F460331

General Info

Members Datasets Scaffolds Average Seq Length
532 241 1064 115

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0009686|Ga0501036_0009686_2922_3278
Length 118
Sequence MLSAHATLAYLAVAVPALAAAVGGYVYWQRRGAGRIVSHLLALAQTLLIAQVGLGLLLLSDDRRTSDDLHYVYGSLSLGALLVPWLYAPASGARRLAWFAGTSALAAALAVRAFMTGA

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
90 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
93 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
94 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
107 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
108 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
110 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
126 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
127 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
128 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
154 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
173 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
238 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.12
Metatranscriptomes 1.88
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 7.52
Rhizosphere 91.17
Stem 0
Stem Tuber 0
Unclassified 9.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_0009686 3300049572 Bacteria 7929
2 Ga0070658_10457024 3300005327 Bacteria 1101
3 Ga0070658_10517559 3300005327 Bacteria 1031
4 Ga0070683_100044248 3300005329 Bacteria 4105
5 Ga0070683_100103720 3300005329 Bacteria 2680
6 Ga0070683_100165156 3300005329 Bacteria 2100
7 Ga0070683_100265025 3300005329 Bacteria 1634
8 Ga0070680_100037505 3300005336 Bacteria 3916
9 Ga0070680_100626651 3300005336 Bacteria 924
10 Ga0070682_100018533 3300005337 Bacteria 4072
11 Ga0070660_100024280 3300005339 Bacteria 4498
12 Ga0070660_100024290 3300005339 Bacteria 4497
13 Ga0070660_100319616 3300005339 Bacteria 1275
14 Ga0070660_100430112 3300005339 Bacteria 1094
15 Ga0070660_101624029 3300005339 Bacteria 550
16 Ga0070691_10879879 3300005341 Bacteria 551
17 Ga0070661_100002794 3300005344 Bacteria 11984
18 Ga0070661_100161475 3300005344 Bacteria 1697
19 Ga0070661_100234409 3300005344 Bacteria 1411
20 Ga0070661_100511031 3300005344 Bacteria 963
21 Ga0070675_100517224 3300005354 Bacteria 1077
22 Ga0070671_100254244 3300005355 Bacteria 1493
23 Ga0070671_100262415 3300005355 Unclassified 1468
24 Ga0070674_101014129 3300005356 Bacteria 729
25 Ga0070674_101741143 3300005356 Unclassified 564
26 Ga0070659_100039235 3300005366 Bacteria 3696
27 Ga0070659_100227225 3300005366 Bacteria 1542
28 Ga0070709_10286990 3300005434 Bacteria 1198
29 Ga0070714_100289600 3300005435 Bacteria 1524
30 Ga0070714_100352029 3300005435 Bacteria 1383
31 Ga0070714_100600752 3300005435 Bacteria 1057
32 Ga0070714_100826335 3300005435 Unclassified 898
33 Ga0070713_100015951 3300005436 Bacteria 5636
34 Ga0070713_100416676 3300005436 Bacteria 1257
35 Ga0070713_100430796 3300005436 Bacteria 1236
36 Ga0070713_102398619 3300005436 Unclassified 510
37 Ga0070710_10893112 3300005437 Unclassified 641
38 Ga0070711_100281424 3300005439 Bacteria 1316
39 Ga0070708_100488389 3300005445 Bacteria 1161
40 Ga0070663_100947439 3300005455 Bacteria 746
41 Ga0070681_10001242 3300005458 Bacteria 22193
42 Ga0070681_10019025 3300005458 Bacteria 6874
43 Ga0070681_10102919 3300005458 Bacteria 2800
44 Ga0070681_10142226 3300005458 Bacteria 2329
45 Ga0070681_11176352 3300005458 Bacteria 689
46 Ga0070706_101065833 3300005467 Bacteria 744
47 Ga0070706_101167203 3300005467 Bacteria 708
48 Ga0070706_101652299 3300005467 Bacteria 584
49 Ga0070698_100487781 3300005471 Bacteria 1170
50 Ga0070699_100155494 3300005518 Bacteria 2024
51 Ga0070679_100002714 3300005530 Bacteria 16116
52 Ga0070679_100029750 3300005530 Bacteria 5388
53 Ga0070679_100451521 3300005530 Bacteria 1230
54 Ga0070684_100001095 3300005535 Bacteria 19436
55 Ga0070684_100041689 3300005535 Bacteria 3959
56 Ga0070684_100297064 3300005535 Bacteria 1482
57 Ga0070684_100472839 3300005535 Bacteria 1159
58 Ga0070684_101172957 3300005535 Unclassified 722
59 Ga0068853_100186009 3300005539 Bacteria 1885
60 Ga0068853_100218022 3300005539 Bacteria 1741
61 Ga0070695_100297784 3300005545 Bacteria 1191
62 Ga0070693_101434620 3300005547 Unclassified 538
63 Ga0070665_100015545 3300005548 Bacteria 7646
64 Ga0070665_100290513 3300005548 Bacteria 1637
65 Ga0070704_101286764 3300005549 Bacteria 669
66 Ga0068855_100043181 3300005563 Bacteria 5341
67 Ga0068855_100106284 3300005563 Bacteria 3226
68 Ga0068855_100193629 3300005563 Bacteria 2291
69 Ga0068855_100258802 3300005563 Bacteria 1939
70 Ga0068855_100633893 3300005563 Bacteria 1150
71 Ga0068857_100052206 3300005577 Bacteria 3627
72 Ga0068857_100148013 3300005577 Bacteria 2125
73 Ga0068857_100440783 3300005577 Bacteria 1217
74 Ga0068854_100431010 3300005578 Bacteria 1097
75 Ga0068854_100995895 3300005578 Bacteria 742
76 Ga0068856_100084897 3300005614 Bacteria 3145
77 Ga0068856_100193144 3300005614 Bacteria 2049
78 Ga0068856_100412154 3300005614 Bacteria 1371
79 Ga0068852_100026148 3300005616 Bacteria 4739
80 Ga0068852_100040177 3300005616 Bacteria 3945
81 Ga0081539_10003787 3300005985 Bacteria 17863
82 Ga0070717_10083984 3300006028 Bacteria 2678
83 Ga0070717_10093185 3300006028 Bacteria 2546
84 Ga0070717_11633286 3300006028 Bacteria 584
85 Ga0075365_10214433 3300006038 Bacteria 1350
86 Ga0070712_100096874 3300006175 Bacteria 2173
87 Ga0070712_100727596 3300006175 Bacteria 848
88 Ga0070712_101678883 3300006175 Bacteria 556
89 Ga0070712_101901375 3300006175 Archaea 521
90 Ga0075362_10212843 3300006177 Unclassified 943
91 Ga0097621_100497268 3300006237 Bacteria 1104
92 Ga0075434_100006313 3300006871 Bacteria 10864
93 Ga0075435_100005187 3300007076 Bacteria 9062
94 Ga0075435_100829927 3300007076 Bacteria 805
95 Ga0105240_10142362 3300009093 Bacteria 2866
96 Ga0105240_10272459 3300009093 Bacteria 1948
97 Ga0105240_10682929 3300009093 Bacteria 1122
98 Ga0105245_10176602 3300009098 Bacteria 2037
99 Ga0105245_10596402 3300009098 Bacteria 1131
100 Ga0114129_10328710 3300009147 Bacteria 2031
101 Ga0114129_10390593 3300009147 Bacteria 1835
102 Ga0114129_10666724 3300009147 Bacteria 1341
103 Ga0114129_11091338 3300009147 Bacteria 1000
104 Ga0114129_11822902 3300009147 Unclassified 739
105 Ga0105243_11169927 3300009148 Unclassified 781
106 Ga0105243_12708986 3300009148 Bacteria 536
107 Ga0105237_10021997 3300009545 Bacteria 6546
108 Ga0105238_10041207 3300009551 Bacteria 4678
109 Ga0105238_10158572 3300009551 Bacteria 2238
110 Ga0105239_10095199 3300010375 Bacteria 3290
111 Ga0105239_10145036 3300010375 Bacteria 2647
112 Ga0157370_10012542 3300013104 Bacteria 8787
113 Ga0157370_10030932 3300013104 Bacteria 5242
114 Ga0157370_10206956 3300013104 Bacteria 1819
115 Ga0157370_10888762 3300013104 Bacteria 809
116 Ga0157369_10005342 3300013105 Bacteria 14966
117 Ga0157369_10036169 3300013105 Bacteria 5412
118 Ga0157369_10037155 3300013105 Bacteria 5333
119 Ga0157369_10194671 3300013105 Bacteria 2129
120 Ga0157369_10205525 3300013105 Bacteria 2066
121 Ga0157369_10519604 3300013105 Bacteria 1231
122 Ga0157369_10953660 3300013105 Unclassified 879
123 Ga0157378_10849215 3300013297 Unclassified 941
124 Ga0157372_10012713 3300013307 Bacteria 8966
125 Ga0157372_10022568 3300013307 Bacteria 6811
126 Ga0157372_10629771 3300013307 Bacteria 1250
127 Ga0182008_10555053 3300014497 Bacteria 639
128 Ga0182008_10654256 3300014497 Bacteria 595
129 Ga0157377_10410206 3300014745 Unclassified 925
130 Ga0197907_10984874 3300020069 Bacteria 1932
131 Ga0197907_11000434 3300020069 Bacteria 1029
132 Ga0197907_11062133 3300020069 Bacteria 944
133 Ga0206354_10436749 3300020081 Bacteria 1709
134 Ga0206354_10488364 3300020081 Bacteria 1837
135 Ga0206354_11695526 3300020081 Bacteria 872
136 Ga0206353_11147252 3300020082 Bacteria 5244
137 Ga0206353_11373322 3300020082 Bacteria 1799
138 Ga0206353_11757538 3300020082 Bacteria 2186
139 Ga0206353_11914856 3300020082 Bacteria 1756
140 Ga0213876_10245068 3300021384 Bacteria 952
141 Ga0207705_10039578 3300025909 Bacteria 3379
142 Ga0207705_10105627 3300025909 Bacteria 2076
143 Ga0207705_10108052 3300025909 Bacteria 2053
144 Ga0207684_10569864 3300025910 Bacteria 968
145 Ga0207654_10141875 3300025911 Bacteria 1533
146 Ga0207654_10450489 3300025911 Bacteria 902
147 Ga0207707_10003875 3300025912 Bacteria 13267
148 Ga0207707_10205386 3300025912 Bacteria 1717
149 Ga0207707_10233985 3300025912 Bacteria 1598
150 Ga0207695_10174628 3300025913 Bacteria 2072
151 Ga0207695_10553399 3300025913 Bacteria 1032
152 Ga0207671_10323447 3300025914 Bacteria 1221
153 Ga0207671_10649428 3300025914 Bacteria 840
154 Ga0207671_10765615 3300025914 Unclassified 766
155 Ga0207671_10791739 3300025914 Unclassified 752
156 Ga0207693_10134734 3300025915 Bacteria 1942
157 Ga0207693_10775573 3300025915 Bacteria 740
158 Ga0207663_10049700 3300025916 Bacteria 2603
159 Ga0207663_10325034 3300025916 Bacteria 1157
160 Ga0207663_11481231 3300025916 Bacteria 547
161 Ga0207660_10068722 3300025917 Bacteria 2570
162 Ga0207660_10207281 3300025917 Bacteria 1534
163 Ga0207657_10003801 3300025919 Bacteria 16051
164 Ga0207657_10004114 3300025919 Bacteria 15445
165 Ga0207657_10346027 3300025919 Bacteria 1173
166 Ga0207649_10021238 3300025920 Bacteria 3733
167 Ga0207649_10034855 3300025920 Bacteria 3019
168 Ga0207649_10178078 3300025920 Bacteria 1486
169 Ga0207652_10019536 3300025921 Bacteria 5573
170 Ga0207652_10053734 3300025921 Bacteria 3460
171 Ga0207652_10389074 3300025921 Bacteria 1258
172 Ga0207652_10503768 3300025921 Bacteria 1090
173 Ga0207652_10643153 3300025921 Bacteria 949
174 Ga0207694_10113970 3300025924 Bacteria 2153
175 Ga0207687_10102855 3300025927 Bacteria 2105
176 Ga0207664_10210481 3300025929 Bacteria 1682
177 Ga0207664_10442313 3300025929 Bacteria 1159
178 Ga0207664_10615477 3300025929 Unclassified 976
179 Ga0207664_10857771 3300025929 Bacteria 816
180 Ga0207644_10279981 3300025931 Unclassified 1339
181 Ga0207644_10315931 3300025931 Bacteria 1262
182 Ga0207690_10110817 3300025932 Bacteria 1977
183 Ga0207690_10163561 3300025932 Bacteria 1661
184 Ga0207690_11117687 3300025932 Bacteria 657
185 Ga0207669_11089239 3300025937 Bacteria 674
186 Ga0207665_10289379 3300025939 Bacteria 1222
187 Ga0207661_10045306 3300025944 Bacteria 3481
188 Ga0207661_10082548 3300025944 Bacteria 2657
189 Ga0207661_10244185 3300025944 Bacteria 1594
190 Ga0207661_10452771 3300025944 Bacteria 1169
191 Ga0207661_10758131 3300025944 Bacteria 893
192 Ga0207667_10038453 3300025949 Bacteria 5110
193 Ga0207667_10292628 3300025949 Bacteria 1664
194 Ga0207667_10420675 3300025949 Bacteria 1359
195 Ga0207640_10039385 3300025981 Bacteria 2991
196 Ga0207640_10638605 3300025981 Unclassified 906
197 Ga0207640_11418901 3300025981 Bacteria 622
198 Ga0207639_10432966 3300026041 Bacteria 1191
199 Ga0207639_10576444 3300026041 Bacteria 1035
200 Ga0207639_10774768 3300026041 Bacteria 893
201 Ga0207678_10635852 3300026067 Bacteria 937
202 Ga0207678_10825863 3300026067 Bacteria 819
203 Ga0207702_10147056 3300026078 Bacteria 2139
204 Ga0207702_10230547 3300026078 Bacteria 1730
205 Ga0207674_10017076 3300026116 Bacteria 7921
206 Ga0207674_10250614 3300026116 Bacteria 1718
207 Ga0207674_10428898 3300026116 Bacteria 1278
208 Ga0207698_10024193 3300026142 Bacteria 4258
209 Ga0207698_11040464 3300026142 Bacteria 830
210 Ga0268266_10164982 3300028379 Bacteria 2006
211 Ga0268266_10359485 3300028379 Bacteria 1370
212 Ga0265334_10120006 3300028573 Bacteria 940
213 Ga0265318_10050008 3300028577 Bacteria 1572
214 Ga0265338_10111325 3300028800 Bacteria 2204
215 Ga0265338_10746392 3300028800 Bacteria 673
216 Ga0265330_10038951 3300031235 Bacteria 2113
217 Ga0265320_10122018 3300031240 Bacteria 1188
218 Ga0265331_10211900 3300031250 Bacteria 872
219 Ga0265327_10075211 3300031251 Bacteria 1680
220 Ga0307408_100255890 3300031548 Bacteria 1446
221 Ga0307408_100946933 3300031548 Unclassified 791
222 Ga0307405_10038804 3300031731 Bacteria 2874
223 Ga0307413_10484480 3300031824 Bacteria 989
224 Ga0307410_10043156 3300031852 Bacteria 2986
225 Ga0307406_10045851 3300031901 Bacteria 2747
226 Ga0307412_10231061 3300031911 Bacteria 1424
227 Ga0307409_100376815 3300031995 Bacteria 1347
228 Ga0307416_100347343 3300032002 Bacteria 1499
229 Ga0307411_10012739 3300032005 Bacteria 4607
230 Ga0307415_100348518 3300032126 Bacteria 1245
231 Ga0373926_0033915 3300035083 Bacteria 1806
232 Ga0373944_0051185 3300035089 Bacteria 1302
233 Ga0373923_0310496 3300035111 Bacteria 748
234 Ga0373945_0023073 3300035116 Bacteria 2148
235 Ga0373945_0267851 3300035116 Unclassified 725
236 Ga0373954_0264125 3300035118 Bacteria 848
237 Ga0373943_0000825 3300035170 Bacteria 13638
238 Ga0373943_0312613 3300035170 Bacteria 894
239 Ga0373946_0000490 3300035171 Bacteria 13102
240 Ga0373946_0041599 3300035171 Unclassified 1886
241 Ga0373924_0474445 3300035410 Bacteria 562
242 Ga0373935_0001745 3300035692 Bacteria 12199
243 Ga0373927_0011613 3300035695 Bacteria 5865
244 Ga0373927_0019664 3300035695 Bacteria 4428
245 Ga0373947_0000742 3300035725 Bacteria 19566
246 Ga0373947_0087094 3300035725 Unclassified 1942
247 Ga0373947_0987890 3300035725 Bacteria 574
248 Ga0373937_0227002 3300036401 Bacteria 1758
249 Ga0373925_0046465 3300037068 Bacteria 3228
250 Ga0373925_0410847 3300037068 Bacteria 1105
251 Ga0373925_0427657 3300037068 Unclassified 1082
252 Ga0395899_0075529 3300037312 Bacteria 2460
253 Ga0395899_0097000 3300037312 Bacteria 2132
254 Ga0395899_0606424 3300037312 Bacteria 697
255 Ga0395899_0618669 3300037312 Unclassified 688
256 Ga0395900_0049517 3300037418 Bacteria 4329
257 Ga0395900_0210060 3300037418 Bacteria 1965
258 Ga0395900_0400417 3300037418 Bacteria 1337
259 Ga0395900_0799405 3300037418 Bacteria 871
260 Ga0395900_0849172 3300037418 Bacteria 839
261 Ga0395900_1189162 3300037418 Bacteria 678
262 Ga0395898_0003471 3300037466 Bacteria 17603
263 Ga0395898_0026181 3300037466 Bacteria 5871
264 Ga0395898_0424898 3300037466 Bacteria 1266
265 Ga0395898_0443491 3300037466 Bacteria 1237
266 Ga0395898_0459411 3300037466 Bacteria 1212
267 Ga0395898_0580842 3300037466 Bacteria 1063
268 Ga0395898_1066707 3300037466 Bacteria 742
269 Ga0395898_1176426 3300037466 Bacteria 698
270 Ga0395898_1311830 3300037466 Bacteria 653
271 Ga0395905_0019593 3300037471 Bacteria 6413
272 Ga0395905_0673660 3300037471 Unclassified 937
273 Ga0395905_0675258 3300037471 Bacteria 935
274 Ga0395905_1842785 3300037471 Bacteria 511
275 Ga0395901_0006732 3300038443 Bacteria 11607
276 Ga0395901_0012280 3300038443 Bacteria 8693
277 Ga0395901_0014460 3300038443 Bacteria 8029
278 Ga0395901_0052634 3300038443 Bacteria 4231
279 Ga0395901_0262561 3300038443 Bacteria 1797
280 Ga0395901_0345207 3300038443 Bacteria 1537
281 Ga0395901_0768931 3300038443 Unclassified 955
282 Ga0395901_0918064 3300038443 Bacteria 856
283 Ga0436365_1495102 3300039437 Bacteria 1390
284 Ga0436363_0321818 3300039450 Bacteria 1200
285 Ga0451802_1290484 3300041460 Bacteria 670
286 Ga0450912_033255 3300042116 Bacteria 541
287 Ga0466969_0051427 3300044656 Bacteria 2028
288 Ga0466966_0070776 3300044684 Bacteria 2186
289 Ga0466961_0008115 3300044693 Bacteria 6684
290 Ga0466963_0000496 3300044694 Bacteria 18307
291 Ga0466963_0010214 3300044694 Bacteria 5677
292 Ga0466963_0011261 3300044694 Bacteria 5443
293 Ga0466963_0046766 3300044694 Bacteria 2854
294 Ga0466963_0116025 3300044694 Bacteria 1840
295 Ga0466963_0528794 3300044694 Bacteria 833
296 Ga0466964_0014685 3300044706 Bacteria 2979
297 Ga0466964_0016678 3300044706 Bacteria 2806
298 Ga0466964_0108093 3300044706 Bacteria 1236
299 Ga0466971_0000165 3300044719 Bacteria 24707
300 Ga0466968_0005689 3300044735 Bacteria 4670
301 Ga0466968_0113311 3300044735 Bacteria 1221
302 Ga0466968_0640194 3300044735 Unclassified 539
303 Ga0466957_0001076 3300044842 Bacteria 14082
304 Ga0466957_0310779 3300044842 Bacteria 1061
305 Ga0466957_0455201 3300044842 Unclassified 882
306 Ga0466957_1042989 3300044842 Unclassified 588
307 Ga0466960_0181977 3300044901 Unclassified 1140
308 Ga0466959_0021447 3300045049 Bacteria 4764
309 Ga0466959_0216023 3300045049 Bacteria 1331
310 Ga0451576_1368761 3300045051 Bacteria 737
311 Ga0466958_0000198 3300045836 Bacteria 22183
312 Ga0466958_0313896 3300045836 Bacteria 1007
313 Ga0466958_1137200 3300045836 Bacteria 510
314 Ga0466967_0008194 3300045976 Bacteria 7632
315 Ga0466967_0012007 3300045976 Bacteria 6600
316 Ga0466967_0012286 3300045976 Bacteria 6541
317 Ga0466967_0034468 3300045976 Bacteria 4297
318 Ga0466967_0084013 3300045976 Bacteria 2880
319 Ga0466967_0108498 3300045976 Bacteria 2547
320 Ga0466967_0134294 3300045976 Bacteria 2300
321 Ga0466967_0177980 3300045976 Bacteria 2004
322 Ga0466967_0392192 3300045976 Bacteria 1350
323 Ga0466967_0400020 3300045976 Bacteria 1336
324 Ga0466967_0470092 3300045976 Bacteria 1231
325 Ga0466967_0878705 3300045976 Bacteria 891
326 Ga0466967_1001639 3300045976 Unclassified 832
327 Ga0466967_1149541 3300045976 Unclassified 773
328 Ga0466967_1554165 3300045976 Unclassified 659
329 Ga0466967_2156453 3300045976 Bacteria 553
330 Ga0495592_0029321 3300046454 Bacteria 4168
331 Ga0495603_0811316 3300046455 Bacteria 533
332 Ga0495629_0004338 3300046459 Bacteria 10633
333 Ga0495629_0154180 3300046459 Bacteria 1596
334 Ga0495629_0374543 3300046459 Bacteria 969
335 Ga0495641_0000709 3300046461 Bacteria 28205
336 Ga0495651_0075557 3300046462 Bacteria 2554
337 Ga0495651_0207550 3300046462 Unclassified 1366
338 Ga0495651_0213375 3300046462 Bacteria 1341
339 Ga0495651_0559421 3300046462 Unclassified 726
340 Ga0495653_0024531 3300046463 Bacteria 4859
341 Ga0495653_0098849 3300046463 Bacteria 2118
342 Ga0495580_0280681 3300046472 Unclassified 1136
343 Ga0495582_0000237 3300046473 Bacteria 30675
344 Ga0495582_0474598 3300046473 Unclassified 723
345 Ga0495605_0120451 3300046474 Bacteria 1190
346 Ga0495639_0005828 3300046475 Bacteria 5299
347 Ga0495639_0427208 3300046475 Bacteria 671
348 Ga0495662_0000484 3300046476 Bacteria 18104
349 Ga0495662_0407537 3300046476 Bacteria 668
350 Ga0495662_0552787 3300046476 Bacteria 564
351 Ga0495664_0055214 3300046477 Bacteria 2363
352 Ga0495664_0150755 3300046477 Bacteria 1410
353 Ga0495664_0162417 3300046477 Bacteria 1355
354 Ga0495664_0529635 3300046477 Unclassified 703
355 Ga0495584_0490483 3300046491 Unclassified 626
356 Ga0495585_0294824 3300046492 Unclassified 799
357 Ga0495594_0500206 3300046499 Bacteria 690
358 Ga0495607_0260410 3300046501 Unclassified 831
359 Ga0495608_0047179 3300046511 Bacteria 2864
360 Ga0495608_0229967 3300046511 Bacteria 1161
361 Ga0495608_0451510 3300046511 Bacteria 782
362 Ga0495608_0555865 3300046511 Bacteria 691
363 Ga0495618_0020351 3300046514 Bacteria 4084
364 Ga0495618_0190388 3300046514 Bacteria 1301
365 Ga0495618_0411318 3300046514 Bacteria 826
366 Ga0495628_0141693 3300046516 Bacteria 1835
367 Ga0495628_0681120 3300046516 Bacteria 728
368 Ga0495630_0032874 3300046517 Bacteria 3867
369 Ga0495630_0076532 3300046517 Bacteria 2521
370 Ga0495630_0191644 3300046517 Bacteria 1560
371 Ga0495630_0496231 3300046517 Unclassified 936
372 Ga0495644_0122687 3300046523 Bacteria 989
373 Ga0495644_0319867 3300046523 Unclassified 609
374 Ga0495652_0073116 3300046529 Bacteria 2856
375 Ga0495652_0081059 3300046529 Bacteria 2678
376 Ga0495652_0179911 3300046529 Bacteria 1624
377 Ga0495652_0322946 3300046529 Bacteria 1114
378 Ga0495652_0439498 3300046529 Bacteria 915
379 Ga0495652_0538269 3300046529 Unclassified 805
380 Ga0495665_0001276 3300046531 Bacteria 13430
381 Ga0495640_0027749 3300046533 Bacteria 4080
382 Ga0495640_0047448 3300046533 Bacteria 2973
383 Ga0495640_0073224 3300046533 Bacteria 2294
384 Ga0495640_0590218 3300046533 Bacteria 671
385 Ga0495586_0718090 3300046535 Unclassified 577
386 Ga0495587_0162020 3300046536 Bacteria 1272
387 Ga0495587_0202362 3300046536 Bacteria 1123
388 Ga0495587_0244153 3300046536 Bacteria 1010
389 Ga0495587_0313280 3300046536 Bacteria 877
390 Ga0495645_0121012 3300046543 Bacteria 1843
391 Ga0495645_0166334 3300046543 Bacteria 1521
392 Ga0495645_0395757 3300046543 Bacteria 881
393 Ga0495667_0053256 3300046559 Bacteria 2665
394 Ga0495667_0060947 3300046559 Bacteria 2474
395 Ga0495656_0137068 3300046615 Bacteria 1170
396 Ga0495634_0066698 3300046642 Bacteria 2382
397 Ga0495634_0085294 3300046642 Bacteria 2058
398 Ga0495634_0200483 3300046642 Bacteria 1240
399 Ga0495634_0509225 3300046642 Bacteria 705
400 Ga0495635_0010241 3300046663 Bacteria 6555
401 Ga0495635_0198743 3300046663 Bacteria 1360
402 Ga0495588_0442824 3300046674 Bacteria 682
403 Ga0495657_0060287 3300046675 Bacteria 2514
404 Ga0495599_0055256 3300046678 Bacteria 2487
405 Ga0495599_0349622 3300046678 Bacteria 886
406 Ga0495623_0098951 3300046679 Bacteria 1779
407 Ga0495646_0025919 3300046680 Bacteria 3683
408 Ga0495646_0139278 3300046680 Bacteria 1358
409 Ga0495646_0215883 3300046680 Bacteria 1039
410 Ga0495647_0023953 3300046681 Bacteria 2218
411 Ga0495658_0000690 3300046683 Bacteria 18283
412 Ga0495658_0032586 3300046683 Bacteria 2847
413 Ga0495658_0516776 3300046683 Bacteria 764
414 Ga0495658_0636466 3300046683 Bacteria 683
415 Ga0495658_0919690 3300046683 Bacteria 559
416 Ga0495613_0059059 3300046689 Bacteria 2812
417 Ga0495613_0424480 3300046689 Bacteria 904
418 Ga0495613_0634082 3300046689 Bacteria 708
419 Ga0495624_0022914 3300046690 Bacteria 4121
420 Ga0495624_0238532 3300046690 Bacteria 1101
421 Ga0495670_0136919 3300046691 Bacteria 1279
422 Ga0495600_0022360 3300046809 Bacteria 4058
423 Ga0495600_0127349 3300046809 Bacteria 1656
424 Ga0495600_0222659 3300046809 Bacteria 1206
425 Ga0495600_0368387 3300046809 Bacteria 898
426 Ga0495581_0001253 3300047315 Bacteria 13954
427 Ga0495604_0020730 3300047317 Bacteria 5249
428 Ga0495604_0156176 3300047317 Bacteria 1616
429 Ga0495604_0203850 3300047317 Bacteria 1370
430 Ga0495604_0233530 3300047317 Bacteria 1261
431 Ga0495674_0041297 3300047319 Bacteria 4121
432 Ga0495674_0054533 3300047319 Bacteria 3510
433 Ga0495674_0117974 3300047319 Bacteria 2244
434 Ga0495674_0633261 3300047319 Bacteria 844
435 Ga0495674_1043873 3300047319 Bacteria 624
436 Ga0495676_0011861 3300047321 Bacteria 7862
437 Ga0495680_0014060 3300047322 Bacteria 6953
438 Ga0495680_0193457 3300047322 Bacteria 1462
439 Ga0495680_0225414 3300047322 Bacteria 1336
440 Ga0495680_0472237 3300047322 Bacteria 855
441 Ga0495675_0261269 3300047444 Bacteria 1037
442 Ga0495675_0279936 3300047444 Bacteria 995
443 Ga0495684_0151808 3300047471 Bacteria 1731
444 Ga0495684_0254457 3300047471 Bacteria 1276
445 Ga0495593_0003760 3300047673 Bacteria 9064
446 Ga0495602_0029426 3300048088 Bacteria 5230
447 Ga0495602_0364043 3300048088 Bacteria 1040
448 Ga0495602_0496939 3300048088 Unclassified 853
449 Ga0495614_0001669 3300048089 Bacteria 9678
450 Ga0495614_0494739 3300048089 Bacteria 581
451 Ga0496100_0004732 3300048903 Bacteria 7257
452 Ga0496100_0053923 3300048903 Bacteria 2620
453 Ga0496100_0183818 3300048903 Bacteria 1513
454 Ga0496100_0809942 3300048903 Bacteria 734
455 Ga0496101_0022257 3300048904 Bacteria 4362
456 Ga0496102_0015138 3300048905 Bacteria 6716
457 Ga0496103_0170884 3300048906 Bacteria 1396
458 Ga0496103_0215567 3300048906 Bacteria 1234
459 Ga0496104_0024882 3300048907 Bacteria 5513
460 Ga0496104_0397969 3300048907 Bacteria 1290
461 Ga0496104_0672210 3300048907 Unclassified 944
462 Ga0496105_0010458 3300048908 Bacteria 7295
463 Ga0496105_0153903 3300048908 Bacteria 1889
464 Ga0496105_0471957 3300048908 Bacteria 988
465 Ga0496106_0009047 3300048909 Bacteria 7362
466 Ga0496106_0010051 3300048909 Bacteria 6990
467 Ga0496107_0000589 3300048910 Bacteria 20289
468 Ga0496107_0166259 3300048910 Bacteria 1636
469 Ga0496107_0379440 3300048910 Bacteria 1052
470 Ga0496108_0034813 3300048911 Bacteria 4184
471 Ga0496109_0024030 3300048912 Bacteria 5414
472 Ga0496109_0614028 3300048912 Unclassified 1024
473 Ga0496109_0633497 3300048912 Unclassified 1006
474 Ga0496110_0359449 3300048913 Bacteria 1327
475 Ga0496111_0081158 3300048914 Bacteria 2367
476 Ga0496111_0351631 3300048914 Bacteria 1091
477 Ga0496112_0006354 3300048915 Bacteria 10370
478 Ga0496112_0029498 3300048915 Bacteria 5306
479 Ga0496113_0180761 3300048916 Bacteria 1672
480 Ga0496114_0001310 3300048917 Bacteria 18849
481 Ga0496114_0033507 3300048917 Bacteria 4233
482 Ga0496114_0612258 3300048917 Bacteria 960
483 Ga0496114_0901870 3300048917 Bacteria 765
484 Ga0496114_1757505 3300048917 Bacteria 508
485 Ga0496115_0002558 3300048918 Bacteria 13065
486 Ga0496115_0044931 3300048918 Bacteria 3525
487 Ga0496115_0060415 3300048918 Bacteria 3054
488 Ga0496115_0061455 3300048918 Bacteria 3028
489 Ga0496115_0590612 3300048918 Unclassified 884
490 Ga0501031_0059725 3300049568 Bacteria 2484
491 Ga0501034_1179172 3300049571 Bacteria 645
492 Ga0501038_0027404 3300049574 Bacteria 5069
493 Ga0501039_0029153 3300049575 Bacteria 4250
494 Ga0501039_0619697 3300049575 Unclassified 848
495 Ga0501041_0005087 3300049577 Bacteria 7667
496 Ga0501046_0412893 3300049580 Bacteria 974
497 Ga0501048_0005423 3300049582 Bacteria 9698
498 Ga0501067_0161184 3300049583 Bacteria 1249
499 Ga0501069_0051594 3300049585 Bacteria 2289
500 Ga0501070_0000402 3300049586 Bacteria 39380
501 Ga0501071_0008457 3300049587 Bacteria 6806
502 Ga0501074_0030199 3300049590 Bacteria 3928
503 Ga0501074_0545018 3300049590 Bacteria 821
504 Ga0501075_0333581 3300049591 Unclassified 1156
505 Ga0501076_0003188 3300049592 Bacteria 11444
506 Ga0501077_0125456 3300049593 Bacteria 1627
507 Ga0501080_0434659 3300049742 Bacteria 1178
508 Ga0501080_1493309 3300049742 Bacteria 574
509 Ga0501083_0301108 3300049744 Bacteria 1043
510 Ga0501271_010865 3300049768 Bacteria 967
511 Ga0501035_0704588 3300049822 Bacteria 814
512 Ga0501044_0639287 3300049823 Bacteria 954
513 Ga0501045_0019177 3300049824 Bacteria 4872
514 nmdc:mga03683_452905_c1 3300050489 Unclassified 617
515 nmdc:mga0yw44_309765_c1 3300050492 Bacteria 1059
516 nmdc:mga05p37_532407_c1 3300050507 Bacteria 1341
517 nmdc:mga05p37_836019_c1 3300050507 Bacteria 1002
518 nmdc:mga0n895_19850_c1 3300050512 Bacteria 6255
519 nmdc:mga0rr50_1715849_c1 3300050513 Bacteria 529
520 nmdc:mga0rr50_51388_c1 3300050513 Bacteria 3058
521 nmdc:mga08x19_558229_c1 3300050514 Bacteria 810
522 Ga0495601_0078207 3300053077 Bacteria 2119
523 Ga0495601_0166267 3300053077 Bacteria 1442
524 Ga0495601_0196025 3300053077 Bacteria 1320
525 Ga0495612_0030276 3300053078 Bacteria 2180
526 Ga0495612_0055780 3300053078 Bacteria 1630
527 Ga0495612_0148571 3300053078 Bacteria 1019
528 Ga0495595_0016538 3300053084 Bacteria 3158
529 Ga0495619_0103745 3300053085 Bacteria 1937
530 Ga0495619_0120095 3300053085 Bacteria 1802
531 Ga0501084_0011830 3300054114 Bacteria 7223
532 Ga0466962_0000618 3300061719 Bacteria 15773
533 Ga0501036_0009686
534 Ga0070658_10457024
535 Ga0070658_10517559
536 Ga0070683_100044248
537 Ga0070683_100103720
538 Ga0070683_100165156
539 Ga0070683_100265025
540 Ga0070680_100037505
541 Ga0070680_100626651
542 Ga0070682_100018533
543 Ga0070660_100024280
544 Ga0070660_100024290
545 Ga0070660_100319616
546 Ga0070660_100430112
547 Ga0070660_101624029
548 Ga0070691_10879879
549 Ga0070661_100002794
550 Ga0070661_100161475
551 Ga0070661_100234409
552 Ga0070661_100511031
553 Ga0070675_100517224
554 Ga0070671_100254244
555 Ga0070671_100262415
556 Ga0070674_101014129
557 Ga0070674_101741143
558 Ga0070659_100039235
559 Ga0070659_100227225
560 Ga0070709_10286990
561 Ga0070714_100289600
562 Ga0070714_100352029
563 Ga0070714_100600752
564 Ga0070714_100826335
565 Ga0070713_100015951
566 Ga0070713_100416676
567 Ga0070713_100430796
568 Ga0070713_102398619
569 Ga0070710_10893112
570 Ga0070711_100281424
571 Ga0070708_100488389
572 Ga0070663_100947439
573 Ga0070681_10001242
574 Ga0070681_10019025
575 Ga0070681_10102919
576 Ga0070681_10142226
577 Ga0070681_11176352
578 Ga0070706_101065833
579 Ga0070706_101167203
580 Ga0070706_101652299
581 Ga0070698_100487781
582 Ga0070699_100155494
583 Ga0070679_100002714
584 Ga0070679_100029750
585 Ga0070679_100451521
586 Ga0070684_100001095
587 Ga0070684_100041689
588 Ga0070684_100297064
589 Ga0070684_100472839
590 Ga0070684_101172957
591 Ga0068853_100186009
592 Ga0068853_100218022
593 Ga0070695_100297784
594 Ga0070693_101434620
595 Ga0070665_100015545
596 Ga0070665_100290513
597 Ga0070704_101286764
598 Ga0068855_100043181
599 Ga0068855_100106284
600 Ga0068855_100193629
601 Ga0068855_100258802
602 Ga0068855_100633893
603 Ga0068857_100052206
604 Ga0068857_100148013
605 Ga0068857_100440783
606 Ga0068854_100431010
607 Ga0068854_100995895
608 Ga0068856_100084897
609 Ga0068856_100193144
610 Ga0068856_100412154
611 Ga0068852_100026148
612 Ga0068852_100040177
613 Ga0081539_10003787
614 Ga0070717_10083984
615 Ga0070717_10093185
616 Ga0070717_11633286
617 Ga0075365_10214433
618 Ga0070712_100096874
619 Ga0070712_100727596
620 Ga0070712_101678883
621 Ga0070712_101901375
622 Ga0075362_10212843
623 Ga0097621_100497268
624 Ga0075434_100006313
625 Ga0075435_100005187
626 Ga0075435_100829927
627 Ga0105240_10142362
628 Ga0105240_10272459
629 Ga0105240_10682929
630 Ga0105245_10176602
631 Ga0105245_10596402
632 Ga0114129_10328710
633 Ga0114129_10390593
634 Ga0114129_10666724
635 Ga0114129_11091338
636 Ga0114129_11822902
637 Ga0105243_11169927
638 Ga0105243_12708986
639 Ga0105237_10021997
640 Ga0105238_10041207
641 Ga0105238_10158572
642 Ga0105239_10095199
643 Ga0105239_10145036
644 Ga0157370_10012542
645 Ga0157370_10030932
646 Ga0157370_10206956
647 Ga0157370_10888762
648 Ga0157369_10005342
649 Ga0157369_10036169
650 Ga0157369_10037155
651 Ga0157369_10194671
652 Ga0157369_10205525
653 Ga0157369_10519604
654 Ga0157369_10953660
655 Ga0157378_10849215
656 Ga0157372_10012713
657 Ga0157372_10022568
658 Ga0157372_10629771
659 Ga0182008_10555053
660 Ga0182008_10654256
661 Ga0157377_10410206
662 Ga0197907_10984874
663 Ga0197907_11000434
664 Ga0197907_11062133
665 Ga0206354_10436749
666 Ga0206354_10488364
667 Ga0206354_11695526
668 Ga0206353_11147252
669 Ga0206353_11373322
670 Ga0206353_11757538
671 Ga0206353_11914856
672 Ga0213876_10245068
673 Ga0207705_10039578
674 Ga0207705_10105627
675 Ga0207705_10108052
676 Ga0207684_10569864
677 Ga0207654_10141875
678 Ga0207654_10450489
679 Ga0207707_10003875
680 Ga0207707_10205386
681 Ga0207707_10233985
682 Ga0207695_10174628
683 Ga0207695_10553399
684 Ga0207671_10323447
685 Ga0207671_10649428
686 Ga0207671_10765615
687 Ga0207671_10791739
688 Ga0207693_10134734
689 Ga0207693_10775573
690 Ga0207663_10049700
691 Ga0207663_10325034
692 Ga0207663_11481231
693 Ga0207660_10068722
694 Ga0207660_10207281
695 Ga0207657_10003801
696 Ga0207657_10004114
697 Ga0207657_10346027
698 Ga0207649_10021238
699 Ga0207649_10034855
700 Ga0207649_10178078
701 Ga0207652_10019536
702 Ga0207652_10053734
703 Ga0207652_10389074
704 Ga0207652_10503768
705 Ga0207652_10643153
706 Ga0207694_10113970
707 Ga0207687_10102855
708 Ga0207664_10210481
709 Ga0207664_10442313
710 Ga0207664_10615477
711 Ga0207664_10857771
712 Ga0207644_10279981
713 Ga0207644_10315931
714 Ga0207690_10110817
715 Ga0207690_10163561
716 Ga0207690_11117687
717 Ga0207669_11089239
718 Ga0207665_10289379
719 Ga0207661_10045306
720 Ga0207661_10082548
721 Ga0207661_10244185
722 Ga0207661_10452771
723 Ga0207661_10758131
724 Ga0207667_10038453
725 Ga0207667_10292628
726 Ga0207667_10420675
727 Ga0207640_10039385
728 Ga0207640_10638605
729 Ga0207640_11418901
730 Ga0207639_10432966
731 Ga0207639_10576444
732 Ga0207639_10774768
733 Ga0207678_10635852
734 Ga0207678_10825863
735 Ga0207702_10147056
736 Ga0207702_10230547
737 Ga0207674_10017076
738 Ga0207674_10250614
739 Ga0207674_10428898
740 Ga0207698_10024193
741 Ga0207698_11040464
742 Ga0268266_10164982
743 Ga0268266_10359485
744 Ga0265334_10120006
745 Ga0265318_10050008
746 Ga0265338_10111325
747 Ga0265338_10746392
748 Ga0265330_10038951
749 Ga0265320_10122018
750 Ga0265331_10211900
751 Ga0265327_10075211
752 Ga0307408_100255890
753 Ga0307408_100946933
754 Ga0307405_10038804
755 Ga0307413_10484480
756 Ga0307410_10043156
757 Ga0307406_10045851
758 Ga0307412_10231061
759 Ga0307409_100376815
760 Ga0307416_100347343
761 Ga0307411_10012739
762 Ga0307415_100348518
763 Ga0373926_0033915
764 Ga0373944_0051185
765 Ga0373923_0310496
766 Ga0373945_0023073
767 Ga0373945_0267851
768 Ga0373954_0264125
769 Ga0373943_0000825
770 Ga0373943_0312613
771 Ga0373946_0000490
772 Ga0373946_0041599
773 Ga0373924_0474445
774 Ga0373935_0001745
775 Ga0373927_0011613
776 Ga0373927_0019664
777 Ga0373947_0000742
778 Ga0373947_0087094
779 Ga0373947_0987890
780 Ga0373937_0227002
781 Ga0373925_0046465
782 Ga0373925_0410847
783 Ga0373925_0427657
784 Ga0395899_0075529
785 Ga0395899_0097000
786 Ga0395899_0606424
787 Ga0395899_0618669
788 Ga0395900_0049517
789 Ga0395900_0210060
790 Ga0395900_0400417
791 Ga0395900_0799405
792 Ga0395900_0849172
793 Ga0395900_1189162
794 Ga0395898_0003471
795 Ga0395898_0026181
796 Ga0395898_0424898
797 Ga0395898_0443491
798 Ga0395898_0459411
799 Ga0395898_0580842
800 Ga0395898_1066707
801 Ga0395898_1176426
802 Ga0395898_1311830
803 Ga0395905_0019593
804 Ga0395905_0673660
805 Ga0395905_0675258
806 Ga0395905_1842785
807 Ga0395901_0006732
808 Ga0395901_0012280
809 Ga0395901_0014460
810 Ga0395901_0052634
811 Ga0395901_0262561
812 Ga0395901_0345207
813 Ga0395901_0768931
814 Ga0395901_0918064
815 Ga0436365_1495102
816 Ga0436363_0321818
817 Ga0451802_1290484
818 Ga0450912_033255
819 Ga0466969_0051427
820 Ga0466966_0070776
821 Ga0466961_0008115
822 Ga0466963_0000496
823 Ga0466963_0010214
824 Ga0466963_0011261
825 Ga0466963_0046766
826 Ga0466963_0116025
827 Ga0466963_0528794
828 Ga0466964_0014685
829 Ga0466964_0016678
830 Ga0466964_0108093
831 Ga0466971_0000165
832 Ga0466968_0005689
833 Ga0466968_0113311
834 Ga0466968_0640194
835 Ga0466957_0001076
836 Ga0466957_0310779
837 Ga0466957_0455201
838 Ga0466957_1042989
839 Ga0466960_0181977
840 Ga0466959_0021447
841 Ga0466959_0216023
842 Ga0451576_1368761
843 Ga0466958_0000198
844 Ga0466958_0313896
845 Ga0466958_1137200
846 Ga0466967_0008194
847 Ga0466967_0012007
848 Ga0466967_0012286
849 Ga0466967_0034468
850 Ga0466967_0084013
851 Ga0466967_0108498
852 Ga0466967_0134294
853 Ga0466967_0177980
854 Ga0466967_0392192
855 Ga0466967_0400020
856 Ga0466967_0470092
857 Ga0466967_0878705
858 Ga0466967_1001639
859 Ga0466967_1149541
860 Ga0466967_1554165
861 Ga0466967_2156453
862 Ga0495592_0029321
863 Ga0495603_0811316
864 Ga0495629_0004338
865 Ga0495629_0154180
866 Ga0495629_0374543
867 Ga0495641_0000709
868 Ga0495651_0075557
869 Ga0495651_0207550
870 Ga0495651_0213375
871 Ga0495651_0559421
872 Ga0495653_0024531
873 Ga0495653_0098849
874 Ga0495580_0280681
875 Ga0495582_0000237
876 Ga0495582_0474598
877 Ga0495605_0120451
878 Ga0495639_0005828
879 Ga0495639_0427208
880 Ga0495662_0000484
881 Ga0495662_0407537
882 Ga0495662_0552787
883 Ga0495664_0055214
884 Ga0495664_0150755
885 Ga0495664_0162417
886 Ga0495664_0529635
887 Ga0495584_0490483
888 Ga0495585_0294824
889 Ga0495594_0500206
890 Ga0495607_0260410
891 Ga0495608_0047179
892 Ga0495608_0229967
893 Ga0495608_0451510
894 Ga0495608_0555865
895 Ga0495618_0020351
896 Ga0495618_0190388
897 Ga0495618_0411318
898 Ga0495628_0141693
899 Ga0495628_0681120
900 Ga0495630_0032874
901 Ga0495630_0076532
902 Ga0495630_0191644
903 Ga0495630_0496231
904 Ga0495644_0122687
905 Ga0495644_0319867
906 Ga0495652_0073116
907 Ga0495652_0081059
908 Ga0495652_0179911
909 Ga0495652_0322946
910 Ga0495652_0439498
911 Ga0495652_0538269
912 Ga0495665_0001276
913 Ga0495640_0027749
914 Ga0495640_0047448
915 Ga0495640_0073224
916 Ga0495640_0590218
917 Ga0495586_0718090
918 Ga0495587_0162020
919 Ga0495587_0202362
920 Ga0495587_0244153
921 Ga0495587_0313280
922 Ga0495645_0121012
923 Ga0495645_0166334
924 Ga0495645_0395757
925 Ga0495667_0053256
926 Ga0495667_0060947
927 Ga0495656_0137068
928 Ga0495634_0066698
929 Ga0495634_0085294
930 Ga0495634_0200483
931 Ga0495634_0509225
932 Ga0495635_0010241
933 Ga0495635_0198743
934 Ga0495588_0442824
935 Ga0495657_0060287
936 Ga0495599_0055256
937 Ga0495599_0349622
938 Ga0495623_0098951
939 Ga0495646_0025919
940 Ga0495646_0139278
941 Ga0495646_0215883
942 Ga0495647_0023953
943 Ga0495658_0000690
944 Ga0495658_0032586
945 Ga0495658_0516776
946 Ga0495658_0636466
947 Ga0495658_0919690
948 Ga0495613_0059059
949 Ga0495613_0424480
950 Ga0495613_0634082
951 Ga0495624_0022914
952 Ga0495624_0238532
953 Ga0495670_0136919
954 Ga0495600_0022360
955 Ga0495600_0127349
956 Ga0495600_0222659
957 Ga0495600_0368387
958 Ga0495581_0001253
959 Ga0495604_0020730
960 Ga0495604_0156176
961 Ga0495604_0203850
962 Ga0495604_0233530
963 Ga0495674_0041297
964 Ga0495674_0054533
965 Ga0495674_0117974
966 Ga0495674_0633261
967 Ga0495674_1043873
968 Ga0495676_0011861
969 Ga0495680_0014060
970 Ga0495680_0193457
971 Ga0495680_0225414
972 Ga0495680_0472237
973 Ga0495675_0261269
974 Ga0495675_0279936
975 Ga0495684_0151808
976 Ga0495684_0254457
977 Ga0495593_0003760
978 Ga0495602_0029426
979 Ga0495602_0364043
980 Ga0495602_0496939
981 Ga0495614_0001669
982 Ga0495614_0494739
983 Ga0496100_0004732
984 Ga0496100_0053923
985 Ga0496100_0183818
986 Ga0496100_0809942
987 Ga0496101_0022257
988 Ga0496102_0015138
989 Ga0496103_0170884
990 Ga0496103_0215567
991 Ga0496104_0024882
992 Ga0496104_0397969
993 Ga0496104_0672210
994 Ga0496105_0010458
995 Ga0496105_0153903
996 Ga0496105_0471957
997 Ga0496106_0009047
998 Ga0496106_0010051
999 Ga0496107_0000589
1000 Ga0496107_0166259
1001 Ga0496107_0379440
1002 Ga0496108_0034813
1003 Ga0496109_0024030
1004 Ga0496109_0614028
1005 Ga0496109_0633497
1006 Ga0496110_0359449
1007 Ga0496111_0081158
1008 Ga0496111_0351631
1009 Ga0496112_0006354
1010 Ga0496112_0029498
1011 Ga0496113_0180761
1012 Ga0496114_0001310
1013 Ga0496114_0033507
1014 Ga0496114_0612258
1015 Ga0496114_0901870
1016 Ga0496114_1757505
1017 Ga0496115_0002558
1018 Ga0496115_0044931
1019 Ga0496115_0060415
1020 Ga0496115_0061455
1021 Ga0496115_0590612
1022 Ga0501031_0059725
1023 Ga0501034_1179172
1024 Ga0501038_0027404
1025 Ga0501039_0029153
1026 Ga0501039_0619697
1027 Ga0501041_0005087
1028 Ga0501046_0412893
1029 Ga0501048_0005423
1030 Ga0501067_0161184
1031 Ga0501069_0051594
1032 Ga0501070_0000402
1033 Ga0501071_0008457
1034 Ga0501074_0030199
1035 Ga0501074_0545018
1036 Ga0501075_0333581
1037 Ga0501076_0003188
1038 Ga0501077_0125456
1039 Ga0501080_0434659
1040 Ga0501080_1493309
1041 Ga0501083_0301108
1042 Ga0501271_010865
1043 Ga0501035_0704588
1044 Ga0501044_0639287
1045 Ga0501045_0019177
1046 nmdc:mga03683_452905_c1
1047 nmdc:mga0yw44_309765_c1
1048 nmdc:mga05p37_532407_c1
1049 nmdc:mga05p37_836019_c1
1050 nmdc:mga0n895_19850_c1
1051 nmdc:mga0rr50_1715849_c1
1052 nmdc:mga0rr50_51388_c1
1053 nmdc:mga08x19_558229_c1
1054 Ga0495601_0078207
1055 Ga0495601_0166267
1056 Ga0495601_0196025
1057 Ga0495612_0030276
1058 Ga0495612_0055780
1059 Ga0495612_0148571
1060 Ga0495595_0016538
1061 Ga0495619_0103745
1062 Ga0495619_0120095
1063 Ga0501084_0011830
1064 Ga0466962_0000618

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map