metagRoot

F460426

General Info

Members	Datasets	Scaffolds	Average Seq Length
533	285	517	291

Family's Representative Sequence

Representative Sequence	3300031995\|Ga0307409_100004098\|Ga0307409_1000040983
Length	351
Sequence	MPPRQLVTRHGTARDGLSANENIPHGEILMSTTDISARLHPRRALLVLSLLECHFAAYRVGAMSQWTAADLPSFAGRTVIVTGANSGLGLITARELARVGAKTILAVRNTAKGDEAAASIGGDVEVRKLDLQDLASVRTFADGVDSVDVLVNNAGIMAVPYAQTVDGFESQIGTNHLGHFALTNLLLPKITDRVVTVSSGMHLIGQINLDDLNWKARPYSPWRAYGQSKLANLLFTSELQRRLDAAGSPLKAHAAHPGYSATNLQGNTGRKVGDALMTFGNKLATNADFGARQTLYAVAKDLPGDSFIGPQFAMWGPTGRTPLRSPLARDAKKAVGLWELSEQLTDTKFGL

Samples

	Sample ID	Description	Type	Environment
1	2643221687	Mycobacterium sp. Root135	Isolate	Unclassified
2	2738541264	Mycobacterium sp. OK889	Isolate	Unclassified
3	2738541274	Mycobacterium sp. YR708	Isolate	Unclassified
4	2738541356	Mycobacterium sp. OK887	Isolate	Unclassified
5	2738543028	Mycobacterium sp. YR782	Isolate	Unclassified
6	2808606982	Streptomyces sp. SLBN-118	Isolate	Unclassified
7	2842134933	Mycolicibacterium obuense SEMIA 442	Isolate	Nodule
8	2899359706	Amycolatopsis anabasis EGI 650086	Isolate	Unclassified
9	2902792274	Mycolicibacterium sp. P9-64	Isolate	Unclassified
10	2902799365	Mycolicibacterium sp. P1-5	Isolate	Unclassified
11	2902810491	Mycolicibacterium sp. P9-22	Isolate	Unclassified
12	2902837492	Mycolicibacterium sp. P1-18	Isolate	Unclassified
13	2917736166	Amycolatopsis dendrobii DR6-1	Isolate	Unclassified
14	2929212328	Mycolicibacterium sp. R-73050 Hybrid assembly	Isolate	Unclassified
15	2939582691	Mycolicibacterium sp. 624	Isolate	Rhizosphere
16	2990088156	Streptomyces albidus CAP 215	Isolate	Unclassified
17	3300002073	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4	Metagenome	Rhizosphere
18	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
19	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
20	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
21	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
22	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
23	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
24	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
25	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
26	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
27	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
28	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
29	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
30	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
31	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
32	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
33	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
34	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
35	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
36	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
37	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
38	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
39	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
40	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
41	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
42	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
43	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
44	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
45	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
46	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
47	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
48	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
49	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
50	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
51	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
52	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
53	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
54	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
55	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
56	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
57	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
58	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
59	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
60	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
61	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
62	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
63	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
64	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
65	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
66	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
67	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
68	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
69	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
70	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
71	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
72	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
73	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
74	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
75	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
76	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
77	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
78	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
79	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
80	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
81	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
82	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
83	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
84	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
85	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
86	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
87	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
88	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
89	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
90	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
91	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
92	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
93	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
94	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
95	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
96	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
97	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
98	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
99	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
100	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
101	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
102	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
103	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
104	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
105	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
106	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
107	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
108	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
109	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
110	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
111	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
159	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
160	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
161	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
162	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
163	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
164	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
165	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
166	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
167	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
168	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
169	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
170	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
171	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
172	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
173	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
174	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
175	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
176	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
177	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
178	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
179	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
180	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
181	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
182	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
183	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
184	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
185	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
186	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
187	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
188	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
189	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
190	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
191	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
192	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
193	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
194	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
195	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
196	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
197	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
198	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
199	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
200	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
201	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
202	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
203	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
204	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
205	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
206	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
207	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
208	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
209	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
210	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
211	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
212	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
213	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
214	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
215	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
216	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
217	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
218	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
219	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
220	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
221	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
222	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
223	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
224	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
225	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
226	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
227	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
228	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
229	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
230	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
231	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
232	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
233	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
234	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
235	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
236	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
237	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
238	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
239	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
240	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
241	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
242	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
243	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
244	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
245	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
246	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
247	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
248	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
249	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
250	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
251	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
252	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
253	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
254	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
255	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
256	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
257	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
258	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
259	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
260	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
261	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
262	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
263	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
264	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
265	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
266	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
267	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
268	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
269	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
270	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
271	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
272	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
273	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
274	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
275	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
276	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
277	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
278	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
279	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
280	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
281	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
282	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
283	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
284	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
285	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	97
Metatranscriptomes	0
Isolates	3

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	11.63
Nodule	0.19
Rhizoplane	12.57
Rhizosphere	65.67
Stem	0
Stem Tuber	0
Unclassified	9.94

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24745J21846_1000885	3300002073	Bacteria	2782
2	JGI24744J21845_10002910	3300002077	Bacteria	3500
3	JGI24742J22300_10002859	3300002244	Bacteria	2790
4	Ga0055528_1023167	3300003790	Bacteria	1905
5	Ga0055540_1000043	3300003792	Bacteria	155228
6	Ga0055540_1004226	3300003792	Bacteria	6598
7	Ga0070690_100223356	3300005330	Bacteria	1321
8	Ga0068869_100019489	3300005334	Bacteria	4637
9	Ga0070666_10093788	3300005335	Bacteria	2064
10	Ga0070666_10123147	3300005335	Bacteria	1799
11	Ga0070682_100003080	3300005337	Bacteria	9232
12	Ga0068868_100001163	3300005338	Bacteria	18048
13	Ga0068868_100162543	3300005338	Bacteria	1845
14	Ga0070691_10010543	3300005341	Bacteria	4219
15	Ga0070687_100044972	3300005343	Bacteria	2252
16	Ga0070668_100001540	3300005347	Bacteria	16632
17	Ga0070668_100162205	3300005347	Bacteria	1814
18	Ga0070669_100018910	3300005353	Bacteria	4924
19	Ga0070669_100020428	3300005353	Bacteria	4730
20	Ga0070671_100043005	3300005355	Bacteria	3756
21	Ga0070671_100227223	3300005355	Bacteria	1583
22	Ga0070673_100071196	3300005364	Bacteria	2793
23	Ga0070659_100206786	3300005366	Bacteria	1617
24	Ga0070667_100000791	3300005367	Bacteria	29649
25	Ga0070667_100013169	3300005367	Bacteria	6836
26	Ga0070667_100013973	3300005367	Bacteria	6635
27	Ga0070667_100027611	3300005367	Bacteria	4723
28	Ga0070709_10012808	3300005434	Bacteria	4700
29	Ga0070714_100512386	3300005435	Bacteria	1145
30	Ga0070710_10000690	3300005437	Bacteria	16057
31	Ga0070710_10003060	3300005437	Bacteria	7951
32	Ga0070711_100000160	3300005439	Bacteria	36517
33	Ga0070711_100007595	3300005439	Bacteria	6597
34	Ga0070711_100271820	3300005439	Bacteria	1338
35	Ga0070705_100149966	3300005440	Bacteria	1545
36	Ga0070694_100061108	3300005444	Bacteria	2571
37	Ga0070663_100032577	3300005455	Bacteria	3594
38	Ga0070678_100000117	3300005456	Bacteria	31126
39	Ga0070662_100016792	3300005457	Bacteria	4921
40	Ga0068867_100004067	3300005459	Bacteria	10296
41	Ga0068867_100028527	3300005459	Bacteria	4020
42	Ga0070706_100341411	3300005467	Bacteria	1396
43	Ga0070707_100003125	3300005468	Bacteria	15664
44	Ga0070684_100097128	3300005535	Bacteria	2627
45	Ga0068853_100023310	3300005539	Bacteria	5180
46	Ga0068853_100023917	3300005539	Bacteria	5120
47	Ga0070672_100067944	3300005543	Bacteria	2825
48	Ga0070686_100065306	3300005544	Bacteria	2363
49	Ga0070686_100097616	3300005544	Bacteria	1978
50	Ga0070695_100103507	3300005545	Bacteria	1921
51	Ga0070696_100010017	3300005546	Bacteria	6339
52	Ga0070693_100070126	3300005547	Bacteria	2062
53	Ga0070665_100006373	3300005548	Bacteria	12030
54	Ga0070665_100009409	3300005548	Bacteria	9888
55	Ga0070665_100029759	3300005548	Bacteria	5495
56	Ga0068855_100263352	3300005563	Bacteria	1920
57	Ga0070664_100230222	3300005564	Bacteria	1661
58	Ga0068854_100009069	3300005578	Bacteria	6411
59	Ga0068854_100277711	3300005578	Bacteria	1347
60	Ga0068859_100001042	3300005617	Bacteria	28409
61	Ga0068859_100077098	3300005617	Bacteria	3374
62	Ga0068864_100534163	3300005618	Bacteria	1132
63	Ga0068866_10000441	3300005718	Bacteria	19171
64	Ga0068866_10043910	3300005718	Bacteria	2233
65	Ga0068861_100003820	3300005719	Bacteria	10055
66	Ga0068863_100001025	3300005841	Bacteria	27909
67	Ga0068863_100012259	3300005841	Bacteria	8277
68	Ga0068863_100089781	3300005841	Bacteria	2914
69	Ga0068858_100004832	3300005842	Bacteria	13203
70	Ga0068858_100014666	3300005842	Bacteria	7378
71	Ga0068858_100016818	3300005842	Bacteria	6869
72	Ga0068860_100000087	3300005843	Bacteria	158242
73	Ga0068860_100008728	3300005843	Bacteria	10094
74	Ga0068862_100000077	3300005844	Bacteria	116781
75	Ga0068862_100022465	3300005844	Bacteria	5276
76	Ga0068862_100281044	3300005844	Bacteria	1525
77	Ga0081455_10048103	3300005937	Bacteria	3688
78	Ga0081455_10050617	3300005937	Bacteria	3571
79	Ga0081455_10321411	3300005937	Bacteria	1102
80	Ga0070717_10283194	3300006028	Bacteria	1470
81	Ga0075365_10008384	3300006038	Bacteria	5862
82	Ga0075365_10021990	3300006038	Bacteria	3987
83	Ga0075365_10066664	3300006038	Bacteria	2416
84	Ga0075365_10178984	3300006038	Bacteria	1482
85	Ga0075363_100008437	3300006048	Bacteria	4796
86	Ga0075363_100047538	3300006048	Bacteria	2279
87	Ga0075363_100050105	3300006048	Bacteria	2224
88	Ga0075363_100055659	3300006048	Bacteria	2119
89	Ga0075364_10050924	3300006051	Bacteria	2703
90	Ga0075364_10073962	3300006051	Bacteria	2246
91	Ga0075364_10111675	3300006051	Bacteria	1824
92	Ga0075364_10205962	3300006051	Bacteria	1334
93	Ga0070716_100009944	3300006173	Bacteria	4757
94	Ga0070716_100025451	3300006173	Bacteria	3158
95	Ga0070712_100000846	3300006175	Bacteria	18192
96	Ga0070712_100002348	3300006175	Bacteria	11656
97	Ga0075362_10049670	3300006177	Bacteria	1874
98	Ga0075362_10120917	3300006177	Bacteria	1239
99	Ga0075367_10225707	3300006178	Bacteria	1173
100	Ga0075369_10004544	3300006186	Bacteria	5137
101	Ga0075369_10006368	3300006186	Bacteria	4461
102	Ga0075369_10014594	3300006186	Bacteria	3142
103	Ga0075369_10057821	3300006186	Bacteria	1688
104	Ga0075369_10144026	3300006186	Bacteria	1087
105	Ga0097621_100150291	3300006237	Bacteria	1997
106	Ga0075370_10053304	3300006353	Bacteria	2296
107	Ga0075370_10055517	3300006353	Bacteria	2250
108	Ga0075370_10069734	3300006353	Bacteria	2010
109	Ga0068871_100048970	3300006358	Bacteria	3414
110	Ga0075428_100071233	3300006844	Bacteria	3799
111	Ga0075433_10255974	3300006852	Bacteria	1553
112	Ga0068865_100401689	3300006881	Bacteria	1122
113	Ga0075436_100087314	3300006914	Bacteria	2166
114	Ga0097620_100001042	3300006931	Bacteria	28409
115	Ga0097620_100077087	3300006931	Bacteria	3374
116	Ga0075435_100133462	3300007076	Bacteria	2078
117	Ga0105250_10037242	3300009092	Bacteria	1952
118	Ga0111539_10328257	3300009094	Bacteria	1781
119	Ga0111539_10916898	3300009094	Bacteria	1019
120	Ga0105245_10008338	3300009098	Bacteria	9053
121	Ga0105245_10035982	3300009098	Bacteria	4396
122	Ga0105245_10059620	3300009098	Bacteria	3437
123	Ga0105247_10000007	3300009101	Bacteria	409490
124	Ga0105247_10000060	3300009101	Bacteria	127879
125	Ga0105247_10000298	3300009101	Bacteria	44765
126	Ga0114129_10212142	3300009147	Bacteria	2617
127	Ga0114129_10424682	3300009147	Bacteria	1748
128	Ga0105243_10000700	3300009148	Bacteria	32410
129	Ga0105243_10045903	3300009148	Bacteria	3435
130	Ga0105243_10333689	3300009148	Bacteria	1386
131	Ga0105242_10001954	3300009176	Bacteria	16221
132	Ga0105242_10242373	3300009176	Bacteria	1621
133	Ga0105248_10000050	3300009177	Bacteria	152667
134	Ga0105248_10003516	3300009177	Bacteria	17379
135	Ga0105248_10056751	3300009177	Bacteria	4393
136	Ga0105248_10145708	3300009177	Bacteria	2672
137	Ga0105237_10006011	3300009545	Bacteria	13581
138	Ga0105237_10011826	3300009545	Bacteria	9231
139	Ga0105237_10027144	3300009545	Bacteria	5848
140	Ga0105238_10676479	3300009551	Bacteria	1043
141	Ga0105249_10000042	3300009553	Bacteria	195242
142	Ga0105249_10000470	3300009553	Bacteria	37482
143	Ga0105249_10052537	3300009553	Bacteria	3722
144	Ga0105239_10016841	3300010375	Bacteria	8078
145	Ga0105239_10024596	3300010375	Bacteria	6634
146	Ga0105239_10082818	3300010375	Bacteria	3533
147	Ga0157369_10448544	3300013105	Bacteria	1336
148	Ga0157374_10032490	3300013296	Bacteria	4752
149	Ga0157378_10292006	3300013297	Bacteria	1575
150	Ga0157372_10048234	3300013307	Bacteria	4734
151	Ga0157375_10078003	3300013308	Bacteria	3344
152	Ga0157375_10317825	3300013308	Bacteria	1721
153	Ga0157375_10502654	3300013308	Bacteria	1376
154	Ga0163163_10094418	3300014325	Bacteria	3009
155	Ga0157380_10010166	3300014326	Bacteria	6763
156	Ga0157377_10180592	3300014745	Bacteria	1327
157	Ga0157379_10002499	3300014968	Bacteria	15398
158	Ga0157379_10052574	3300014968	Bacteria	3639
159	Ga0157379_10061838	3300014968	Bacteria	3349
160	Ga0157376_10161575	3300014969	Bacteria	2031
161	Ga0163161_10027061	3300017792	Bacteria	4066
162	Ga0163161_10041561	3300017792	Bacteria	3303
163	Ga0213876_10005625	3300021384	Bacteria	6880
164	Ga0213876_10062567	3300021384	Bacteria	1965
165	Ga0209673_1013931	3300025273	Bacteria	3143
166	Ga0209051_1000108	3300025303	Bacteria	155280
167	Ga0209051_1001345	3300025303	Bacteria	21360
168	Ga0209051_1003362	3300025303	Bacteria	10530
169	Ga0209051_1010755	3300025303	Bacteria	4581
170	Ga0209051_1024750	3300025303	Bacteria	2461
171	Ga0209051_1036090	3300025303	Bacteria	1830
172	Ga0207692_10007732	3300025898	Bacteria	4417
173	Ga0207642_10036329	3300025899	Bacteria	2113
174	Ga0207710_10000010	3300025900	Bacteria	482087
175	Ga0207710_10000013	3300025900	Bacteria	409402
176	Ga0207688_10021558	3300025901	Bacteria	3522
177	Ga0207688_10158374	3300025901	Bacteria	1341
178	Ga0207680_10014842	3300025903	Bacteria	4047
179	Ga0207647_10013370	3300025904	Bacteria	5693
180	Ga0207647_10102217	3300025904	Bacteria	1700
181	Ga0207685_10014881	3300025905	Bacteria	2448
182	Ga0207699_10005382	3300025906	Bacteria	6135
183	Ga0207699_10142454	3300025906	Bacteria	1577
184	Ga0207645_10070834	3300025907	Bacteria	2231
185	Ga0207684_10007648	3300025910	Bacteria	9693
186	Ga0207654_10169896	3300025911	Bacteria	1415
187	Ga0207654_10232315	3300025911	Bacteria	1229
188	Ga0207671_10007606	3300025914	Bacteria	9375
189	Ga0207671_10074011	3300025914	Bacteria	2545
190	Ga0207671_10234914	3300025914	Bacteria	1439
191	Ga0207693_10000754	3300025915	Bacteria	29034
192	Ga0207693_10003890	3300025915	Bacteria	12718
193	Ga0207693_10192297	3300025915	Bacteria	1605
194	Ga0207663_10004087	3300025916	Bacteria	7234
195	Ga0207663_10254197	3300025916	Bacteria	1295
196	Ga0207662_10020192	3300025918	Bacteria	3800
197	Ga0207646_10006984	3300025922	Bacteria	11567
198	Ga0207646_10041901	3300025922	Bacteria	4114
199	Ga0207681_10001782	3300025923	Bacteria	13828
200	Ga0207681_10002155	3300025923	Bacteria	12552
201	Ga0207681_10025217	3300025923	Bacteria	3822
202	Ga0207694_10477201	3300025924	Bacteria	1043
203	Ga0207687_10016666	3300025927	Bacteria	4829
204	Ga0207644_10026466	3300025931	Bacteria	3997
205	Ga0207690_10052045	3300025932	Bacteria	2741
206	Ga0207690_10221592	3300025932	Bacteria	1447
207	Ga0207706_10019289	3300025933	Bacteria	6133
208	Ga0207706_10021979	3300025933	Bacteria	5726
209	Ga0207686_10002494	3300025934	Bacteria	9999
210	Ga0207709_10007107	3300025935	Bacteria	6252
211	Ga0207709_10246775	3300025935	Bacteria	1302
212	Ga0207709_10486915	3300025935	Bacteria	960
213	Ga0207669_10001189	3300025937	Bacteria	11053
214	Ga0207669_10021180	3300025937	Bacteria	3426
215	Ga0207704_10083181	3300025938	Bacteria	2076
216	Ga0207665_10009094	3300025939	Bacteria	6524
217	Ga0207691_10055981	3300025940	Bacteria	3594
218	Ga0207711_10001406	3300025941	Bacteria	22551
219	Ga0207711_10032792	3300025941	Bacteria	4394
220	Ga0207711_10033441	3300025941	Bacteria	4350
221	Ga0207711_10320052	3300025941	Bacteria	1433
222	Ga0207651_10062166	3300025960	Bacteria	2601
223	Ga0207712_10000010	3300025961	Bacteria	455972
224	Ga0207712_10001196	3300025961	Bacteria	17936
225	Ga0207668_10002892	3300025972	Bacteria	10073
226	Ga0207640_10009045	3300025981	Bacteria	5558
227	Ga0207658_10000677	3300025986	Bacteria	29704
228	Ga0207658_10001961	3300025986	Bacteria	15354
229	Ga0207658_10061168	3300025986	Bacteria	2813
230	Ga0207703_10009823	3300026035	Bacteria	7505
231	Ga0207703_10028562	3300026035	Bacteria	4397
232	Ga0207703_10074184	3300026035	Bacteria	2816
233	Ga0207703_10549154	3300026035	Bacteria	1089
234	Ga0207639_10007030	3300026041	Bacteria	7672
235	Ga0207639_10016712	3300026041	Bacteria	5198
236	Ga0207678_10009360	3300026067	Bacteria	8622
237	Ga0207678_10016046	3300026067	Bacteria	6578
238	Ga0207708_10016479	3300026075	Bacteria	5557
239	Ga0207641_10000849	3300026088	Bacteria	32380
240	Ga0207641_10005077	3300026088	Bacteria	11285
241	Ga0207641_10026225	3300026088	Bacteria	4809
242	Ga0207648_10014199	3300026089	Bacteria	7367
243	Ga0207648_10114857	3300026089	Bacteria	2366
244	Ga0207676_10426590	3300026095	Bacteria	1245
245	Ga0207675_100007850	3300026118	Bacteria	10069
246	Ga0207675_100063261	3300026118	Bacteria	3457
247	Ga0207683_10000984	3300026121	Bacteria	26143
248	Ga0207683_10058440	3300026121	Bacteria	3386
249	Ga0207698_10250822	3300026142	Bacteria	1619
250	Ga0268266_10030548	3300028379	Bacteria	4577
251	Ga0268266_10139805	3300028379	Bacteria	2172
252	Ga0268266_10238385	3300028379	Bacteria	1678
253	Ga0268265_10000014	3300028380	Bacteria	330186
254	Ga0268265_10128264	3300028380	Bacteria	2103
255	Ga0268264_10000150	3300028381	Bacteria	158263
256	Ga0268264_10027397	3300028381	Bacteria	4655
257	Ga0307511_10104160	3300030521	Bacteria	1844
258	Ga0265327_10002508	3300031251	Bacteria	19190
259	Ga0307405_10040394	3300031731	Bacteria	2826
260	Ga0307413_10213759	3300031824	Bacteria	1403
261	Ga0307410_10078120	3300031852	Bacteria	2316
262	Ga0307407_10024118	3300031903	Bacteria	3185
263	Ga0307412_10221481	3300031911	Bacteria	1451
264	Ga0307409_100004098	3300031995	Bacteria	8112
265	Ga0307409_100039873	3300031995	Bacteria	3490
266	Ga0307411_10092790	3300032005	Bacteria	2112
267	Ga0307415_100077296	3300032126	Bacteria	2363
268	Ga0307415_100131120	3300032126	Bacteria	1898
269	Ga0307415_100339556	3300032126	Bacteria	1260
270	Ga0373939_0005374	3300035114	Bacteria	3050
271	Ga0316582_0116046	3300036647	Bacteria	1787
272	Ga0316584_0017797	3300036712	Bacteria	5117
273	Ga0395900_0006721	3300037418	Bacteria	11939
274	Ga0436364_1308388	3300037853	Bacteria	35210
275	Ga0436365_0052028	3300039437	Bacteria	2431
276	Ga0436365_0056280	3300039437	Bacteria	18059
277	Ga0436365_1443134	3300039437	Bacteria	4214
278	Ga0436362_1156483	3300039453	Bacteria	1696
279	Ga0439461_0000950	3300041410	Bacteria	4341
280	Ga0439461_0008037	3300041410	Bacteria	1883
281	Ga0439466_0009584	3300041411	Bacteria	3620
282	Ga0439466_0010268	3300041411	Bacteria	3480
283	Ga0439466_0023180	3300041411	Bacteria	2185
284	Ga0439465_0002866	3300041413	Bacteria	5645
285	Ga0439465_0002904	3300041413	Bacteria	5617
286	Ga0439465_0054227	3300041413	Bacteria	1318
287	Ga0451793_1722364	3300041452	Bacteria	2293
288	Ga0451843_1031485	3300041509	Bacteria	1779
289	Ga0439431_0008285	3300041997	Bacteria	2334
290	Ga0439431_0041265	3300041997	Bacteria	1176
291	Ga0439445_0018743	3300042004	Bacteria	1720
292	Ga0439434_0004459	3300042435	Bacteria	4093
293	Ga0439434_0030735	3300042435	Bacteria	1631
294	Ga0466969_0056737	3300044656	Bacteria	1911
295	Ga0466972_0008599	3300044658	Bacteria	5121
296	Ga0466972_0019835	3300044658	Bacteria	3361
297	Ga0466972_0031739	3300044658	Bacteria	2597
298	Ga0466965_0000697	3300044683	Bacteria	12460
299	Ga0466965_0002661	3300044683	Bacteria	7643
300	Ga0466965_0010937	3300044683	Bacteria	4243
301	Ga0466965_0047754	3300044683	Bacteria	2120
302	Ga0466965_0149834	3300044683	Bacteria	1219
303	Ga0466966_0120765	3300044684	Bacteria	1610
304	Ga0466966_0156281	3300044684	Bacteria	1389
305	Ga0466961_0061691	3300044693	Bacteria	2383
306	Ga0466961_0126180	3300044693	Bacteria	1605
307	Ga0466963_0058225	3300044694	Bacteria	2576
308	Ga0466963_0199824	3300044694	Bacteria	1398
309	Ga0466971_0012321	3300044719	Bacteria	3745
310	Ga0466971_0013054	3300044719	Bacteria	3644
311	Ga0466971_0079129	3300044719	Bacteria	1498
312	Ga0466971_0104012	3300044719	Bacteria	1306
313	Ga0466968_0004379	3300044735	Bacteria	5273
314	Ga0466968_0010033	3300044735	Bacteria	3660
315	Ga0466970_0106292	3300044765	Bacteria	1531
316	Ga0466970_0141703	3300044765	Bacteria	1325
317	Ga0466957_0003667	3300044842	Bacteria	8475
318	Ga0466957_0020307	3300044842	Bacteria	3909
319	Ga0466957_0051256	3300044842	Bacteria	2512
320	Ga0466957_0152596	3300044842	Bacteria	1495
321	Ga0466957_0175988	3300044842	Bacteria	1395
322	Ga0466960_0000225	3300044901	Bacteria	19643
323	Ga0466960_0000319	3300044901	Bacteria	16503
324	Ga0466960_0002911	3300044901	Bacteria	6510
325	Ga0466960_0050599	3300044901	Bacteria	2004
326	Ga0466959_0046101	3300045049	Bacteria	3208
327	Ga0466959_0049823	3300045049	Bacteria	3076
328	Ga0466958_0019127	3300045836	Bacteria	3984
329	Ga0466958_0080665	3300045836	Bacteria	2002
330	Ga0466958_0088296	3300045836	Bacteria	1915
331	Ga0466967_0001792	3300045976	Bacteria	12861
332	Ga0466967_0081127	3300045976	Bacteria	2929
333	Ga0466967_0165525	3300045976	Bacteria	2078
334	Ga0466967_0285203	3300045976	Bacteria	1585
335	Ga0495603_0023983	3300046455	Bacteria	3690
336	Ga0495603_0093866	3300046455	Bacteria	1753
337	Ga0495629_0050017	3300046459	Bacteria	2928
338	Ga0495638_0014063	3300046460	Bacteria	5422
339	Ga0495638_0017830	3300046460	Bacteria	4725
340	Ga0495641_0142080	3300046461	Bacteria	1072
341	Ga0495582_0098732	3300046473	Bacteria	1634
342	Ga0495639_0048277	3300046475	Bacteria	1930
343	Ga0495662_0140875	3300046476	Bacteria	1187
344	Ga0495606_0027733	3300046507	Bacteria	4009
345	Ga0495608_0271078	3300046511	Bacteria	1055
346	Ga0495630_0336482	3300046517	Bacteria	1155
347	Ga0495666_0044409	3300046526	Bacteria	2146
348	Ga0495645_0011604	3300046543	Bacteria	6205
349	Ga0495668_0294949	3300046616	Bacteria	889
350	Ga0495635_0211791	3300046663	Bacteria	1312
351	Ga0495624_0110327	3300046690	Bacteria	1692
352	Ga0495674_0196475	3300047319	Bacteria	1675
353	Ga0495672_0174774	3300047320	Bacteria	1092
354	Ga0495676_0068721	3300047321	Bacteria	2736
355	Ga0495686_0001660	3300047472	Bacteria	23180
356	Ga0495602_0207077	3300048088	Bacteria	1492
357	Ga0496100_0000084	3300048903	Bacteria	53649
358	Ga0496100_0001148	3300048903	Bacteria	12879
359	Ga0496100_0001530	3300048903	Bacteria	11346
360	Ga0496100_0058895	3300048903	Bacteria	2522
361	Ga0496100_0077155	3300048903	Bacteria	2239
362	Ga0496100_0125224	3300048903	Bacteria	1803
363	Ga0496100_0154376	3300048903	Bacteria	1640
364	Ga0496100_0281107	3300048903	Bacteria	1241
365	Ga0496101_0000100	3300048904	Bacteria	89811
366	Ga0496101_0000110	3300048904	Bacteria	85776
367	Ga0496101_0001605	3300048904	Bacteria	13597
368	Ga0496101_0007060	3300048904	Bacteria	7261
369	Ga0496101_0123677	3300048904	Bacteria	1958
370	Ga0496101_0320118	3300048904	Bacteria	1217
371	Ga0496102_0000006	3300048905	Bacteria	471494
372	Ga0496102_0001053	3300048905	Bacteria	25521
373	Ga0496102_0003241	3300048905	Bacteria	13802
374	Ga0496102_0008322	3300048905	Bacteria	8887
375	Ga0496102_0031183	3300048905	Bacteria	4780
376	Ga0496102_0054500	3300048905	Bacteria	3646
377	Ga0496102_0238279	3300048905	Bacteria	1716
378	Ga0496103_0000006	3300048906	Bacteria	470539
379	Ga0496103_0000400	3300048906	Bacteria	38628
380	Ga0496103_0000504	3300048906	Bacteria	32265
381	Ga0496103_0000700	3300048906	Bacteria	24863
382	Ga0496103_0019049	3300048906	Bacteria	4121
383	Ga0496103_0134697	3300048906	Bacteria	1578
384	Ga0496104_0021173	3300048907	Bacteria	5967
385	Ga0496104_0028678	3300048907	Bacteria	5159
386	Ga0496104_0075523	3300048907	Bacteria	3209
387	Ga0496104_0165194	3300048907	Bacteria	2123
388	Ga0496105_0017040	3300048908	Bacteria	5816
389	Ga0496105_0188078	3300048908	Bacteria	1689
390	Ga0496105_0322161	3300048908	Bacteria	1239
391	Ga0496106_0000164	3300048909	Bacteria	47996
392	Ga0496106_0011222	3300048909	Bacteria	6630
393	Ga0496106_0029818	3300048909	Bacteria	4067
394	Ga0496106_0074760	3300048909	Bacteria	2594
395	Ga0496107_0010183	3300048910	Bacteria	6522
396	Ga0496107_0053113	3300048910	Bacteria	2923
397	Ga0496107_0077210	3300048910	Bacteria	2426
398	Ga0496107_0238721	3300048910	Bacteria	1352
399	Ga0496108_0006114	3300048911	Bacteria	9741
400	Ga0496108_0016810	3300048911	Bacteria	5977
401	Ga0496108_0038048	3300048911	Bacteria	4008
402	Ga0496108_0189634	3300048911	Bacteria	1782
403	Ga0496109_0000356	3300048912	Bacteria	42608
404	Ga0496109_0002673	3300048912	Bacteria	14964
405	Ga0496109_0070109	3300048912	Bacteria	3216
406	Ga0496109_0078789	3300048912	Bacteria	3034
407	Ga0496109_0371886	3300048912	Bacteria	1350
408	Ga0496109_0446142	3300048912	Bacteria	1222
409	Ga0496110_0009262	3300048913	Bacteria	7960
410	Ga0496111_0045234	3300048914	Bacteria	3167
411	Ga0496112_0012895	3300048915	Bacteria	7697
412	Ga0496112_0063898	3300048915	Bacteria	3631
413	Ga0496113_0249855	3300048916	Bacteria	1416
414	Ga0496113_0494599	3300048916	Bacteria	982
415	Ga0496114_0000164	3300048917	Bacteria	47093
416	Ga0496114_0000522	3300048917	Bacteria	28253
417	Ga0496114_0013077	3300048917	Bacteria	6649
418	Ga0496114_0056611	3300048917	Bacteria	3273
419	Ga0496114_0148045	3300048917	Bacteria	2036
420	Ga0496115_0002348	3300048918	Bacteria	13572
421	Ga0496115_0014536	3300048918	Bacteria	5960
422	Ga0496115_0129879	3300048918	Bacteria	2076
423	Ga0496116_0000025	3300048919	Bacteria	470539
424	Ga0496116_0002215	3300048919	Bacteria	20684
425	Ga0496117_0000006	3300048920	Bacteria	758420
426	Ga0496117_0001137	3300048920	Bacteria	40112
427	Ga0496117_0042120	3300048920	Bacteria	3336
428	Ga0496118_0000004	3300048921	Bacteria	758420
429	Ga0496118_0001770	3300048921	Bacteria	31255
430	Ga0496119_0000035	3300048922	Bacteria	217007
431	Ga0496119_0004129	3300048922	Bacteria	14622
432	Ga0496119_0027109	3300048922	Bacteria	3950
433	Ga0496119_0053852	3300048922	Bacteria	2454
434	Ga0496119_0060289	3300048922	Bacteria	2273
435	Ga0496120_0000079	3300048923	Bacteria	160413
436	Ga0496120_0021588	3300048923	Bacteria	4067
437	Ga0496120_0077933	3300048923	Bacteria	1803
438	Ga0496121_0000004	3300048924	Bacteria	1139011
439	Ga0496121_0000090	3300048924	Bacteria	217920
440	Ga0496121_0000172	3300048924	Bacteria	143849
441	Ga0496121_0010052	3300048924	Bacteria	10737
442	Ga0496122_0000805	3300048925	Bacteria	60172
443	Ga0496123_0003575	3300048926	Bacteria	17241
444	Ga0496124_0000221	3300048927	Bacteria	110879
445	Ga0496125_0000003	3300048928	Bacteria	1189767
446	Ga0496125_0056347	3300048928	Bacteria	3192
447	Ga0496125_0076005	3300048928	Bacteria	2595
448	Ga0496125_0171220	3300048928	Bacteria	1459
449	Ga0496126_0000001	3300048929	Bacteria	1139011
450	Ga0496126_0000180	3300048929	Bacteria	142694
451	Ga0496126_0004091	3300048929	Bacteria	17671
452	Ga0496126_0006264	3300048929	Bacteria	13290
453	Ga0496126_0030158	3300048929	Bacteria	5142
454	Ga0501033_0022381	3300049570	Bacteria	4768
455	Ga0501033_0035503	3300049570	Bacteria	3738
456	Ga0501034_0026741	3300049571	Bacteria	5871
457	Ga0501036_0024129	3300049572	Bacteria	5127
458	Ga0501038_0075693	3300049574	Bacteria	2844
459	Ga0501039_0000929	3300049575	Bacteria	21375
460	Ga0501039_0055032	3300049575	Bacteria	3081
461	Ga0501043_0002664	3300049579	Bacteria	14997
462	Ga0501046_0006675	3300049580	Bacteria	10192
463	Ga0501047_0009645	3300049581	Bacteria	9125
464	Ga0501047_0322714	3300049581	Bacteria	1384
465	Ga0501048_0005296	3300049582	Bacteria	9825
466	Ga0501070_0025716	3300049586	Bacteria	4938
467	Ga0501070_0103101	3300049586	Bacteria	2359
468	Ga0501073_0049629	3300049589	Bacteria	2942
469	Ga0501073_0150544	3300049589	Bacteria	1613
470	Ga0501075_0107293	3300049591	Bacteria	2123
471	Ga0501079_0058162	3300049741	Bacteria	2983
472	Ga0501080_0083453	3300049742	Bacteria	2968
473	Ga0501080_0303899	3300049742	Bacteria	1446
474	Ga0501081_0028923	3300049743	Bacteria	3743
475	Ga0501035_0010269	3300049822	Bacteria	8686
476	Ga0501044_0018505	3300049823	Bacteria	7463
477	nmdc:mga03n38_43584_c1	3300050490	Bacteria	1967
478	nmdc:mga03n38_53666_c1	3300050490	Bacteria	1808
479	nmdc:mga03n38_60191_c1	3300050490	Bacteria	1726
480	nmdc:mga03n38_61461_c1	3300050490	Bacteria	1711
481	nmdc:mga03n38_82661_c1	3300050490	Bacteria	1512
482	nmdc:mga00v17_133045_c1	3300050491	Bacteria	1590
483	nmdc:mga00v17_331261_c1	3300050491	Bacteria	989
484	nmdc:mga00v17_38075_c1	3300050491	Bacteria	2874
485	nmdc:mga00v17_64182_c1	3300050491	Bacteria	2263
486	nmdc:mga0yw44_126100_c1	3300050492	Bacteria	1653
487	nmdc:mga0yw44_152941_c1	3300050492	Bacteria	1506
488	nmdc:mga0yw44_2784_c1	3300050492	Bacteria	7572
489	nmdc:mga07m45_210493_c1	3300050496	Bacteria	1131
490	nmdc:mga07m45_32818_c1	3300050496	Bacteria	2880
491	nmdc:mga05p37_142997_c1	3300050507	Bacteria	2930
492	nmdc:mga0qj67_77017_c1	3300050509	Bacteria	2668
493	nmdc:mga08y16_285981_c1	3300050511	Bacteria	1700
494	nmdc:mga08y16_326120_c1	3300050511	Bacteria	1580
495	nmdc:mga0n895_113382_c1	3300050512	Bacteria	2728
496	nmdc:mga0rr50_195971_c1	3300050513	Bacteria	1658
497	nmdc:mga08x19_94882_c1	3300050514	Bacteria	1973
498	nmdc:mga0sz30_2321_c1	3300050516	Bacteria	6793
499	nmdc:mga0sz30_50650_c1	3300050516	Bacteria	1760
500	nmdc:mga0sz30_64240_c1	3300050516	Bacteria	1572
501	Ga0500610_0034630	3300053079	Bacteria	2586
502	Ga0500635_0026764	3300053080	Bacteria	1828
503	Ga0495619_0083373	3300053085	Bacteria	2156
504	Ga0500643_003561	3300053087	Bacteria	7411
505	Ga0500641_0102452	3300053096	Bacteria	1228
506	Ga0500556_0002920	3300053104	Bacteria	5180
507	Ga0500562_013662	3300053108	Bacteria	2076
508	Ga0500595_075720	3300053119	Bacteria	992
509	Ga0500652_002083	3300053131	Bacteria	6013
510	Ga0500652_166275	3300053131	Bacteria	909
511	Ga0500616_0007285	3300053153	Bacteria	7057
512	Ga0500645_000490	3300053730	Bacteria	26762
513	Ga0500645_035419	3300053730	Bacteria	1487
514	Ga0501084_0113303	3300054114	Bacteria	2280
515	Ga0466962_0012658	3300061719	Bacteria	4059
516	Ga0466962_0146243	3300061719	Bacteria	1146
517	Ga0530510_0015859	3300061734	Bacteria	5327

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300044693	Ga0466961_0061691	Ga0466961_0061691_105_893	245
2	3300046616	Ga0495668_0294949	Ga0495668_0294949_12_752	245
3	3300049570	Ga0501033_0022381	Ga0501033_0022381_4014_4757	246
4	3300044765	Ga0466970_0141703	Ga0466970_0141703_129_1022	251
5	3300045836	Ga0466958_0080665	Ga0466958_0080665_126_1031	259
6	3300049741	Ga0501079_0058162	Ga0501079_0058162_2053_2913	261
7	3300025922	Ga0207646_10041901	Ga0207646_100419013	263
8	3300046543	Ga0495645_0011604	Ga0495645_0011604_2565_3497	263
9	3300005468	Ga0070707_100003125	Ga0070707_1000031258	268
10	3300025922	Ga0207646_10006984	Ga0207646_1000698411	268
11	3300026095	Ga0207676_10426590	Ga0207676_104265902	268
12	3300005937	Ga0081455_10048103	Ga0081455_100481032	269
13	3300044694	Ga0466963_0199824	Ga0466963_0199824_348_1253	272
14	3300006852	Ga0075433_10255974	Ga0075433_102559742	275
15	3300006914	Ga0075436_100087314	Ga0075436_1000873143	275
16	3300007076	Ga0075435_100133462	Ga0075435_1001334622	275
17	3300009147	Ga0114129_10212142	Ga0114129_102121424	275
18	3300044694	Ga0466963_0058225	Ga0466963_0058225_1372_2277	275
19	3300045976	Ga0466967_0081127	Ga0466967_0081127_1372_2244	275
20	iso_pu_bacteria	2917736166	2917744540	276
21	3300039437	Ga0436365_1443134	Ga0436365_1443134_1724_2641	277
22	iso_pu_bacteria	2899359706	2899361303	277
23	3300032126	Ga0307415_100131120	Ga0307415_1001311202	278
24	3300048906	Ga0496103_0134697	Ga0496103_0134697_257_1111	279
25	3300044719	Ga0466971_0012321	Ga0466971_0012321_1735_2637	280
26	3300044842	Ga0466957_0020307	Ga0466957_0020307_1299_2201	280
27	3300045836	Ga0466958_0019127	Ga0466958_0019127_579_1481	280
28	3300048929	Ga0496126_0006264	Ga0496126_0006264_1179_2024	280
29	3300006048	Ga0075363_100055659	Ga0075363_1000556592	281
30	3300006178	Ga0075367_10225707	Ga0075367_102257072	281
31	3300021384	Ga0213876_10005625	Ga0213876_100056253	281
32	3300039437	Ga0436365_0056280	Ga0436365_0056280_13102_14025	281
33	3300039453	Ga0436362_1156483	Ga0436362_1156483_165_1088	281
34	3300036647	Ga0316582_0116046	Ga0316582_0116046_798_1664	282
35	3300036712	Ga0316584_0017797	Ga0316584_0017797_3762_4628	282
36	iso_pu_bacteria	2808606982	2811848167	282
37	iso_pu_bacteria	2902810491	2902814898	282
38	3300031852	Ga0307410_10078120	Ga0307410_100781201	283
39	3300032126	Ga0307415_100339556	Ga0307415_1003395561	283
40	iso_pu_bacteria	2643221687	2644490707	283
41	iso_pu_bacteria	2738541274	2738706939	283
42	iso_pu_bacteria	2738543028	2739333644	283
43	iso_pu_bacteria	2842134933	2842139269	283
44	iso_pu_bacteria	2902799365	2902800575	283
45	iso_pu_bacteria	2902837492	2902838479	283
46	iso_pu_bacteria	2929212328	2929217423	283
47	iso_pu_bacteria	2939582691	2939584660	283
48	iso_pu_bacteria	2990088156	2990089908	283
49	3300009098	Ga0105245_10035982	Ga0105245_100359821	284
50	3300025901	Ga0207688_10158374	Ga0207688_101583742	284
51	3300037418	Ga0395900_0006721	Ga0395900_0006721_1608_2495	284
52	3300044683	Ga0466965_0149834	Ga0466965_0149834_286_1185	284
53	3300044842	Ga0466957_0152596	Ga0466957_0152596_286_1185	284
54	3300048908	Ga0496105_0322161	Ga0496105_0322161_188_1081	284
55	3300048911	Ga0496108_0016810	Ga0496108_0016810_4931_5824	284
56	3300048912	Ga0496109_0078789	Ga0496109_0078789_628_1521	284
57	3300048917	Ga0496114_0056611	Ga0496114_0056611_113_1006	284
58	3300061719	Ga0466962_0146243	Ga0466962_0146243_94_993	284
59	iso_pu_bacteria	2738541264	2738668355	284
60	iso_pu_bacteria	2738541356	2739147425	284
61	3300048912	Ga0496109_0371886	Ga0496109_0371886_152_1030	285
62	3300049591	Ga0501075_0107293	Ga0501075_0107293_17_949	285
63	3300050507	nmdc:mga05p37_142997_c1	nmdc:mga05p37_142997_c1_1320_2213	285
64	3300050511	nmdc:mga08y16_326120_c1	nmdc:mga08y16_326120_c1_286_1179	285
65	3300050513	nmdc:mga0rr50_195971_c1	nmdc:mga0rr50_195971_c1_689_1582	285
66	3300050514	nmdc:mga08x19_94882_c1	nmdc:mga08x19_94882_c1_251_1144	285
67	3300054114	Ga0501084_0113303	Ga0501084_0113303_592_1524	285
68	iso_pu_bacteria	2902792274	2902798708	285
69	3300005467	Ga0070706_100341411	Ga0070706_1003414112	286
70	3300005937	Ga0081455_10321411	Ga0081455_103214112	286
71	3300006028	Ga0070717_10283194	Ga0070717_102831942	286
72	3300006173	Ga0070716_100025451	Ga0070716_1000254513	286
73	3300009094	Ga0111539_10328257	Ga0111539_103282572	286
74	3300025910	Ga0207684_10007648	Ga0207684_100076482	286
75	3300030521	Ga0307511_10104160	Ga0307511_101041602	286
76	3300031731	Ga0307405_10040394	Ga0307405_100403944	286
77	3300041410	Ga0439461_0000950	Ga0439461_0000950_3383_4246	286
78	3300041411	Ga0439466_0010268	Ga0439466_0010268_1777_2640	286
79	3300042435	Ga0439434_0004459	Ga0439434_0004459_2198_3061	286
80	3300044658	Ga0466972_0019835	Ga0466972_0019835_1431_2294	286
81	3300044683	Ga0466965_0000697	Ga0466965_0000697_6813_7676	286
82	3300044684	Ga0466966_0156281	Ga0466966_0156281_33_968	286
83	3300044719	Ga0466971_0013054	Ga0466971_0013054_245_1108	286
84	3300044735	Ga0466968_0004379	Ga0466968_0004379_4249_5112	286
85	3300044765	Ga0466970_0106292	Ga0466970_0106292_118_990	286
86	3300044842	Ga0466957_0003667	Ga0466957_0003667_1505_2368	286
87	3300044842	Ga0466957_0051256	Ga0466957_0051256_608_1501	286
88	3300044901	Ga0466960_0002911	Ga0466960_0002911_1817_2680	286
89	3300045049	Ga0466959_0049823	Ga0466959_0049823_13_894	286
90	3300046455	Ga0495603_0023983	Ga0495603_0023983_2311_3240	286
91	3300046460	Ga0495638_0017830	Ga0495638_0017830_1234_2097	286
92	3300048088	Ga0495602_0207077	Ga0495602_0207077_326_1258	286
93	3300048907	Ga0496104_0021173	Ga0496104_0021173_4806_5732	286
94	3300048908	Ga0496105_0017040	Ga0496105_0017040_295_1221	286
95	3300048923	Ga0496120_0077933	Ga0496120_0077933_525_1388	286
96	3300048929	Ga0496126_0004091	Ga0496126_0004091_15443_16306	286
97	3300049571	Ga0501034_0026741	Ga0501034_0026741_3000_3863	286
98	3300049574	Ga0501038_0075693	Ga0501038_0075693_1881_2744	286
99	3300049575	Ga0501039_0000929	Ga0501039_0000929_15455_16318	286
100	3300049575	Ga0501039_0055032	Ga0501039_0055032_1603_2541	286
101	3300049579	Ga0501043_0002664	Ga0501043_0002664_10491_11354	286
102	3300049586	Ga0501070_0103101	Ga0501070_0103101_1126_1989	286
103	3300049589	Ga0501073_0049629	Ga0501073_0049629_776_1639	286
104	3300049743	Ga0501081_0028923	Ga0501081_0028923_891_1829	286
105	3300050511	nmdc:mga08y16_285981_c1	nmdc:mga08y16_285981_c1_422_1297	286
106	3300050512	nmdc:mga0n895_113382_c1	nmdc:mga0n895_113382_c1_427_1362	286
107	3300053079	Ga0500610_0034630	Ga0500610_0034630_1511_2374	286
108	3300053104	Ga0500556_0002920	Ga0500556_0002920_277_1140	286
109	3300061734	Ga0530510_0015859	Ga0530510_0015859_2476_3414	286
110	3300003790	Ga0055528_1023167	Ga0055528_10231672	287
111	3300003792	Ga0055540_1004226	Ga0055540_10042263	287
112	3300005353	Ga0070669_100020428	Ga0070669_1000204286	287
113	3300005367	Ga0070667_100000791	Ga0070667_10000079123	287
114	3300005439	Ga0070711_100271820	Ga0070711_1002718201	287
115	3300005539	Ga0068853_100023310	Ga0068853_1000233103	287
116	3300005617	Ga0068859_100077098	Ga0068859_1000770984	287
117	3300005841	Ga0068863_100001025	Ga0068863_10000102521	287
118	3300005842	Ga0068858_100016818	Ga0068858_1000168187	287
119	3300005843	Ga0068860_100000087	Ga0068860_10000008724	287
120	3300005844	Ga0068862_100000077	Ga0068862_10000007771	287
121	3300006038	Ga0075365_10066664	Ga0075365_100666642	287
122	3300006038	Ga0075365_10178984	Ga0075365_101789842	287
123	3300006051	Ga0075364_10111675	Ga0075364_101116752	287
124	3300006186	Ga0075369_10014594	Ga0075369_100145944	287
125	3300006931	Ga0097620_100077087	Ga0097620_1000770874	287
126	3300009101	Ga0105247_10000007	Ga0105247_10000007341	287
127	3300009101	Ga0105247_10000060	Ga0105247_1000006072	287
128	3300009148	Ga0105243_10333689	Ga0105243_103336892	287
129	3300009177	Ga0105248_10000050	Ga0105248_1000005019	287
130	3300009177	Ga0105248_10056751	Ga0105248_100567513	287
131	3300009551	Ga0105238_10676479	Ga0105238_106764791	287
132	3300009553	Ga0105249_10000042	Ga0105249_10000042134	287
133	3300013308	Ga0157375_10502654	Ga0157375_105026542	287
134	3300014968	Ga0157379_10052574	Ga0157379_100525743	287
135	3300021384	Ga0213876_10062567	Ga0213876_100625671	287
136	3300025273	Ga0209673_1013931	Ga0209673_10139314	287
137	3300025303	Ga0209051_1001345	Ga0209051_100134520	287
138	3300025303	Ga0209051_1003362	Ga0209051_10033626	287
139	3300025303	Ga0209051_1010755	Ga0209051_10107556	287
140	3300025303	Ga0209051_1024750	Ga0209051_10247501	287
141	3300025303	Ga0209051_1036090	Ga0209051_10360902	287
142	3300025900	Ga0207710_10000010	Ga0207710_1000001074	287
143	3300025900	Ga0207710_10000013	Ga0207710_10000013340	287
144	3300025915	Ga0207693_10192297	Ga0207693_101922971	287
145	3300025916	Ga0207663_10254197	Ga0207663_102541972	287
146	3300025923	Ga0207681_10001782	Ga0207681_1000178212	287
147	3300025923	Ga0207681_10002155	Ga0207681_100021552	287
148	3300025924	Ga0207694_10477201	Ga0207694_104772011	287
149	3300025935	Ga0207709_10486915	Ga0207709_104869151	287
150	3300025937	Ga0207669_10021180	Ga0207669_100211804	287
151	3300025941	Ga0207711_10001406	Ga0207711_1000140617	287
152	3300025941	Ga0207711_10033441	Ga0207711_100334414	287
153	3300025961	Ga0207712_10000010	Ga0207712_10000010317	287
154	3300025986	Ga0207658_10000677	Ga0207658_1000067723	287
155	3300026035	Ga0207703_10009823	Ga0207703_100098238	287
156	3300026041	Ga0207639_10016712	Ga0207639_100167123	287
157	3300026088	Ga0207641_10000849	Ga0207641_100008497	287
158	3300028379	Ga0268266_10030548	Ga0268266_100305486	287
159	3300028379	Ga0268266_10238385	Ga0268266_102383852	287
160	3300028380	Ga0268265_10000014	Ga0268265_10000014136	287
161	3300028381	Ga0268264_10000150	Ga0268264_1000015023	287
162	3300039437	Ga0436365_0052028	Ga0436365_0052028_1049_1915	287
163	3300041452	Ga0451793_1722364	Ga0451793_1722364_1383_2249	287
164	3300041509	Ga0451843_1031485	Ga0451843_1031485_331_1197	287
165	3300044684	Ga0466966_0120765	Ga0466966_0120765_343_1275	287
166	3300044735	Ga0466968_0010033	Ga0466968_0010033_329_1261	287
167	3300046455	Ga0495603_0093866	Ga0495603_0093866_82_948	287
168	3300046459	Ga0495629_0050017	Ga0495629_0050017_2021_2887	287
169	3300046460	Ga0495638_0014063	Ga0495638_0014063_145_1011	287
170	3300046461	Ga0495641_0142080	Ga0495641_0142080_134_1000	287
171	3300046473	Ga0495582_0098732	Ga0495582_0098732_148_1014	287
172	3300046475	Ga0495639_0048277	Ga0495639_0048277_803_1669	287
173	3300046476	Ga0495662_0140875	Ga0495662_0140875_77_943	287
174	3300046511	Ga0495608_0271078	Ga0495608_0271078_139_1005	287
175	3300046517	Ga0495630_0336482	Ga0495630_0336482_101_967	287
176	3300046526	Ga0495666_0044409	Ga0495666_0044409_427_1293	287
177	3300046663	Ga0495635_0211791	Ga0495635_0211791_202_1068	287
178	3300046690	Ga0495624_0110327	Ga0495624_0110327_189_1055	287
179	3300047319	Ga0495674_0196475	Ga0495674_0196475_721_1587	287
180	3300047321	Ga0495676_0068721	Ga0495676_0068721_1377_2243	287
181	3300047472	Ga0495686_0001660	Ga0495686_0001660_22215_23081	287
182	3300048903	Ga0496100_0077155	Ga0496100_0077155_199_1065	287
183	3300048903	Ga0496100_0154376	Ga0496100_0154376_222_1088	287
184	3300048904	Ga0496101_0001605	Ga0496101_0001605_8816_9682	287
185	3300048904	Ga0496101_0007060	Ga0496101_0007060_1807_2673	287
186	3300048905	Ga0496102_0001053	Ga0496102_0001053_21119_21985	287
187	3300048906	Ga0496103_0000504	Ga0496103_0000504_31226_32092	287
188	3300048907	Ga0496104_0028678	Ga0496104_0028678_929_1795	287
189	3300048908	Ga0496105_0188078	Ga0496105_0188078_697_1563	287
190	3300048909	Ga0496106_0011222	Ga0496106_0011222_3485_4351	287
191	3300048910	Ga0496107_0077210	Ga0496107_0077210_1451_2317	287
192	3300048912	Ga0496109_0446142	Ga0496109_0446142_10_876	287
193	3300048916	Ga0496113_0249855	Ga0496113_0249855_521_1387	287
194	3300048917	Ga0496114_0013077	Ga0496114_0013077_3450_4316	287
195	3300048918	Ga0496115_0014536	Ga0496115_0014536_562_1428	287
196	3300048920	Ga0496117_0001137	Ga0496117_0001137_16256_17122	287
197	3300048921	Ga0496118_0001770	Ga0496118_0001770_25814_26680	287
198	3300048922	Ga0496119_0027109	Ga0496119_0027109_2472_3341	287
199	3300048922	Ga0496119_0053852	Ga0496119_0053852_120_986	287
200	3300048922	Ga0496119_0060289	Ga0496119_0060289_529_1395	287
201	3300048923	Ga0496120_0021588	Ga0496120_0021588_1448_2314	287
202	3300048924	Ga0496121_0000172	Ga0496121_0000172_94190_95059	287
203	3300048924	Ga0496121_0010052	Ga0496121_0010052_149_1015	287
204	3300048928	Ga0496125_0056347	Ga0496125_0056347_567_1436	287
205	3300048928	Ga0496125_0076005	Ga0496125_0076005_921_1787	287
206	3300048928	Ga0496125_0171220	Ga0496125_0171220_328_1197	287
207	3300048929	Ga0496126_0000180	Ga0496126_0000180_93038_93907	287
208	3300050492	nmdc:mga0yw44_126100_c1	nmdc:mga0yw44_126100_c1_133_999	287
209	3300050492	nmdc:mga0yw44_152941_c1	nmdc:mga0yw44_152941_c1_367_1233	287
210	3300050516	nmdc:mga0sz30_64240_c1	nmdc:mga0sz30_64240_c1_94_960	287
211	3300053080	Ga0500635_0026764	Ga0500635_0026764_309_1175	287
212	3300053085	Ga0495619_0083373	Ga0495619_0083373_151_1017	287
213	3300053096	Ga0500641_0102452	Ga0500641_0102452_64_930	287
214	3300053119	Ga0500595_075720	Ga0500595_075720_80_946	287
215	3300053131	Ga0500652_166275	Ga0500652_166275_11_877	287
216	3300053153	Ga0500616_0007285	Ga0500616_0007285_3645_4511	287
217	3300053730	Ga0500645_000490	Ga0500645_000490_18338_19204	287
218	3300053730	Ga0500645_035419	Ga0500645_035419_150_1016	287
219	3300003792	Ga0055540_1000043	Ga0055540_100004317	288
220	3300005335	Ga0070666_10093788	Ga0070666_100937883	288
221	3300005337	Ga0070682_100003080	Ga0070682_1000030804	288
222	3300005367	Ga0070667_100013973	Ga0070667_1000139736	288
223	3300005535	Ga0070684_100097128	Ga0070684_1000971282	288
224	3300005564	Ga0070664_100230222	Ga0070664_1002302222	288
225	3300006038	Ga0075365_10021990	Ga0075365_100219902	288
226	3300006048	Ga0075363_100008437	Ga0075363_1000084373	288
227	3300006048	Ga0075363_100047538	Ga0075363_1000475382	288
228	3300006048	Ga0075363_100050105	Ga0075363_1000501053	288
229	3300006051	Ga0075364_10050924	Ga0075364_100509242	288
230	3300006051	Ga0075364_10205962	Ga0075364_102059622	288
231	3300006177	Ga0075362_10049670	Ga0075362_100496702	288
232	3300006186	Ga0075369_10057821	Ga0075369_100578211	288
233	3300006353	Ga0075370_10053304	Ga0075370_100533043	288
234	3300006353	Ga0075370_10055517	Ga0075370_100555171	288
235	3300009545	Ga0105237_10027144	Ga0105237_100271445	288
236	3300010375	Ga0105239_10024596	Ga0105239_100245964	288
237	3300025303	Ga0209051_1000108	Ga0209051_1000108145	288
238	3300025972	Ga0207668_10002892	Ga0207668_100028926	288
239	3300025986	Ga0207658_10001961	Ga0207658_100019615	288
240	3300031251	Ga0265327_10002508	Ga0265327_100025086	288
241	3300031824	Ga0307413_10213759	Ga0307413_102137592	288
242	3300031903	Ga0307407_10024118	Ga0307407_100241183	288
243	3300031911	Ga0307412_10221481	Ga0307412_102214812	288
244	3300031995	Ga0307409_100004098	Ga0307409_1000040983	288
245	3300031995	Ga0307409_100039873	Ga0307409_1000398734	288
246	3300032005	Ga0307411_10092790	Ga0307411_100927902	288
247	3300032126	Ga0307415_100077296	Ga0307415_1000772963	288
248	3300037853	Ga0436364_1308388	Ga0436364_1308388_17236_18105	288
249	3300041411	Ga0439466_0009584	Ga0439466_0009584_2120_2989	288
250	3300041413	Ga0439465_0002904	Ga0439465_0002904_4005_4874	288
251	3300041997	Ga0439431_0041265	Ga0439431_0041265_141_1010	288
252	3300044656	Ga0466969_0056737	Ga0466969_0056737_20_889	288
253	3300044658	Ga0466972_0008599	Ga0466972_0008599_1333_2202	288
254	3300044658	Ga0466972_0031739	Ga0466972_0031739_208_1080	288
255	3300044683	Ga0466965_0002661	Ga0466965_0002661_1408_2280	288
256	3300044683	Ga0466965_0010937	Ga0466965_0010937_1377_2246	288
257	3300044683	Ga0466965_0047754	Ga0466965_0047754_378_1247	288
258	3300044693	Ga0466961_0126180	Ga0466961_0126180_607_1476	288
259	3300044719	Ga0466971_0079129	Ga0466971_0079129_469_1338	288
260	3300044719	Ga0466971_0104012	Ga0466971_0104012_312_1181	288
261	3300044842	Ga0466957_0175988	Ga0466957_0175988_215_1084	288
262	3300044901	Ga0466960_0000225	Ga0466960_0000225_14027_14896	288
263	3300044901	Ga0466960_0000319	Ga0466960_0000319_1434_2306	288
264	3300045049	Ga0466959_0046101	Ga0466959_0046101_205_1074	288
265	3300045836	Ga0466958_0088296	Ga0466958_0088296_914_1783	288
266	3300045976	Ga0466967_0001792	Ga0466967_0001792_3905_4774	288
267	3300048903	Ga0496100_0000084	Ga0496100_0000084_21917_22786	288
268	3300048903	Ga0496100_0281107	Ga0496100_0281107_309_1178	288
269	3300048904	Ga0496101_0000100	Ga0496101_0000100_12827_13696	288
270	3300048905	Ga0496102_0008322	Ga0496102_0008322_4530_5399	288
271	3300048905	Ga0496102_0031183	Ga0496102_0031183_3527_4396	288
272	3300048905	Ga0496102_0238279	Ga0496102_0238279_286_1341	288
273	3300048906	Ga0496103_0000700	Ga0496103_0000700_11625_12494	288
274	3300048907	Ga0496104_0165194	Ga0496104_0165194_338_1210	288
275	3300048909	Ga0496106_0000164	Ga0496106_0000164_14889_15758	288
276	3300048909	Ga0496106_0029818	Ga0496106_0029818_1923_2795	288
277	3300048910	Ga0496107_0238721	Ga0496107_0238721_145_1014	288
278	3300048911	Ga0496108_0006114	Ga0496108_0006114_7690_8559	288
279	3300048911	Ga0496108_0189634	Ga0496108_0189634_834_1700	288
280	3300048912	Ga0496109_0000356	Ga0496109_0000356_21912_22781	288
281	3300048912	Ga0496109_0070109	Ga0496109_0070109_1731_2600	288
282	3300048913	Ga0496110_0009262	Ga0496110_0009262_3471_4340	288
283	3300048914	Ga0496111_0045234	Ga0496111_0045234_825_1694	288
284	3300048915	Ga0496112_0063898	Ga0496112_0063898_348_1217	288
285	3300048916	Ga0496113_0494599	Ga0496113_0494599_20_889	288
286	3300048917	Ga0496114_0000164	Ga0496114_0000164_19406_20275	288
287	3300048918	Ga0496115_0129879	Ga0496115_0129879_46_915	288
288	3300048919	Ga0496116_0002215	Ga0496116_0002215_17439_18308	288
289	3300048920	Ga0496117_0042120	Ga0496117_0042120_91_960	288
290	3300048922	Ga0496119_0004129	Ga0496119_0004129_10043_10912	288
291	3300048924	Ga0496121_0000004	Ga0496121_0000004_240514_241383	288
292	3300048925	Ga0496122_0000805	Ga0496122_0000805_26153_27022	288
293	3300048926	Ga0496123_0003575	Ga0496123_0003575_6856_7725	288
294	3300048927	Ga0496124_0000221	Ga0496124_0000221_76127_76996	288
295	3300048928	Ga0496125_0000003	Ga0496125_0000003_948385_949254	288
296	3300048929	Ga0496126_0000001	Ga0496126_0000001_240514_241383	288
297	3300049570	Ga0501033_0035503	Ga0501033_0035503_1773_2642	288
298	3300049572	Ga0501036_0024129	Ga0501036_0024129_2261_3130	288
299	3300049580	Ga0501046_0006675	Ga0501046_0006675_5322_6191	288
300	3300049581	Ga0501047_0009645	Ga0501047_0009645_5321_6190	288
301	3300049582	Ga0501048_0005296	Ga0501048_0005296_8340_9209	288
302	3300049586	Ga0501070_0025716	Ga0501070_0025716_1134_2003	288
303	3300049589	Ga0501073_0150544	Ga0501073_0150544_368_1258	288
304	3300049742	Ga0501080_0083453	Ga0501080_0083453_161_1030	288
305	3300049742	Ga0501080_0303899	Ga0501080_0303899_231_1121	288
306	3300049822	Ga0501035_0010269	Ga0501035_0010269_1196_2065	288
307	3300049823	Ga0501044_0018505	Ga0501044_0018505_5771_6640	288
308	3300050490	nmdc:mga03n38_43584_c1	nmdc:mga03n38_43584_c1_914_1783	288
309	3300050490	nmdc:mga03n38_53666_c1	nmdc:mga03n38_53666_c1_660_1526	288
310	3300050490	nmdc:mga03n38_60191_c1	nmdc:mga03n38_60191_c1_152_1021	288
311	3300050490	nmdc:mga03n38_61461_c1	nmdc:mga03n38_61461_c1_809_1678	288
312	3300050491	nmdc:mga00v17_133045_c1	nmdc:mga00v17_133045_c1_275_1156	288
313	3300050491	nmdc:mga00v17_331261_c1	nmdc:mga00v17_331261_c1_39_920	288
314	3300050491	nmdc:mga00v17_38075_c1	nmdc:mga00v17_38075_c1_448_1317	288
315	3300050491	nmdc:mga00v17_64182_c1	nmdc:mga00v17_64182_c1_550_1419	288
316	3300050496	nmdc:mga07m45_32818_c1	nmdc:mga07m45_32818_c1_325_1194	288
317	3300050516	nmdc:mga0sz30_50650_c1	nmdc:mga0sz30_50650_c1_282_1151	288
318	3300053108	Ga0500562_013662	Ga0500562_013662_741_1610	288
319	3300053131	Ga0500652_002083	Ga0500652_002083_67_936	288
320	3300061719	Ga0466962_0012658	Ga0466962_0012658_2443_3312	288
321	3300002073	JGI24745J21846_1000885	JGI24745J21846_10008854	289
322	3300002077	JGI24744J21845_10002910	JGI24744J21845_100029104	289
323	3300002244	JGI24742J22300_10002859	JGI24742J22300_100028593	289
324	3300005330	Ga0070690_100223356	Ga0070690_1002233562	289
325	3300005334	Ga0068869_100019489	Ga0068869_1000194892	289
326	3300005335	Ga0070666_10123147	Ga0070666_101231472	289
327	3300005338	Ga0068868_100001163	Ga0068868_1000011639	289
328	3300005338	Ga0068868_100162543	Ga0068868_1001625432	289
329	3300005341	Ga0070691_10010543	Ga0070691_100105435	289
330	3300005343	Ga0070687_100044972	Ga0070687_1000449722	289
331	3300005347	Ga0070668_100001540	Ga0070668_1000015408	289
332	3300005347	Ga0070668_100162205	Ga0070668_1001622052	289
333	3300005353	Ga0070669_100018910	Ga0070669_1000189105	289
334	3300005355	Ga0070671_100043005	Ga0070671_1000430054	289
335	3300005355	Ga0070671_100227223	Ga0070671_1002272232	289
336	3300005364	Ga0070673_100071196	Ga0070673_1000711962	289
337	3300005366	Ga0070659_100206786	Ga0070659_1002067862	289
338	3300005367	Ga0070667_100013169	Ga0070667_1000131697	289
339	3300005367	Ga0070667_100027611	Ga0070667_1000276115	289
340	3300005434	Ga0070709_10012808	Ga0070709_100128082	289
341	3300005435	Ga0070714_100512386	Ga0070714_1005123861	289
342	3300005437	Ga0070710_10000690	Ga0070710_100006905	289
343	3300005437	Ga0070710_10003060	Ga0070710_100030608	289
344	3300005439	Ga0070711_100000160	Ga0070711_10000016026	289
345	3300005439	Ga0070711_100007595	Ga0070711_1000075954	289
346	3300005440	Ga0070705_100149966	Ga0070705_1001499662	289
347	3300005444	Ga0070694_100061108	Ga0070694_1000611083	289
348	3300005455	Ga0070663_100032577	Ga0070663_1000325775	289
349	3300005456	Ga0070678_100000117	Ga0070678_10000011730	289
350	3300005457	Ga0070662_100016792	Ga0070662_1000167921	289
351	3300005459	Ga0068867_100004067	Ga0068867_1000040678	289
352	3300005459	Ga0068867_100028527	Ga0068867_1000285276	289
353	3300005539	Ga0068853_100023917	Ga0068853_1000239176	289
354	3300005543	Ga0070672_100067944	Ga0070672_1000679444	289
355	3300005544	Ga0070686_100065306	Ga0070686_1000653063	289
356	3300005544	Ga0070686_100097616	Ga0070686_1000976162	289
357	3300005545	Ga0070695_100103507	Ga0070695_1001035072	289
358	3300005546	Ga0070696_100010017	Ga0070696_1000100175	289
359	3300005547	Ga0070693_100070126	Ga0070693_1000701263	289
360	3300005548	Ga0070665_100006373	Ga0070665_10000637315	289
361	3300005548	Ga0070665_100009409	Ga0070665_1000094099	289
362	3300005548	Ga0070665_100029759	Ga0070665_1000297595	289
363	3300005563	Ga0068855_100263352	Ga0068855_1002633522	289
364	3300005578	Ga0068854_100009069	Ga0068854_1000090694	289
365	3300005578	Ga0068854_100277711	Ga0068854_1002777112	289
366	3300005617	Ga0068859_100001042	Ga0068859_10000104216	289
367	3300005618	Ga0068864_100534163	Ga0068864_1005341632	289
368	3300005718	Ga0068866_10000441	Ga0068866_100004418	289
369	3300005718	Ga0068866_10043910	Ga0068866_100439102	289
370	3300005719	Ga0068861_100003820	Ga0068861_1000038209	289
371	3300005841	Ga0068863_100012259	Ga0068863_1000122599	289
372	3300005841	Ga0068863_100089781	Ga0068863_1000897812	289
373	3300005842	Ga0068858_100004832	Ga0068858_10000483211	289
374	3300005842	Ga0068858_100014666	Ga0068858_1000146663	289
375	3300005843	Ga0068860_100008728	Ga0068860_1000087289	289
376	3300005844	Ga0068862_100022465	Ga0068862_1000224651	289
377	3300005844	Ga0068862_100281044	Ga0068862_1002810442	289
378	3300005937	Ga0081455_10050617	Ga0081455_100506172	289
379	3300006038	Ga0075365_10008384	Ga0075365_100083846	289
380	3300006051	Ga0075364_10073962	Ga0075364_100739622	289
381	3300006173	Ga0070716_100009944	Ga0070716_1000099444	289
382	3300006175	Ga0070712_100000846	Ga0070712_1000008462	289
383	3300006175	Ga0070712_100002348	Ga0070712_1000023488	289
384	3300006177	Ga0075362_10120917	Ga0075362_101209171	289
385	3300006186	Ga0075369_10004544	Ga0075369_100045444	289
386	3300006186	Ga0075369_10006368	Ga0075369_100063684	289
387	3300006186	Ga0075369_10144026	Ga0075369_101440261	289
388	3300006237	Ga0097621_100150291	Ga0097621_1001502911	289
389	3300006353	Ga0075370_10069734	Ga0075370_100697342	289
390	3300006358	Ga0068871_100048970	Ga0068871_1000489704	289
391	3300006844	Ga0075428_100071233	Ga0075428_1000712331	289
392	3300006881	Ga0068865_100401689	Ga0068865_1004016891	289
393	3300006931	Ga0097620_100001042	Ga0097620_10000104216	289
394	3300009092	Ga0105250_10037242	Ga0105250_100372422	289
395	3300009094	Ga0111539_10916898	Ga0111539_109168981	289
396	3300009098	Ga0105245_10008338	Ga0105245_100083388	289
397	3300009098	Ga0105245_10059620	Ga0105245_100596203	289
398	3300009101	Ga0105247_10000298	Ga0105247_1000029825	289
399	3300009147	Ga0114129_10424682	Ga0114129_104246821	289
400	3300009148	Ga0105243_10000700	Ga0105243_1000070011	289
401	3300009148	Ga0105243_10045903	Ga0105243_100459032	289
402	3300009176	Ga0105242_10001954	Ga0105242_100019542	289
403	3300009176	Ga0105242_10242373	Ga0105242_102423732	289
404	3300009177	Ga0105248_10003516	Ga0105248_100035162	289
405	3300009177	Ga0105248_10145708	Ga0105248_101457084	289
406	3300009545	Ga0105237_10006011	Ga0105237_1000601110	289
407	3300009545	Ga0105237_10011826	Ga0105237_100118265	289
408	3300009553	Ga0105249_10000470	Ga0105249_1000047014	289
409	3300009553	Ga0105249_10052537	Ga0105249_100525374	289
410	3300010375	Ga0105239_10016841	Ga0105239_100168416	289
411	3300010375	Ga0105239_10082818	Ga0105239_100828184	289
412	3300013105	Ga0157369_10448544	Ga0157369_104485442	289
413	3300013296	Ga0157374_10032490	Ga0157374_100324904	289
414	3300013297	Ga0157378_10292006	Ga0157378_102920062	289
415	3300013307	Ga0157372_10048234	Ga0157372_100482344	289
416	3300013308	Ga0157375_10078003	Ga0157375_100780033	289
417	3300013308	Ga0157375_10317825	Ga0157375_103178252	289
418	3300014325	Ga0163163_10094418	Ga0163163_100944182	289
419	3300014326	Ga0157380_10010166	Ga0157380_100101669	289
420	3300014745	Ga0157377_10180592	Ga0157377_101805921	289
421	3300014968	Ga0157379_10002499	Ga0157379_1000249918	289
422	3300014968	Ga0157379_10061838	Ga0157379_100618382	289
423	3300014969	Ga0157376_10161575	Ga0157376_101615752	289
424	3300017792	Ga0163161_10027061	Ga0163161_100270611	289
425	3300017792	Ga0163161_10041561	Ga0163161_100415612	289
426	3300025898	Ga0207692_10007732	Ga0207692_100077323	289
427	3300025899	Ga0207642_10036329	Ga0207642_100363292	289
428	3300025901	Ga0207688_10021558	Ga0207688_100215582	289
429	3300025903	Ga0207680_10014842	Ga0207680_100148425	289
430	3300025904	Ga0207647_10013370	Ga0207647_100133704	289
431	3300025904	Ga0207647_10102217	Ga0207647_101022172	289
432	3300025905	Ga0207685_10014881	Ga0207685_100148812	289
433	3300025906	Ga0207699_10005382	Ga0207699_100053826	289
434	3300025906	Ga0207699_10142454	Ga0207699_101424542	289
435	3300025907	Ga0207645_10070834	Ga0207645_100708342	289
436	3300025911	Ga0207654_10169896	Ga0207654_101698961	289
437	3300025911	Ga0207654_10232315	Ga0207654_102323152	289
438	3300025914	Ga0207671_10007606	Ga0207671_100076069	289
439	3300025914	Ga0207671_10074011	Ga0207671_100740111	289
440	3300025914	Ga0207671_10234914	Ga0207671_102349141	289
441	3300025915	Ga0207693_10000754	Ga0207693_1000075425	289
442	3300025915	Ga0207693_10003890	Ga0207693_1000389010	289
443	3300025916	Ga0207663_10004087	Ga0207663_100040875	289
444	3300025918	Ga0207662_10020192	Ga0207662_100201922	289
445	3300025923	Ga0207681_10025217	Ga0207681_100252175	289
446	3300025927	Ga0207687_10016666	Ga0207687_100166665	289
447	3300025931	Ga0207644_10026466	Ga0207644_100264662	289
448	3300025932	Ga0207690_10052045	Ga0207690_100520453	289
449	3300025932	Ga0207690_10221592	Ga0207690_102215922	289
450	3300025933	Ga0207706_10019289	Ga0207706_100192896	289
451	3300025933	Ga0207706_10021979	Ga0207706_100219791	289
452	3300025934	Ga0207686_10002494	Ga0207686_100024949	289
453	3300025935	Ga0207709_10007107	Ga0207709_100071074	289
454	3300025935	Ga0207709_10246775	Ga0207709_102467751	289
455	3300025937	Ga0207669_10001189	Ga0207669_100011891	289
456	3300025938	Ga0207704_10083181	Ga0207704_100831812	289
457	3300025939	Ga0207665_10009094	Ga0207665_100090944	289
458	3300025940	Ga0207691_10055981	Ga0207691_100559814	289
459	3300025941	Ga0207711_10032792	Ga0207711_100327922	289
460	3300025941	Ga0207711_10320052	Ga0207711_103200521	289
461	3300025960	Ga0207651_10062166	Ga0207651_100621662	289
462	3300025961	Ga0207712_10001196	Ga0207712_1000119618	289
463	3300025981	Ga0207640_10009045	Ga0207640_100090456	289
464	3300025986	Ga0207658_10061168	Ga0207658_100611682	289
465	3300026035	Ga0207703_10028562	Ga0207703_100285622	289
466	3300026035	Ga0207703_10074184	Ga0207703_100741843	289
467	3300026035	Ga0207703_10549154	Ga0207703_105491541	289
468	3300026041	Ga0207639_10007030	Ga0207639_100070307	289
469	3300026067	Ga0207678_10009360	Ga0207678_100093609	289
470	3300026067	Ga0207678_10016046	Ga0207678_100160466	289
471	3300026075	Ga0207708_10016479	Ga0207708_100164795	289
472	3300026088	Ga0207641_10005077	Ga0207641_1000507711	289
473	3300026088	Ga0207641_10026225	Ga0207641_100262253	289
474	3300026089	Ga0207648_10014199	Ga0207648_100141992	289
475	3300026089	Ga0207648_10114857	Ga0207648_101148573	289
476	3300026118	Ga0207675_100007850	Ga0207675_1000078506	289
477	3300026118	Ga0207675_100063261	Ga0207675_1000632614	289
478	3300026121	Ga0207683_10000984	Ga0207683_100009846	289
479	3300026121	Ga0207683_10058440	Ga0207683_100584402	289
480	3300026142	Ga0207698_10250822	Ga0207698_102508222	289
481	3300028379	Ga0268266_10139805	Ga0268266_101398052	289
482	3300028380	Ga0268265_10128264	Ga0268265_101282642	289
483	3300028381	Ga0268264_10027397	Ga0268264_100273972	289
484	3300035114	Ga0373939_0005374	Ga0373939_0005374_1324_2226	289
485	3300041410	Ga0439461_0008037	Ga0439461_0008037_279_1148	289
486	3300041411	Ga0439466_0023180	Ga0439466_0023180_29_898	289
487	3300041413	Ga0439465_0002866	Ga0439465_0002866_3428_4300	289
488	3300041413	Ga0439465_0054227	Ga0439465_0054227_218_1087	289
489	3300041997	Ga0439431_0008285	Ga0439431_0008285_231_1100	289
490	3300042004	Ga0439445_0018743	Ga0439445_0018743_775_1644	289
491	3300042435	Ga0439434_0030735	Ga0439434_0030735_143_1012	289
492	3300044901	Ga0466960_0050599	Ga0466960_0050599_106_975	289
493	3300045976	Ga0466967_0165525	Ga0466967_0165525_565_1434	289
494	3300045976	Ga0466967_0285203	Ga0466967_0285203_198_1067	289
495	3300046507	Ga0495606_0027733	Ga0495606_0027733_846_1715	289
496	3300047320	Ga0495672_0174774	Ga0495672_0174774_173_1045	289
497	3300048903	Ga0496100_0001148	Ga0496100_0001148_9958_10827	289
498	3300048903	Ga0496100_0001530	Ga0496100_0001530_4339_5208	289
499	3300048903	Ga0496100_0058895	Ga0496100_0058895_38_940	289
500	3300048903	Ga0496100_0125224	Ga0496100_0125224_787_1656	289
501	3300048904	Ga0496101_0000110	Ga0496101_0000110_16786_17655	289
502	3300048904	Ga0496101_0123677	Ga0496101_0123677_940_1842	289
503	3300048904	Ga0496101_0320118	Ga0496101_0320118_316_1185	289
504	3300048905	Ga0496102_0000006	Ga0496102_0000006_318554_319423	289
505	3300048905	Ga0496102_0003241	Ga0496102_0003241_1123_1992	289
506	3300048905	Ga0496102_0054500	Ga0496102_0054500_144_1046	289
507	3300048906	Ga0496103_0000006	Ga0496103_0000006_318352_319221	289
508	3300048906	Ga0496103_0000400	Ga0496103_0000400_36973_37842	289
509	3300048906	Ga0496103_0019049	Ga0496103_0019049_2402_3304	289
510	3300048907	Ga0496104_0075523	Ga0496104_0075523_127_996	289
511	3300048909	Ga0496106_0074760	Ga0496106_0074760_997_1866	289
512	3300048910	Ga0496107_0010183	Ga0496107_0010183_1079_1981	289
513	3300048910	Ga0496107_0053113	Ga0496107_0053113_1295_2164	289
514	3300048911	Ga0496108_0038048	Ga0496108_0038048_658_1527	289
515	3300048912	Ga0496109_0002673	Ga0496109_0002673_8984_9853	289
516	3300048915	Ga0496112_0012895	Ga0496112_0012895_1634_2503	289
517	3300048917	Ga0496114_0000522	Ga0496114_0000522_18769_19638	289
518	3300048917	Ga0496114_0148045	Ga0496114_0148045_861_1763	289
519	3300048918	Ga0496115_0002348	Ga0496115_0002348_1437_2306	289
520	3300048919	Ga0496116_0000025	Ga0496116_0000025_151319_152188	289
521	3300048920	Ga0496117_0000006	Ga0496117_0000006_151319_152188	289
522	3300048921	Ga0496118_0000004	Ga0496118_0000004_151319_152188	289
523	3300048922	Ga0496119_0000035	Ga0496119_0000035_68199_69068	289
524	3300048923	Ga0496120_0000079	Ga0496120_0000079_26695_27564	289
525	3300048924	Ga0496121_0000090	Ga0496121_0000090_99109_99978	289
526	3300048929	Ga0496126_0030158	Ga0496126_0030158_1357_2226	289
527	3300049581	Ga0501047_0322714	Ga0501047_0322714_321_1193	289
528	3300050490	nmdc:mga03n38_82661_c1	nmdc:mga03n38_82661_c1_478_1347	289
529	3300050492	nmdc:mga0yw44_2784_c1	nmdc:mga0yw44_2784_c1_4396_5274	289
530	3300050496	nmdc:mga07m45_210493_c1	nmdc:mga07m45_210493_c1_123_992	289
531	3300050509	nmdc:mga0qj67_77017_c1	nmdc:mga0qj67_77017_c1_1597_2466	289
532	3300050516	nmdc:mga0sz30_2321_c1	nmdc:mga0sz30_2321_c1_2755_3633	289
533	3300053087	Ga0500643_003561	Ga0500643_003561_2576_3445	289

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08659

KR

KR domain

77

211

0.89 PF00106

adh_short

short chain dehydrogenase

77

273

0.85 PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

83

216

0.84 PF01370

Epimerase

NAD dependent epimerase/dehydratase family

79

246

0.83 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3rd5-assembly1.cif.gz_A	crystal structure of a putative uncharacterized protein from mycobacterium paratuberculosis	0.9801	2	289
3rd5-assembly1.cif.gz_A	crystal structure of a putative uncharacterized protein from mycobacterium paratuberculosis	0.9765	2	289
6l1h-assembly1.cif.gz_A	crystal structure of light-dependent protochlorophyllide oxidoreductase from thermosynechococcus elongatus	0.8525	15	284
6l1h-assembly2.cif.gz_B	crystal structure of light-dependent protochlorophyllide oxidoreductase from thermosynechococcus elongatus	0.8311	15	284
6r48-assembly2.cif.gz_B	crystal structure of lpor (synechocystis) complexed with nadph at 1.87a resolution.	0.8242	15	284

ID	Description	Score	Start	End	Superfamily
3rd5A00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9801	2	289	3.40.50.720
3rd5A00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9765	2	289	3.40.50.720
af_O53726_7_311_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.966	1	289	3.40.50.720
af_O53726_7_311_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9627	1	289	3.40.50.720
af_A0A368UI72_22_109_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9462	6	80	3.40.50.720

ID	Description	Score	Start	End	GO Terms
AF-X8C4F2-F1-model_v4	deleted	1.005	4	98
AF-A0A2S8MLU2-F1-model_v4	deleted	1.002	1	114
AF-X8B0A6-F1-model_v4	deleted	0.9997	1	126
AF-X8AI62-F1-model_v4	Short chain dehydrogenase family protein	0.9994	16	151	GO:0016491
AF-A0A1T3W6V6-F1-model_v4	Oxidoreductase	0.9941	1	200	GO:0016491

Feature Viewer

pLDDT	pTM	Quality
91.61	0.89	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F460426

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF08659

KR

KR domain

77

211

0.89

PF00106

adh_short

short chain dehydrogenase

77

273

0.85

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

83

216

0.84

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

79

246

0.83

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map