100096393
623 Ga0068855_100401871
624 Ga0068855_100686529
625 Ga0068855_100780148
626 Ga0070664_100520492
627 Ga0068857_100000120
628 Ga0068857_100017149
629 Ga0068854_100334543
630 Ga0068856_100004731
631 Ga0068856_100013858
632 Ga0068856_100052277
633 Ga0068856_100060407
634 Ga0068856_100130389
635 Ga0068856_100170747
636 Ga0068856_100241605
637 Ga0068856_100874336
638 Ga0070702_101192906
639 Ga0068852_100001736
640 Ga0068852_100004881
641 Ga0068859_100023291
642 Ga0068859_100034564
643 Ga0068859_100526321
644 Ga0068859_100907137
645 Ga0068864_100159805
646 Ga0068866_10291920
647 Ga0068851_10554636
648 Ga0068870_10086800
649 Ga0068863_100084869
650 Ga0068863_101734610
651 Ga0068858_100171904
652 Ga0068858_100221481
653 Ga0068860_100038588
654 Ga0068860_100740510
655 Ga0068860_100828990
656 Ga0068862_100778747
657 Ga0068862_101018092
658 Ga0081539_10042379
659 Ga0070717_10004593
660 Ga0070717_10095082
661 Ga0070712_100799219
662 Ga0097621_100001781
663 Ga0097621_100009350
664 Ga0097621_100017840
665 Ga0097621_100046427
666 Ga0097621_101450625
667 Ga0068871_100033219
668 Ga0068871_100042453
669 Ga0068871_100053848
670 Ga0068871_100145867
671 Ga0068871_100715566
672 Ga0068865_100038917
673 Ga0097620_100023291
674 Ga0097620_100034564
675 Ga0097620_100526375
676 Ga0097620_100907156
677 Ga0105240_10002588
678 Ga0105240_10047725
679 Ga0105240_10196046
680 Ga0105240_10204209
681 Ga0105240_10499531
682 Ga0105240_10542267
683 Ga0105245_10002512
684 Ga0105245_10006104
685 Ga0105245_10007357
686 Ga0105245_10072754
687 Ga0105247_10311793
688 Ga0105247_10365741
689 Ga0105243_10226223
690 Ga0105243_10294265
691 Ga0105243_12958819
692 Ga0105241_10005924
693 Ga0105241_10052868
694 Ga0105241_10074928
695 Ga0105241_10075553
696 Ga0105241_10281271
697 Ga0105241_10358458
698 Ga0105241_10382727
699 Ga0105242_10011197
700 Ga0105242_10075099
701 Ga0105242_12366722
702 Ga0105248_10005037
703 Ga0105248_10227142
704 Ga0105248_10619763
705 Ga0105248_11143378
706 Ga0105248_11210399
707 Ga0105237_10003514
708 Ga0105237_10012348
709 Ga0105237_10037065
710 Ga0105237_10079700
711 Ga0105237_10944301
712 Ga0105238_10001220
713 Ga0105238_10012477
714 Ga0105238_10035317
715 Ga0105238_10039392
716 Ga0105238_10046380
717 Ga0105238_10167784
718 Ga0105238_11928923
719 Ga0105249_10066666
720 Ga0105239_10009647
721 Ga0105239_10049366
722 Ga0105239_10069536
723 Ga0105239_10202393
724 Ga0105239_10381826
725 Ga0105239_11644299
726 Ga0105246_10003495
727 Ga0105246_10824469
728 Ga0105246_12260701
729 Ga0157373_10261028
730 Ga0157371_10460501
731 Ga0157370_10006696
732 Ga0157370_10009232
733 Ga0157370_10047330
734 Ga0157370_10048458
735 Ga0157370_10176881
736 Ga0157370_10275392
737 Ga0157370_10869594
738 Ga0157369_10001249
739 Ga0157369_10002261
740 Ga0157369_10046017
741 Ga0157369_10049434
742 Ga0157369_10094601
743 Ga0157369_10173272
744 Ga0157369_10682677
745 Ga0157369_11184990
746 Ga0157369_12121575
747 Ga0157374_10004785
748 Ga0157374_10027006
749 Ga0157374_10054415
750 Ga0157374_10166372
751 Ga0157374_10539844
752 Ga0157374_10714422
753 Ga0157378_10000777
754 Ga0157378_10044072
755 Ga0157378_10297370
756 Ga0157378_10622059
757 Ga0157372_10050431
758 Ga0157372_10064289
759 Ga0157372_10160692
760 Ga0157372_10164244
761 Ga0157372_10200984
762 Ga0157372_10291709
763 Ga0157372_10937350
764 Ga0157375_10009841
765 Ga0163163_10030604
766 Ga0163163_10077736
767 Ga0163163_10388055
768 Ga0163163_10641464
769 Ga0163163_10838383
770 Ga0163163_11115822
771 Ga0157380_11619673
772 Ga0157380_11695241
773 Ga0157379_10030717
774 Ga0157379_10124871
775 Ga0157379_10834578
776 Ga0157379_11710815
777 Ga0157376_10087275
778 Ga0157376_10127955
779 Ga0157376_12082211
780 Ga0213873_10002351
781 Ga0213873_10006396
782 Ga0213873_10081744
783 Ga0213872_10047062
784 Ga0213874_10002494
785 Ga0213874_10017233
786 Ga0213874_10162525
787 Ga0213876_10025313
788 Ga0213876_10212035
789 Ga0213876_10281541
790 Ga0213875_10000090
791 Ga0213875_10053760
792 Ga0213875_10121695
793 Ga0213871_10008773
794 Ga0207656_10119377
795 Ga0207642_10015631
796 Ga0207710_10074358
797 Ga0207710_10080029
798 Ga0207680_10760050
799 Ga0207645_10040506
800 Ga0207643_10035270
801 Ga0207705_10033236
802 Ga0207654_10010268
803 Ga0207654_10031410
804 Ga0207654_10073814
805 Ga0207654_10113087
806 Ga0207654_10216183
807 Ga0207707_10004262
808 Ga0207707_10165174
809 Ga0207707_10368809
810 Ga0207695_10003430
811 Ga0207695_10004721
812 Ga0207695_10017846
813 Ga0207695_10059678
814 Ga0207695_11164197
815 Ga0207671_10012071
816 Ga0207671_10012283
817 Ga0207671_10867697
818 Ga0207693_10664818
819 Ga0207663_10069856
820 Ga0207663_10120534
821 Ga0207660_10417019
822 Ga0207657_10000117
823 Ga0207657_10063688
824 Ga0207657_10244107
825 Ga0207649_10262854
826 Ga0207652_10007596
827 Ga0207652_10663434
828 Ga0207652_10694938
829 Ga0207652_10931467
830 Ga0207652_11262027
831 Ga0207646_10780101
832 Ga0207694_10011233
833 Ga0207694_10023157
834 Ga0207694_10028089
835 Ga0207694_10049717
836 Ga0207694_10098841
837 Ga0207694_10121945
838 Ga0207694_10453076
839 Ga0207687_10001292
840 Ga0207687_10001975
841 Ga0207687_10019911
842 Ga0207687_10238590
843 Ga0207700_10002828
844 Ga0207700_10143107
845 Ga0207700_10770727
846 Ga0207664_10307195
847 Ga0207644_10081173
848 Ga0207644_10202034
849 Ga0207644_10716556
850 Ga0207690_10037905
851 Ga0207690_10064293
852 Ga0207706_10126628
853 Ga0207686_10059443
854 Ga0207709_10395308
855 Ga0207670_10257604
856 Ga0207704_10031205
857 Ga0207704_11473857
858 Ga0207711_10002570
859 Ga0207711_10032500
860 Ga0207711_10561490
861 Ga0207689_10042168
862 Ga0207661_10005613
863 Ga0207661_10008140
864 Ga0207661_10031115
865 Ga0207661_10348022
866 Ga0207661_10771610
867 Ga0207661_11289778
868 Ga0207679_10190545
869 Ga0207679_10662523
870 Ga0207679_11718895
871 Ga0207667_10000558
872 Ga0207667_10003914
873 Ga0207667_10005583
874 Ga0207667_10014928
875 Ga0207667_10215036
876 Ga0207667_10528722
877 Ga0207667_10698849
878 Ga0207667_10743271
879 Ga0207651_10030322
880 Ga0207712_10021251
881 Ga0207640_10215674
882 Ga0207658_10172010
883 Ga0207677_10006434
884 Ga0207677_10131645
885 Ga0207677_12277300
886 Ga0207703_10005046
887 Ga0207703_10134541
888 Ga0207639_10024898
889 Ga0207639_10058000
890 Ga0207639_10065260
891 Ga0207639_10126812
892 Ga0207639_10510573
893 Ga0207639_10981922
894 Ga0207678_10028311
895 Ga0207678_11052400
896 Ga0207702_10003846
897 Ga0207702_10037020
898 Ga0207702_10083551
899 Ga0207702_10194859
900 Ga0207702_10416794
901 Ga0207702_10429495
902 Ga0207702_10627052
903 Ga0207641_10202054
904 Ga0207648_10034389
905 Ga0207648_10454246
906 Ga0207676_10189464
907 Ga0207676_10881244
908 Ga0207674_10000063
909 Ga0207674_10002195
910 Ga0207674_10143497
911 Ga0207675_100498306
912 Ga0207683_10115529
913 Ga0207698_10001811
914 Ga0207698_10026694
915 Ga0207698_10487845
916 Ga0207698_11530523
917 Ga0268266_10017312
918 Ga0268266_10017490
919 Ga0268264_10046367
920 Ga0268264_10588271
921 Ga0265325_10009741
922 Ga0265340_10032987
923 Ga0265313_10002538
924 Ga0265314_10000542
925 Ga0373934_0001529
926 Ga0373934_0064965
927 Ga0373934_0143338
928 Ga0373923_0011919
929 Ga0373936_0312018
930 Ga0373953_0257684
931 Ga0373954_0006227
932 Ga0373954_0108916
933 Ga0373954_0177007
934 Ga0373956_0065612
935 Ga0373956_0275603
936 Ga0373943_0372468
937 Ga0373955_0012279
938 Ga0373955_0141892
939 Ga0373924_0119492
940 Ga0373935_0364265
941 Ga0373927_0249244
942 Ga0373927_0649748
943 Ga0373927_0673355
944 Ga0373927_0771720
945 Ga0373933_0009208
946 Ga0373933_0056366
947 Ga0373947_0538132
948 Ga0373937_0004267
949 Ga0373937_0140096
950 Ga0373937_0169161
951 Ga0373937_0214210
952 Ga0373937_0483995
953 Ga0373937_0524046
954 Ga0373925_0083863
955 Ga0395900_1244109
956 Ga0395898_0245621
957 Ga0395898_0343883
958 Ga0395905_0544408
959 Ga0436364_0150979
960 Ga0436364_0197868
961 Ga0436364_0309018
962 Ga0436364_0365755
963 Ga0436364_0736287
964 Ga0436364_0835025
965 Ga0436364_1033516
966 Ga0436364_1052588
967 Ga0436364_1059906
968 Ga0436364_1176483
969 Ga0436364_1259297
970 Ga0436364_1515040
971 Ga0395901_0493776
972 Ga0436365_0045967
973 Ga0436365_0123288
974 Ga0436365_0928021
975 Ga0436365_1690613
976 Ga0436360_0017108
977 Ga0436361_0693434
978 Ga0436363_0362655
979 Ga0436363_1110255
980 Ga0436363_1196028
981 Ga0436363_1700643
982 Ga0436362_0280514
983 Ga0436362_0692269
984 Ga0436362_0715145
985 Ga0436362_1052564
986 Ga0439448_0115624
987 Ga0451577_0874640
988 Ga0466966_0087949
989 Ga0466961_0181692
990 Ga0466963_0061541
991 Ga0466963_0224204
992 Ga0466960_0027797
993 Ga0466959_0641324
994 Ga0451576_0431762
995 Ga0466958_0216965
996 Ga0466967_1821866
997 Ga0495592_0037329
998 Ga0495592_0244879
999 Ga0495651_0142054
1000 Ga0495653_0605830
1001 Ga0495580_0051320
1002 Ga0495580_0355950
1003 Ga0495582_0004835
1004 Ga0495639_0018401
1005 Ga0495664_0170370
1006 Ga0495618_0837484
1007 Ga0495628_1050401
1008 Ga0495630_0202227
1009 Ga0495652_0084234
1010 Ga0495665_0055900
1011 Ga0495586_0003316
1012 Ga0495586_0072193
1013 Ga0495586_0183724
1014 Ga0495587_0001975
1015 Ga0495645_0008840
1016 Ga0495645_0239464
1017 Ga0495667_0195603
1018 Ga0495634_0034770
1019 Ga0495635_0767731
1020 Ga0495635_0922108
1021 Ga0495657_0439088
1022 Ga0495599_0002938
1023 Ga0495599_0600038
1024 Ga0495599_0627235
1025 Ga0495623_0250405
1026 Ga0495646_0623249
1027 Ga0495658_0027167
1028 Ga0495613_0080580
1029 Ga0495581_0029805
1030 Ga0495604_0071369
1031 Ga0495674_0142903
1032 Ga0495674_0281178
1033 Ga0495680_0129135
1034 Ga0495680_0267121
1035 Ga0495675_0102655
1036 Ga0495675_0432671
1037 Ga0495684_0003128
1038 Ga0495684_0306548
1039 Ga0495684_0554037
1040 Ga0495602_0001193
1041 Ga0495602_0066603
1042 Ga0495602_0370143
1043 Ga0495602_0606919
1044 Ga0496104_0504158
1045 Ga0496112_0110741
1046 Ga0496115_0014573
1047 Ga0496115_0527873
1048 Ga0496126_0345361
1049 Ga0501034_0030415
1050 Ga0501038_0100309
1051 Ga0501043_0378622
1052 Ga0501046_0708141
1053 Ga0501047_0007200
1054 Ga0501047_0205565
1055 Ga0501070_0112456
1056 Ga0501070_0473236
1057 Ga0501073_0736348
1058 Ga0501074_0648434
1059 Ga0501035_0063771
1060 Ga0501044_0019196
1061 Ga0501044_0038128
1062 Ga0501044_0097939
1063 Ga0501044_0128033
1064 Ga0495595_0201503
1065 Ga0495619_0256503
1066 Ga0466962_0384619

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06429

Flg_bbr_C

Flagellar basal body rod FlgEFG protein C-terminal

97

142

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cg0-assembly1.cif.gz_p cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.8446 2 143
7cg0-assembly1.cif.gz_p cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.833 2 143
7cg0-assembly1.cif.gz_i cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.8297 2 141
7cg0-assembly1.cif.gz_h cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.8261 2 141
7nvg-assembly1.cif.gz_V2 salmonella flagellar basal body refined in c1 map 0.826 2 143
ID Description Score Start End Superfamily
af_Q9VMH8_1_121_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6549 82 142 1.10.287.370
5qinA02 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.5664 14 45 1.10.510.10
af_C6SW11_8_117_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5281 13 142 1.10.287.370
af_Q3LFN0_1_257_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5026 58 140 1.20.1250.20
2dy4A04 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain 0.494 12 144 1.10.287.690
ID Description Score Start End GO Terms
AF-A0A7Z9ZYY7-F1-model_v4 Flagellar basal-body rod protein FlgC 0.9437 9 145 GO:0030694
GO:0071973
AF-A0A328QM01-F1-model_v4 deleted 0.9284 1 145
AF-A0A847M9L4-F1-model_v4 Flagellar basal-body rod protein FlgC 0.9204 1 145 GO:0030694
GO:0071978
AF-A0A371RH16-F1-model_v4 Flagellar basal body rod protein FlgC 0.9172 5 145 GO:0009425
GO:0071978
AF-A0A1G1EUL4-F1-model_v4 Flagellar basal-body rod protein FlgC 0.9142 7 145 GO:0030694
GO:0071978

Map