F460295

General Info

Members Datasets Scaffolds Average Seq Length
532 275 1065 127

Family's Representative Sequence

Representative Sequence 3300035691|Ga0373931_0473846|Ga0373931_0473846_316_762
Length 148
Sequence MFMEDRSPNPDKLSTRHRGTAMSRTAIRTASAPAAIGPYSQAVRSGDLVFLSGQIPLDPATGLLVEGDISAQARRVFENLRAVCEAAGGSLDDIVRAGIFLTDLGNFAAVNAVMAEYFNEPYPARSTVEVSGLPRGAQVEVDAILVVE

Samples

Sample ID Description Type Environment
1 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
66 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
130 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
131 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
132 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
133 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
147 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
148 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
160 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
161 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
162 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
163 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
164 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
165 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
166 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
167 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
168 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
169 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
170 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
171 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
172 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
173 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
180 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
181 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
182 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
183 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
184 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
187 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
188 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
189 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
190 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
193 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
194 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
197 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
198 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
199 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
200 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
201 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
202 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
207 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
212 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
217 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
218 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
221 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
222 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
223 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
224 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
225 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
235 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
238 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
254 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
255 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
256 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
257 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
258 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
265 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
266 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
267 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
270 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
271 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
272 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
273 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
274 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
275 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.68
Metatranscriptomes 0.38
Isolates 0.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.88
Nodule 0
Rhizoplane 3.01
Rhizosphere 89.29
Stem 0
Stem Tuber 0
Unclassified 3.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373931_0473846 3300035691 Bacteria 804
2 JGI25162J39368_1000134 3300002737 Bacteria 79787
3 rootH1_10000877 3300003316 Bacteria 19081
4 rootH1_10000877 3300003323 Bacteria 40245
5 rootL2_10124050 3300003322 Bacteria 2550
6 Ga0055542_1015891 3300003762 Bacteria 1198
7 Ga0070658_10003789 3300005327 Bacteria 12386
8 Ga0070658_10230973 3300005327 Bacteria 1566
9 Ga0070676_11336393 3300005328 Bacteria 548
10 Ga0070683_100408723 3300005329 Bacteria 1295
11 Ga0070670_100047475 3300005331 Bacteria 3695
12 Ga0070670_100112379 3300005331 Bacteria 2348
13 Ga0070670_100675204 3300005331 Bacteria 928
14 Ga0068869_100124403 3300005334 Unclassified 1976
15 Ga0068869_100899442 3300005334 Bacteria 766
16 Ga0070666_10003714 3300005335 Bacteria 9253
17 Ga0070666_10077742 3300005335 Bacteria 2265
18 Ga0070666_10352238 3300005335 Bacteria 1054
19 Ga0070666_10578636 3300005335 Bacteria 818
20 Ga0070666_10823605 3300005335 Bacteria 684
21 Ga0070680_100179608 3300005336 Bacteria 1783
22 Ga0070682_100881567 3300005337 Bacteria 734
23 Ga0070682_100992751 3300005337 Bacteria 696
24 Ga0068868_100043692 3300005338 Bacteria 3500
25 Ga0068868_101533921 3300005338 Bacteria 624
26 Ga0070660_100031760 3300005339 Bacteria 3968
27 Ga0070661_100090909 3300005344 Bacteria 2260
28 Ga0070661_100159738 3300005344 Bacteria 1707
29 Ga0070661_100200518 3300005344 Bacteria 1524
30 Ga0070661_100309732 3300005344 Bacteria 1231
31 Ga0070661_100508949 3300005344 Bacteria 964
32 Ga0070661_100731728 3300005344 Bacteria 808
33 Ga0070661_100869710 3300005344 Bacteria 743
34 Ga0070661_101373980 3300005344 Bacteria 594
35 Ga0070668_100041046 3300005347 Bacteria 3544
36 Ga0070668_100671985 3300005347 Bacteria 911
37 Ga0070668_101351255 3300005347 Bacteria 649
38 Ga0070668_101530974 3300005347 Bacteria 610
39 Ga0070671_100244431 3300005355 Bacteria 1524
40 Ga0070671_100447825 3300005355 Bacteria 1108
41 Ga0070671_100568947 3300005355 Bacteria 978
42 Ga0070659_100170072 3300005366 Bacteria 1784
43 Ga0070659_100718323 3300005366 Bacteria 865
44 Ga0070667_100000085 3300005367 Bacteria 117695
45 Ga0070667_100046860 3300005367 Bacteria 3637
46 Ga0070667_100102226 3300005367 Bacteria 2476
47 Ga0070667_100202732 3300005367 Bacteria 1761
48 Ga0070667_101410007 3300005367 Bacteria 654
49 Ga0070709_11099579 3300005434 Bacteria 636
50 Ga0070713_100694317 3300005436 Bacteria 971
51 Ga0070710_10719007 3300005437 Bacteria 706
52 Ga0070710_10993579 3300005437 Bacteria 611
53 Ga0070711_100062599 3300005439 Bacteria 2594
54 Ga0070705_100647531 3300005440 Bacteria 823
55 Ga0070663_100000045 3300005455 Bacteria 56569
56 Ga0070663_100006942 3300005455 Bacteria 6859
57 Ga0070663_100251376 3300005455 Bacteria 1399
58 Ga0070662_100022597 3300005457 Bacteria 4309
59 Ga0070681_10033465 3300005458 Bacteria 5160
60 Ga0070685_10000387 3300005466 Bacteria 26461
61 Ga0070679_100068470 3300005530 Bacteria 3540
62 Ga0070679_101067620 3300005530 Bacteria 752
63 Ga0068853_100002370 3300005539 Bacteria 14081
64 Ga0068853_100005041 3300005539 Bacteria 10301
65 Ga0068853_100018417 3300005539 Bacteria 5780
66 Ga0068853_100029765 3300005539 Bacteria 4606
67 Ga0068853_100066540 3300005539 Bacteria 3129
68 Ga0068853_100105886 3300005539 Bacteria 2492
69 Ga0068853_100225064 3300005539 Bacteria 1714
70 Ga0070696_100556580 3300005546 Archaea 919
71 Ga0070693_100057167 3300005547 Bacteria 2254
72 Ga0070693_100754926 3300005547 Bacteria 717
73 Ga0070665_100011703 3300005548 Bacteria 8866
74 Ga0070665_100041145 3300005548 Bacteria 4645
75 Ga0070665_100048270 3300005548 Unclassified 4275
76 Ga0070665_100082296 3300005548 Bacteria 3224
77 Ga0070665_100674544 3300005548 Bacteria 1047
78 Ga0068855_100016597 3300005563 Bacteria 8856
79 Ga0068855_100059623 3300005563 Bacteria 4465
80 Ga0068855_100180030 3300005563 Bacteria 2390
81 Ga0068855_100247182 3300005563 Bacteria 1991
82 Ga0068855_100538789 3300005563 Bacteria 1265
83 Ga0068855_101317904 3300005563 Bacteria 747
84 Ga0070664_100329034 3300005564 Bacteria 1386
85 Ga0070664_101171123 3300005564 Bacteria 725
86 Ga0070664_101206384 3300005564 Bacteria 714
87 Ga0068857_100200756 3300005577 Bacteria 1818
88 Ga0068857_100470541 3300005577 Bacteria 1177
89 Ga0068857_100485889 3300005577 Bacteria 1157
90 Ga0068857_101650792 3300005577 Bacteria 626
91 Ga0068854_100486847 3300005578 Bacteria 1036
92 Ga0068854_101584541 3300005578 Bacteria 596
93 Ga0068856_100076606 3300005614 Bacteria 3314
94 Ga0068856_100371745 3300005614 Bacteria 1448
95 Ga0068852_100018636 3300005616 Bacteria 5471
96 Ga0068852_100112215 3300005616 Bacteria 2480
97 Ga0068852_100129642 3300005616 Bacteria 2321
98 Ga0068852_100268139 3300005616 Bacteria 1642
99 Ga0068852_100496649 3300005616 Bacteria 1214
100 Ga0068852_100892094 3300005616 Bacteria 906
101 Ga0068852_100966239 3300005616 Bacteria 870
102 Ga0068859_100061631 3300005617 Bacteria 3780
103 Ga0068864_100853708 3300005618 Bacteria 897
104 Ga0068864_101842133 3300005618 Bacteria 610
105 Ga0068851_10000416 3300005834 Bacteria 19112
106 Ga0068851_10114949 3300005834 Bacteria 1441
107 Ga0068851_10224379 3300005834 Bacteria 1057
108 Ga0068863_100014666 3300005841 Bacteria 7544
109 Ga0068863_100061266 3300005841 Bacteria 3557
110 Ga0068863_100706971 3300005841 Bacteria 1002
111 Ga0068858_100001311 3300005842 Bacteria 25694
112 Ga0068858_100102724 3300005842 Bacteria 2666
113 Ga0068858_100110401 3300005842 Bacteria 2568
114 Ga0068858_100953233 3300005842 Bacteria 840
115 Ga0068858_101522821 3300005842 Bacteria 660
116 Ga0068860_100863528 3300005843 Bacteria 920
117 Ga0068862_100194446 3300005844 Bacteria 1827
118 Ga0081455_10232541 3300005937 Bacteria 1359
119 Ga0081455_10390911 3300005937 Bacteria 968
120 Ga0070716_100380863 3300006173 Bacteria 1008
121 Ga0070712_100494983 3300006175 Bacteria 1024
122 Ga0097621_100229198 3300006237 Bacteria 1621
123 Ga0097621_100308669 3300006237 Bacteria 1399
124 Ga0097621_100829685 3300006237 Bacteria 858
125 Ga0097621_101428079 3300006237 Bacteria 656
126 Ga0068871_100045282 3300006358 Bacteria 3540
127 Ga0068871_100243451 3300006358 Bacteria 1564
128 Ga0068871_100461265 3300006358 Bacteria 1140
129 Ga0068871_100889727 3300006358 Bacteria 825
130 Ga0068865_100059156 3300006881 Bacteria 2679
131 Ga0097620_100061635 3300006931 Bacteria 3780
132 Ga0105240_10007411 3300009093 Bacteria 15941
133 Ga0105240_10010575 3300009093 Bacteria 12963
134 Ga0105240_11732668 3300009093 Bacteria 652
135 Ga0105245_10369562 3300009098 Bacteria 1425
136 Ga0105245_11250045 3300009098 Bacteria 791
137 Ga0105245_12093473 3300009098 Bacteria 619
138 Ga0105245_12336981 3300009098 Bacteria 588
139 Ga0105241_10055627 3300009174 Bacteria 3031
140 Ga0105241_11611925 3300009174 Bacteria 628
141 Ga0105242_10246670 3300009176 Bacteria 1607
142 Ga0105248_10000534 3300009177 Bacteria 43233
143 Ga0105248_10274086 3300009177 Bacteria 1900
144 Ga0105248_10984306 3300009177 Bacteria 953
145 Ga0105248_11082799 3300009177 Bacteria 906
146 Ga0105248_11301364 3300009177 Bacteria 822
147 Ga0105237_10000960 3300009545 Bacteria 38773
148 Ga0105237_10055411 3300009545 Bacteria 3971
149 Ga0105237_10095203 3300009545 Bacteria 2967
150 Ga0105237_10347659 3300009545 Bacteria 1487
151 Ga0105237_11116984 3300009545 Bacteria 795
152 Ga0105238_10000266 3300009551 Bacteria 58638
153 Ga0105238_10007763 3300009551 Bacteria 10729
154 Ga0105238_10009038 3300009551 Bacteria 9969
155 Ga0105238_10013869 3300009551 Bacteria 8148
156 Ga0105238_10440474 3300009551 Bacteria 1299
157 Ga0105238_10638459 3300009551 Bacteria 1074
158 Ga0105238_11176862 3300009551 Bacteria 791
159 Ga0105249_10000659 3300009553 Bacteria 31343
160 Ga0105249_10012434 3300009553 Bacteria 7505
161 Ga0105239_10016659 3300010375 Bacteria 8124
162 Ga0105239_10068558 3300010375 Bacteria 3898
163 Ga0105239_10267406 3300010375 Bacteria 1922
164 Ga0105239_10456205 3300010375 Bacteria 1450
165 Ga0105239_10839889 3300010375 Bacteria 1053
166 Ga0105239_11285562 3300010375 Bacteria 844
167 Ga0105239_11956118 3300010375 Bacteria 680
168 Ga0105246_10672946 3300011119 Bacteria 904
169 Ga0157342_1031781 3300012507 Bacteria 669
170 Ga0157316_1076043 3300012510 Bacteria 516
171 Ga0157373_10165345 3300013100 Bacteria 1557
172 Ga0157371_10139940 3300013102 Bacteria 1724
173 Ga0157370_10357474 3300013104 Bacteria 1346
174 Ga0157370_10370729 3300013104 Bacteria 1319
175 Ga0157370_10460976 3300013104 Bacteria 1168
176 Ga0157370_10971919 3300013104 Bacteria 769
177 Ga0157369_10062992 3300013105 Bacteria 3996
178 Ga0157369_10329354 3300013105 Bacteria 1587
179 Ga0157369_10811440 3300013105 Unclassified 961
180 Ga0157369_11202177 3300013105 Bacteria 774
181 Ga0157374_10006055 3300013296 Bacteria 10237
182 Ga0157374_10200344 3300013296 Bacteria 1955
183 Ga0157374_10300828 3300013296 Bacteria 1587
184 Ga0157374_10370894 3300013296 Bacteria 1425
185 Ga0157374_10689835 3300013296 Bacteria 1034
186 Ga0157378_10089656 3300013297 Bacteria 2794
187 Ga0157378_10108438 3300013297 Bacteria 2542
188 Ga0157378_10248530 3300013297 Bacteria 1702
189 Ga0157372_10179055 3300013307 Bacteria 2454
190 Ga0157372_10377125 3300013307 Bacteria 1653
191 Ga0157372_10424236 3300013307 Bacteria 1550
192 Ga0157372_12859023 3300013307 Bacteria 553
193 Ga0163163_10088788 3300014325 Bacteria 3103
194 Ga0182008_10343758 3300014497 Bacteria 790
195 Ga0157379_10187549 3300014968 Bacteria 1869
196 Ga0157379_10681620 3300014968 Unclassified 964
197 Ga0157379_10739678 3300014968 Bacteria 925
198 Ga0157379_11060667 3300014968 Bacteria 775
199 Ga0157376_10022876 3300014969 Bacteria 4880
200 Ga0157376_10060427 3300014969 Bacteria 3182
201 Ga0157376_10728399 3300014969 Bacteria 999
202 Ga0206353_10571502 3300020082 Bacteria 1017
203 Ga0209148_1003993 3300025254 Bacteria 3780
204 Ga0209148_1010978 3300025254 Bacteria 1696
205 Ga0209051_1015277 3300025303 Bacteria 3540
206 Ga0207697_10268810 3300025315 Bacteria 755
207 Ga0207656_10002691 3300025321 Bacteria 6031
208 Ga0207656_10016417 3300025321 Bacteria 2882
209 Ga0207692_10756325 3300025898 Bacteria 633
210 Ga0207680_10026720 3300025903 Bacteria 3203
211 Ga0207680_10449822 3300025903 Bacteria 914
212 Ga0207680_10470499 3300025903 Bacteria 893
213 Ga0207680_10519806 3300025903 Bacteria 849
214 Ga0207680_10581202 3300025903 Bacteria 801
215 Ga0207647_10000165 3300025904 Bacteria 52279
216 Ga0207705_10003053 3300025909 Bacteria 12767
217 Ga0207705_10402872 3300025909 Bacteria 1058
218 Ga0207705_10608467 3300025909 Bacteria 850
219 Ga0207654_10055221 3300025911 Bacteria 2299
220 Ga0207654_10192180 3300025911 Bacteria 1339
221 Ga0207707_10092284 3300025912 Bacteria 2646
222 Ga0207695_10000014 3300025913 Bacteria 812599
223 Ga0207695_10017274 3300025913 Bacteria 8401
224 Ga0207695_10058189 3300025913 Bacteria 4013
225 Ga0207695_10329863 3300025913 Bacteria 1415
226 Ga0207695_11193798 3300025913 Bacteria 641
227 Ga0207671_10003966 3300025914 Bacteria 14391
228 Ga0207671_10015454 3300025914 Bacteria 5974
229 Ga0207671_11282749 3300025914 Bacteria 571
230 Ga0207693_10874480 3300025915 Bacteria 690
231 Ga0207663_10040682 3300025916 Bacteria 2827
232 Ga0207657_10020402 3300025919 Bacteria 6263
233 Ga0207657_10429688 3300025919 Bacteria 1037
234 Ga0207649_10026305 3300025920 Bacteria 3403
235 Ga0207649_10157564 3300025920 Bacteria 1570
236 Ga0207649_10250784 3300025920 Bacteria 1275
237 Ga0207649_10288747 3300025920 Bacteria 1195
238 Ga0207649_10310459 3300025920 Bacteria 1156
239 Ga0207694_10000834 3300025924 Bacteria 27450
240 Ga0207694_10001105 3300025924 Bacteria 23357
241 Ga0207694_10001485 3300025924 Bacteria 20023
242 Ga0207694_10021584 3300025924 Bacteria 4879
243 Ga0207694_10068166 3300025924 Bacteria 2778
244 Ga0207694_10092564 3300025924 Bacteria 2387
245 Ga0207694_10512062 3300025924 Bacteria 1005
246 Ga0207650_10226739 3300025925 Bacteria 1506
247 Ga0207650_10383873 3300025925 Bacteria 1160
248 Ga0207687_10236121 3300025927 Bacteria 1446
249 Ga0207687_11939781 3300025927 Bacteria 503
250 Ga0207644_10203561 3300025931 Bacteria 1562
251 Ga0207644_10532553 3300025931 Bacteria 971
252 Ga0207690_10603955 3300025932 Bacteria 896
253 Ga0207690_10619696 3300025932 Bacteria 884
254 Ga0207706_10001649 3300025933 Bacteria 22096
255 Ga0207706_11519814 3300025933 Bacteria 545
256 Ga0207686_10501910 3300025934 Bacteria 941
257 Ga0207704_10016816 3300025938 Bacteria 3771
258 Ga0207711_10000668 3300025941 Bacteria 34112
259 Ga0207711_10582886 3300025941 Unclassified 1043
260 Ga0207711_10781922 3300025941 Bacteria 889
261 Ga0207711_10788389 3300025941 Bacteria 885
262 Ga0207711_11207727 3300025941 Bacteria 698
263 Ga0207689_10140436 3300025942 Unclassified 1990
264 Ga0207661_10162001 3300025944 Bacteria 1942
265 Ga0207679_10303085 3300025945 Bacteria 1378
266 Ga0207679_10671055 3300025945 Bacteria 939
267 Ga0207667_10040542 3300025949 Bacteria 4958
268 Ga0207667_10109700 3300025949 Bacteria 2846
269 Ga0207667_10766431 3300025949 Bacteria 963
270 Ga0207651_10124654 3300025960 Bacteria 1961
271 Ga0207712_10000091 3300025961 Bacteria 103955
272 Ga0207712_10000528 3300025961 Bacteria 31348
273 Ga0207668_10239271 3300025972 Bacteria 1468
274 Ga0207668_11070878 3300025972 Bacteria 722
275 Ga0207668_11304835 3300025972 Bacteria 653
276 Ga0207640_10999111 3300025981 Bacteria 736
277 Ga0207658_10000032 3300025986 Bacteria 162260
278 Ga0207658_10018139 3300025986 Bacteria 4854
279 Ga0207658_10157442 3300025986 Bacteria 1858
280 Ga0207658_10255044 3300025986 Bacteria 1492
281 Ga0207658_10370962 3300025986 Bacteria 1251
282 Ga0207658_10591536 3300025986 Bacteria 996
283 Ga0207658_10890447 3300025986 Bacteria 810
284 Ga0207703_10005509 3300026035 Bacteria 10173
285 Ga0207703_10516604 3300026035 Bacteria 1123
286 Ga0207703_10648208 3300026035 Bacteria 1002
287 Ga0207639_10000526 3300026041 Bacteria 26426
288 Ga0207639_10002558 3300026041 Bacteria 12210
289 Ga0207639_10017625 3300026041 Bacteria 5064
290 Ga0207639_10019332 3300026041 Bacteria 4857
291 Ga0207639_10048590 3300026041 Bacteria 3213
292 Ga0207639_10094521 3300026041 Bacteria 2400
293 Ga0207639_10219530 3300026041 Bacteria 1641
294 Ga0207639_10632205 3300026041 Bacteria 989
295 Ga0207678_10000457 3300026067 Bacteria 37030
296 Ga0207678_10005175 3300026067 Bacteria 11686
297 Ga0207678_10114303 3300026067 Bacteria 2303
298 Ga0207678_10323175 3300026067 Bacteria 1328
299 Ga0207678_10352155 3300026067 Bacteria 1270
300 Ga0207702_10079781 3300026078 Bacteria 2838
301 Ga0207702_10596753 3300026078 Bacteria 1083
302 Ga0207641_10021278 3300026088 Bacteria 5332
303 Ga0207641_10118924 3300026088 Bacteria 2354
304 Ga0207641_10392126 3300026088 Bacteria 1332
305 Ga0207676_10557737 3300026095 Bacteria 1095
306 Ga0207676_12516219 3300026095 Bacteria 511
307 Ga0207674_10045461 3300026116 Bacteria 4516
308 Ga0207674_10152167 3300026116 Bacteria 2270
309 Ga0207674_10291084 3300026116 Bacteria 1582
310 Ga0207674_10402894 3300026116 Bacteria 1322
311 Ga0207675_101159922 3300026118 Bacteria 793
312 Ga0207683_10313271 3300026121 Bacteria 1437
313 Ga0207698_10111434 3300026142 Bacteria 2294
314 Ga0207698_10343248 3300026142 Bacteria 1407
315 Ga0207698_10397817 3300026142 Bacteria 1316
316 Ga0207698_10438260 3300026142 Bacteria 1258
317 Ga0207698_10478087 3300026142 Bacteria 1208
318 Ga0268266_10000007 3300028379 Bacteria 1372921
319 Ga0268266_10000091 3300028379 Bacteria 195002
320 Ga0268266_10018317 3300028379 Bacteria 5969
321 Ga0268266_10026124 3300028379 Bacteria 4969
322 Ga0268266_10192567 3300028379 Bacteria 1862
323 Ga0268266_10212308 3300028379 Bacteria 1775
324 Ga0268266_10533630 3300028379 Bacteria 1123
325 Ga0268266_11216436 3300028379 Bacteria 728
326 Ga0268265_10182243 3300028380 Bacteria 1805
327 Ga0268265_11608265 3300028380 Unclassified 655
328 Ga0268264_10355825 3300028381 Bacteria 1395
329 Ga0268264_10588873 3300028381 Bacteria 1095
330 Ga0265327_10021956 3300031251 Bacteria 3834
331 Ga0265316_10949389 3300031344 Unclassified 599
332 Ga0307408_100198638 3300031548 Bacteria 1621
333 Ga0307408_102314256 3300031548 Bacteria 520
334 Ga0307508_10143052 3300031616 Bacteria 1996
335 Ga0316575_10208120 3300031665 Bacteria 815
336 Ga0265342_10307750 3300031712 Unclassified 833
337 Ga0316576_10123631 3300031727 Bacteria 1944
338 Ga0316578_10129773 3300031728 Bacteria 1516
339 Ga0316578_10180173 3300031728 Bacteria 1273
340 Ga0307405_10013935 3300031731 Bacteria 4306
341 Ga0307405_10320443 3300031731 Bacteria 1184
342 Ga0316577_10034941 3300031733 Bacteria 2809
343 Ga0307410_10385595 3300031852 Bacteria 1128
344 Ga0307410_10412489 3300031852 Bacteria 1094
345 Ga0307406_10093690 3300031901 Bacteria 2028
346 Ga0307407_10100168 3300031903 Bacteria 1796
347 Ga0307407_10844784 3300031903 Bacteria 699
348 Ga0307412_10085500 3300031911 Bacteria 2192
349 Ga0307412_10166877 3300031911 Bacteria 1642
350 Ga0307409_100154122 3300031995 Bacteria 1999
351 Ga0307416_100061239 3300032002 Bacteria 3070
352 Ga0307416_100107303 3300032002 Bacteria 2450
353 Ga0307414_10074539 3300032004 Bacteria 2459
354 Ga0307414_10103862 3300032004 Bacteria 2145
355 Ga0307414_10153711 3300032004 Bacteria 1819
356 Ga0307414_10266081 3300032004 Bacteria 1433
357 Ga0307411_10491603 3300032005 Bacteria 1035
358 Ga0307415_100039281 3300032126 Bacteria 3126
359 Ga0316593_10192380 3300032168 Bacteria 752
360 Ga0307507_10114497 3300033179 Bacteria 2187
361 Ga0307510_10000371 3300033180 Bacteria 42503
362 Ga0307510_10030485 3300033180 Bacteria 6113
363 Ga0307510_10179256 3300033180 Bacteria 1684
364 Ga0373944_0121698 3300035089 Bacteria 900
365 Ga0373935_0689150 3300035692 Unclassified 751
366 Ga0373933_0544559 3300035724 Bacteria 761
367 Ga0373933_0895432 3300035724 Bacteria 584
368 Ga0373947_1057965 3300035725 Unclassified 553
369 Ga0373937_0365792 3300036401 Bacteria 1367
370 Ga0316584_0175502 3300036712 Bacteria 1587
371 Ga0373925_0161915 3300037068 Bacteria 1763
372 Ga0395900_0021012 3300037418 Bacteria 6672
373 Ga0395898_0041088 3300037466 Bacteria 4570
374 Ga0395905_0751911 3300037471 Bacteria 877
375 Ga0436365_0465446 3300039437 Bacteria 658
376 Ga0439461_0159944 3300041410 Unclassified 586
377 Ga0451787_180292 3300041441 Bacteria 2637
378 Ga0451787_273796 3300041441 Bacteria 978
379 Ga0451791_0485412 3300041451 Bacteria 569
380 Ga0451793_1360733 3300041452 Bacteria 2101
381 Ga0451795_0595672 3300041456 Bacteria 2439
382 Ga0451798_1169784 3300041458 Bacteria 601
383 Ga0451802_1535442 3300041460 Bacteria 4664
384 Ga0451807_1468747 3300041486 Bacteria 1250
385 Ga0451807_2366962 3300041486 Bacteria 537
386 Ga0451839_0482432 3300041496 Bacteria 631
387 Ga0451839_1233145 3300041496 Bacteria 638
388 Ga0451841_1052641 3300041498 Unclassified 1222
389 Ga0451847_0078724 3300041503 Bacteria 965
390 Ga0451849_0585986 3300041505 Bacteria 696
391 Ga0451853_0601292 3300041512 Bacteria 725
392 Ga0451853_0917884 3300041512 Bacteria 1299
393 Ga0451853_1107313 3300041512 Bacteria 569
394 Ga0451853_2932703 3300041512 Bacteria 613
395 Ga0451853_3099830 3300041512 Bacteria 2541
396 Ga0451853_4060710 3300041512 Bacteria 2790
397 Ga0439449_0030060 3300042007 Bacteria 2024
398 Ga0439434_0002053 3300042435 Bacteria 5824
399 Ga0451577_0123547 3300042876 Bacteria 2319
400 Ga0466965_0623268 3300044683 Bacteria 614
401 Ga0466963_0293701 3300044694 Bacteria 1143
402 Ga0453684_0814177 3300044712 Bacteria 1006
403 Ga0466957_0159628 3300044842 Bacteria 1464
404 Ga0495617_019306 3300046452 Bacteria 2305
405 Ga0495591_026649 3300046458 Bacteria 1792
406 Ga0495641_0120666 3300046461 Bacteria 1170
407 Ga0495650_0000469 3300046471 Bacteria 62135
408 Ga0495650_0000938 3300046471 Bacteria 33877
409 Ga0495605_0005959 3300046474 Bacteria 7050
410 Ga0495662_0115743 3300046476 Unclassified 1315
411 Ga0495584_0004494 3300046491 Bacteria 7497
412 Ga0495585_0047547 3300046492 Bacteria 2389
413 Ga0495594_0570209 3300046499 Bacteria 642
414 Ga0495596_0003775 3300046500 Bacteria 7562
415 Ga0495607_0072580 3300046501 Bacteria 1915
416 Ga0495583_0004768 3300046506 Bacteria 9518
417 Ga0495606_0005762 3300046507 Bacteria 11710
418 Ga0495606_0029759 3300046507 Bacteria 3827
419 Ga0495610_0032833 3300046512 Bacteria 2690
420 Ga0495616_0054401 3300046513 Bacteria 1985
421 Ga0495620_0061109 3300046515 Bacteria 1568
422 Ga0495630_0121219 3300046517 Bacteria 1984
423 Ga0495631_0028246 3300046518 Bacteria 2559
424 Ga0495632_0020709 3300046519 Bacteria 3555
425 Ga0495637_0000566 3300046520 Bacteria 26443
426 Ga0495644_0002936 3300046523 Bacteria 6776
427 Ga0495648_0102285 3300046524 Bacteria 1578
428 Ga0495666_0039784 3300046526 Bacteria 2282
429 Ga0495654_0008248 3300046530 Bacteria 5764
430 Ga0495654_0090586 3300046530 Bacteria 1420
431 Ga0495640_0081634 3300046533 Bacteria 2149
432 Ga0495586_0208947 3300046535 Bacteria 1107
433 Ga0495587_0143229 3300046536 Bacteria 1363
434 Ga0495609_0000398 3300046538 Bacteria 36528
435 Ga0495622_0065300 3300046557 Bacteria 1682
436 Ga0495668_0078430 3300046616 Bacteria 1813
437 Ga0495611_0000933 3300046648 Bacteria 15696
438 Ga0495625_0000113 3300046660 Bacteria 124185
439 Ga0495625_0009647 3300046660 Bacteria 8048
440 Ga0495661_0000791 3300046665 Bacteria 30044
441 Ga0495588_0209897 3300046674 Unclassified 1028
442 Ga0495599_0452672 3300046678 Bacteria 760
443 Ga0495658_0027365 3300046683 Bacteria 3068
444 Ga0495670_0337394 3300046691 Bacteria 810
445 Ga0495671_0082161 3300046692 Bacteria 1578
446 Ga0495649_0003780 3300046694 Bacteria 10042
447 Ga0495660_0032625 3300046810 Bacteria 2923
448 Ga0495660_0035527 3300046810 Bacteria 2783
449 Ga0495660_0050207 3300046810 Bacteria 2273
450 Ga0495674_0554955 3300047319 Bacteria 914
451 Ga0495672_0039807 3300047320 Bacteria 2856
452 Ga0495676_0000032 3300047321 Bacteria 131215
453 Ga0495679_000280 3300047446 Bacteria 42647
454 Ga0495673_0010392 3300047469 Bacteria 5065
455 Ga0495673_0280824 3300047469 Bacteria 601
456 Ga0495681_0009434 3300047470 Bacteria 6014
457 Ga0495626_0000024 3300048091 Bacteria 214179
458 Ga0496102_0060360 3300048905 Bacteria 3468
459 Ga0496102_1875741 3300048905 Bacteria 516
460 Ga0496104_1424521 3300048907 Bacteria 596
461 Ga0496108_0594999 3300048911 Bacteria 964
462 Ga0496112_1201501 3300048915 Bacteria 675
463 Ga0496115_0000043 3300048918 Bacteria 116422
464 Ga0496115_0687141 3300048918 Bacteria 806
465 Ga0496117_0120598 3300048920 Bacteria 1612
466 Ga0496118_0014204 3300048921 Bacteria 7468
467 Ga0496121_0088640 3300048924 Bacteria 2425
468 Ga0496122_0001004 3300048925 Bacteria 49981
469 Ga0496123_0001241 3300048926 Bacteria 36928
470 Ga0496123_0269973 3300048926 Unclassified 828
471 Ga0496126_0000087 3300048929 Bacteria 215031
472 Ga0496126_0076062 3300048929 Bacteria 2979
473 Ga0496126_0300685 3300048929 Bacteria 1324
474 Ga0495678_001693 3300049459 Bacteria 16659
475 Ga0495682_0001720 3300049460 Bacteria 11098
476 Ga0501033_0511675 3300049570 Bacteria 830
477 Ga0501034_0001232 3300049571 Bacteria 34779
478 Ga0501034_0680693 3300049571 Bacteria 928
479 Ga0501037_0063713 3300049573 Bacteria 2687
480 Ga0501037_1118008 3300049573 Bacteria 510
481 Ga0501038_0086862 3300049574 Bacteria 2627
482 Ga0501038_0251306 3300049574 Bacteria 1400
483 Ga0501039_0235859 3300049575 Unclassified 1438
484 Ga0501040_0921659 3300049576 Bacteria 633
485 Ga0501042_0145347 3300049578 Bacteria 1710
486 Ga0501042_0971167 3300049578 Bacteria 619
487 Ga0501043_0142742 3300049579 Bacteria 1875
488 Ga0501043_1066126 3300049579 Bacteria 572
489 Ga0501046_0076441 3300049580 Bacteria 2594
490 Ga0501047_0213224 3300049581 Bacteria 1789
491 Ga0501047_0471579 3300049581 Bacteria 1083
492 Ga0501047_0714426 3300049581 Bacteria 819
493 Ga0501047_1001121 3300049581 Bacteria 649
494 Ga0501048_0151090 3300049582 Unclassified 1643
495 Ga0501048_0502916 3300049582 Bacteria 869
496 Ga0501067_0140242 3300049583 Bacteria 1346
497 Ga0501068_0085155 3300049584 Bacteria 1945
498 Ga0501068_0215513 3300049584 Bacteria 1220
499 Ga0501068_0238806 3300049584 Bacteria 1156
500 Ga0501070_0006066 3300049586 Bacteria 10295
501 Ga0501070_0253734 3300049586 Bacteria 1438
502 Ga0501070_1108335 3300049586 Unclassified 610
503 Ga0501071_1401107 3300049587 Bacteria 540
504 Ga0501072_0158863 3300049588 Bacteria 1803
505 Ga0501073_0227875 3300049589 Bacteria 1287
506 Ga0501073_0352592 3300049589 Bacteria 1016
507 Ga0501074_0053528 3300049590 Bacteria 2911
508 Ga0501075_0014604 3300049591 Bacteria 5627
509 Ga0501076_0053079 3300049592 Bacteria 3212
510 Ga0501076_1466924 3300049592 Bacteria 560
511 Ga0501080_0074775 3300049742 Bacteria 3151
512 Ga0501080_0080893 3300049742 Bacteria 3019
513 Ga0501080_0125439 3300049742 Bacteria 2378
514 Ga0501080_0153818 3300049742 Bacteria 2125
515 Ga0501081_0211925 3300049743 Bacteria 1407
516 Ga0501083_0146165 3300049744 Bacteria 1548
517 Ga0501083_0449238 3300049744 Bacteria 839
518 Ga0501035_0829288 3300049822 Bacteria 737
519 Ga0501035_0999448 3300049822 Bacteria 658
520 Ga0501044_0050657 3300049823 Bacteria 4283
521 Ga0501044_0994155 3300049823 Bacteria 711
522 Ga0500635_0109928 3300053080 Bacteria 1023
523 Ga0500646_0011258 3300053090 Bacteria 2299
524 Ga0500651_0169909 3300053093 Bacteria 1300
525 Ga0500568_0003512 3300053139 Bacteria 8693
526 Ga0501084_0301160 3300054114 Bacteria 1354
527 Ga0500661_010529 3300055283 Bacteria 1683
528 Ga0501082_0000037 3300060353 Bacteria 94327
529 2525556455 2524614729 Bacteria 3091755
530 2630649684 2627854209 Bacteria 3093011
531 2678266279 2675903515 Bacteria 6580491
532 2745007511 2744054620 Bacteria 6551379
533 2929150053 2929144301 Bacteria 6622272
534 Ga0373931_0473846
535 JGI25162J39368_1000134
536 rootH1_10000877
537 rootL2_10124050
538 Ga0055542_1015891
539 Ga0070658_10003789
540 Ga0070658_10230973
541 Ga0070676_11336393
542 Ga0070683_100408723
543 Ga0070670_100047475
544 Ga0070670_100112379
545 Ga0070670_100675204
546 Ga0068869_100124403
547 Ga0068869_100899442
548 Ga0070666_10003714
549 Ga0070666_10077742
550 Ga0070666_10352238
551 Ga0070666_10578636
552 Ga0070666_10823605
553 Ga0070680_100179608
554 Ga0070682_100881567
555 Ga0070682_100992751
556 Ga0068868_100043692
557 Ga0068868_101533921
558 Ga0070660_100031760
559 Ga0070661_100090909
560 Ga0070661_100159738
561 Ga0070661_100200518
562 Ga0070661_100309732
563 Ga0070661_100508949
564 Ga0070661_100731728
565 Ga0070661_100869710
566 Ga0070661_101373980
567 Ga0070668_100041046
568 Ga0070668_100671985
569 Ga0070668_101351255
570 Ga0070668_101530974
571 Ga0070671_100244431
572 Ga0070671_100447825
573 Ga0070671_100568947
574 Ga0070659_100170072
575 Ga0070659_100718323
576 Ga0070667_100000085
577 Ga0070667_100046860
578 Ga0070667_100102226
579 Ga0070667_100202732
580 Ga0070667_101410007
581 Ga0070709_11099579
582 Ga0070713_100694317
583 Ga0070710_10719007
584 Ga0070710_10993579
585 Ga0070711_100062599
586 Ga0070705_100647531
587 Ga0070663_100000045
588 Ga0070663_100006942
589 Ga0070663_100251376
590 Ga0070662_100022597
591 Ga0070681_10033465
592 Ga0070685_10000387
593 Ga0070679_100068470
594 Ga0070679_101067620
595 Ga0068853_100002370
596 Ga0068853_100005041
597 Ga0068853_100018417
598 Ga0068853_100029765
599 Ga0068853_100066540
600 Ga0068853_100105886
601 Ga0068853_100225064
602 Ga0070696_100556580
603 Ga0070693_100057167
604 Ga0070693_100754926
605 Ga0070665_100011703
606 Ga0070665_100041145
607 Ga0070665_100048270
608 Ga0070665_100082296
609 Ga0070665_100674544
610 Ga0068855_100016597
611 Ga0068855_100059623
612 Ga0068855_100180030
613 Ga0068855_100247182
614 Ga0068855_100538789
615 Ga0068855_101317904
616 Ga0070664_100329034
617 Ga0070664_101171123
618 Ga0070664_101206384
619 Ga0068857_100200756
620 Ga0068857_100470541
621 Ga0068857_100485889
622 Ga0068857_101650792
623 Ga0068854_100486847
624 Ga0068854_101584541
625 Ga0068856_100076606
626 Ga0068856_100371745
627 Ga0068852_100018636
628 Ga0068852_100112215
629 Ga0068852_100129642
630 Ga0068852_100268139
631 Ga0068852_100496649
632 Ga0068852_100892094
633 Ga0068852_100966239
634 Ga0068859_100061631
635 Ga0068864_100853708
636 Ga0068864_101842133
637 Ga0068851_10000416
638 Ga0068851_10114949
639 Ga0068851_10224379
640 Ga0068863_100014666
641 Ga0068863_100061266
642 Ga0068863_100706971
643 Ga0068858_100001311
644 Ga0068858_100102724
645 Ga0068858_100110401
646 Ga0068858_100953233
647 Ga0068858_101522821
648 Ga0068860_100863528
649 Ga0068862_100194446
650 Ga0081455_10232541
651 Ga0081455_10390911
652 Ga0070716_100380863
653 Ga0070712_100494983
654 Ga0097621_100229198
655 Ga0097621_100308669
656 Ga0097621_100829685
657 Ga0097621_101428079
658 Ga0068871_100045282
659 Ga0068871_100243451
660 Ga0068871_100461265
661 Ga0068871_100889727
662 Ga0068865_100059156
663 Ga0097620_100061635
664 Ga0105240_10007411
665 Ga0105240_10010575
666 Ga0105240_11732668
667 Ga0105245_10369562
668 Ga0105245_11250045
669 Ga0105245_12093473
670 Ga0105245_12336981
671 Ga0105241_10055627
672 Ga0105241_11611925
673 Ga0105242_10246670
674 Ga0105248_10000534
675 Ga0105248_10274086
676 Ga0105248_10984306
677 Ga0105248_11082799
678 Ga0105248_11301364
679 Ga0105237_10000960
680 Ga0105237_10055411
681 Ga0105237_10095203
682 Ga0105237_10347659
683 Ga0105237_11116984
684 Ga0105238_10000266
685 Ga0105238_10007763
686 Ga0105238_10009038
687 Ga0105238_10013869
688 Ga0105238_10440474
689 Ga0105238_10638459
690 Ga0105238_11176862
691 Ga0105249_10000659
692 Ga0105249_10012434
693 Ga0105239_10016659
694 Ga0105239_10068558
695 Ga0105239_10267406
696 Ga0105239_10456205
697 Ga0105239_10839889
698 Ga0105239_11285562
699 Ga0105239_11956118
700 Ga0105246_10672946
701 Ga0157342_1031781
702 Ga0157316_1076043
703 Ga0157373_10165345
704 Ga0157371_10139940
705 Ga0157370_10357474
706 Ga0157370_10370729
707 Ga0157370_10460976
708 Ga0157370_10971919
709 Ga0157369_10062992
710 Ga0157369_10329354
711 Ga0157369_10811440
712 Ga0157369_11202177
713 Ga0157374_10006055
714 Ga0157374_10200344
715 Ga0157374_10300828
716 Ga0157374_10370894
717 Ga0157374_10689835
718 Ga0157378_10089656
719 Ga0157378_10108438
720 Ga0157378_10248530
721 Ga0157372_10179055
722 Ga0157372_10377125
723 Ga0157372_10424236
724 Ga0157372_12859023
725 Ga0163163_10088788
726 Ga0182008_10343758
727 Ga0157379_10187549
728 Ga0157379_10681620
729 Ga0157379_10739678
730 Ga0157379_11060667
731 Ga0157376_10022876
732 Ga0157376_10060427
733 Ga0157376_10728399
734 Ga0206353_10571502
735 Ga0209148_1003993
736 Ga0209148_1010978
737 Ga0209051_1015277
738 Ga0207697_10268810
739 Ga0207656_10002691
740 Ga0207656_10016417
741 Ga0207692_10756325
742 Ga0207680_10026720
743 Ga0207680_10449822
744 Ga0207680_10470499
745 Ga0207680_10519806
746 Ga0207680_10581202
747 Ga0207647_10000165
748 Ga0207705_10003053
749 Ga0207705_10402872
750 Ga0207705_10608467
751 Ga0207654_10055221
752 Ga0207654_10192180
753 Ga0207707_10092284
754 Ga0207695_10000014
755 Ga0207695_10017274
756 Ga0207695_10058189
757 Ga0207695_10329863
758 Ga0207695_11193798
759 Ga0207671_10003966
760 Ga0207671_10015454
761 Ga0207671_11282749
762 Ga0207693_10874480
763 Ga0207663_10040682
764 Ga0207657_10020402
765 Ga0207657_10429688
766 Ga0207649_10026305
767 Ga0207649_10157564
768 Ga0207649_10250784
769 Ga0207649_10288747
770 Ga0207649_10310459
771 Ga0207694_10000834
772 Ga0207694_10001105
773 Ga0207694_10001485
774 Ga0207694_10021584
775 Ga0207694_10068166
776 Ga0207694_10092564
777 Ga0207694_10512062
778 Ga0207650_10226739
779 Ga0207650_10383873
780 Ga0207687_10236121
781 Ga0207687_11939781
782 Ga0207644_10203561
783 Ga0207644_10532553
784 Ga0207690_10603955
785 Ga0207690_10619696
786 Ga0207706_10001649
787 Ga0207706_11519814
788 Ga0207686_10501910
789 Ga0207704_10016816
790 Ga0207711_10000668
791 Ga0207711_10582886
792 Ga0207711_10781922
793 Ga0207711_10788389
794 Ga0207711_11207727
795 Ga0207689_10140436
796 Ga0207661_10162001
797 Ga0207679_10303085
798 Ga0207679_10671055
799 Ga0207667_10040542
800 Ga0207667_10109700
801 Ga0207667_10766431
802 Ga0207651_10124654
803 Ga0207712_10000091
804 Ga0207712_10000528
805 Ga0207668_10239271
806 Ga0207668_11070878
807 Ga0207668_11304835
808 Ga0207640_10999111
809 Ga0207658_10000032
810 Ga0207658_10018139
811 Ga0207658_10157442
812 Ga0207658_10255044
813 Ga0207658_10370962
814 Ga0207658_10591536
815 Ga0207658_10890447
816 Ga0207703_10005509
817 Ga0207703_10516604
818 Ga0207703_10648208
819 Ga0207639_10000526
820 Ga0207639_10002558
821 Ga0207639_10017625
822 Ga0207639_10019332
823 Ga0207639_10048590
824 Ga0207639_10094521
825 Ga0207639_10219530
826 Ga0207639_10632205
827 Ga0207678_10000457
828 Ga0207678_10005175
829 Ga0207678_10114303
830 Ga0207678_10323175
831 Ga0207678_10352155
832 Ga0207702_10079781
833 Ga0207702_10596753
834 Ga0207641_10021278
835 Ga0207641_10118924
836 Ga0207641_10392126
837 Ga0207676_10557737
838 Ga0207676_12516219
839 Ga0207674_10045461
840 Ga0207674_10152167
841 Ga0207674_10291084
842 Ga0207674_10402894
843 Ga0207675_101159922
844 Ga0207683_10313271
845 Ga0207698_10111434
846 Ga0207698_10343248
847 Ga0207698_10397817
848 Ga0207698_10438260
849 Ga0207698_10478087
850 Ga0268266_10000007
851 Ga0268266_10000091
852 Ga0268266_10018317
853 Ga0268266_10026124
854 Ga0268266_10192567
855 Ga0268266_10212308
856 Ga0268266_10533630
857 Ga0268266_11216436
858 Ga0268265_10182243
859 Ga0268265_11608265
860 Ga0268264_10355825
861 Ga0268264_10588873
862 Ga0265327_10021956
863 Ga0265316_10949389
864 Ga0307408_100198638
865 Ga0307408_102314256
866 Ga0307508_10143052
867 Ga0316575_10208120
868 Ga0265342_10307750
869 Ga0316576_10123631
870 Ga0316578_10129773
871 Ga0316578_10180173
872 Ga0307405_10013935
873 Ga0307405_10320443
874 Ga0316577_10034941
875 Ga0307410_10385595
876 Ga0307410_10412489
877 Ga0307406_10093690
878 Ga0307407_10100168
879 Ga0307407_10844784
880 Ga0307412_10085500
881 Ga0307412_10166877
882 Ga0307409_100154122
883 Ga0307416_100061239
884 Ga0307416_100107303
885 Ga0307414_10074539
886 Ga0307414_10103862
887 Ga0307414_10153711
888 Ga0307414_10266081
889 Ga0307411_10491603
890 Ga0307415_100039281
891 Ga0316593_10192380
892 Ga0307507_10114497
893 Ga0307510_10000371
894 Ga0307510_10030485
895 Ga0307510_10179256
896 Ga0373944_0121698
897 Ga0373935_0689150
898 Ga0373933_0544559
899 Ga0373933_0895432
900 Ga0373947_1057965
901 Ga0373937_0365792
902 Ga0316584_0175502
903 Ga0373925_0161915
904 Ga0395900_0021012
905 Ga0395898_0041088
906 Ga0395905_0751911
907 Ga0436365_0465446
908 Ga0439461_0159944
909 Ga0451787_180292
910 Ga0451787_273796
911 Ga0451791_0485412
912 Ga0451793_1360733
913 Ga0451795_0595672
914 Ga0451798_1169784
915 Ga0451802_1535442
916 Ga0451807_1468747
917 Ga0451807_2366962
918 Ga0451839_0482432
919 Ga0451839_1233145
920 Ga0451841_1052641
921 Ga0451847_0078724
922 Ga0451849_0585986
923 Ga0451853_0601292
924 Ga0451853_0917884
925 Ga0451853_1107313
926 Ga0451853_2932703
927 Ga0451853_3099830
928 Ga0451853_4060710
929 Ga0439449_0030060
930 Ga0439434_0002053
931 Ga0451577_0123547
932 Ga0466965_0623268
933 Ga0466963_0293701
934 Ga0453684_0814177
935 Ga0466957_0159628
936 Ga0495617_019306
937 Ga0495591_026649
938 Ga0495641_0120666
939 Ga0495650_0000469
940 Ga0495650_0000938
941 Ga0495605_0005959
942 Ga0495662_0115743
943 Ga0495584_0004494
944 Ga0495585_0047547
945 Ga0495594_0570209
946 Ga0495596_0003775
947 Ga0495607_0072580
948 Ga0495583_0004768
949 Ga0495606_0005762
950 Ga0495606_0029759
951 Ga0495610_0032833
952 Ga0495616_0054401
953 Ga0495620_0061109
954 Ga0495630_0121219
955 Ga0495631_0028246
956 Ga0495632_0020709
957 Ga0495637_0000566
958 Ga0495644_0002936
959 Ga0495648_0102285
960 Ga0495666_0039784
961 Ga0495654_0008248
962 Ga0495654_0090586
963 Ga0495640_0081634
964 Ga0495586_0208947
965 Ga0495587_0143229
966 Ga0495609_0000398
967 Ga0495622_0065300
968 Ga0495668_0078430
969 Ga0495611_0000933
970 Ga0495625_0000113
971 Ga0495625_0009647
972 Ga0495661_0000791
973 Ga0495588_0209897
974 Ga0495599_0452672
975 Ga0495658_0027365
976 Ga0495670_0337394
977 Ga0495671_0082161
978 Ga0495649_0003780
979 Ga0495660_0032625
980 Ga0495660_0035527
981 Ga0495660_0050207
982 Ga0495674_0554955
983 Ga0495672_0039807
984 Ga0495676_0000032
985 Ga0495679_000280
986 Ga0495673_0010392
987 Ga0495673_0280824
988 Ga0495681_0009434
989 Ga0495626_0000024
990 Ga0496102_0060360
991 Ga0496102_1875741
992 Ga0496104_1424521
993 Ga0496108_0594999
994 Ga0496112_1201501
995 Ga0496115_0000043
996 Ga0496115_0687141
997 Ga0496117_0120598
998 Ga0496118_0014204
999 Ga0496121_0088640
1000 Ga0496122_0001004
1001 Ga0496123_0001241
1002 Ga0496123_0269973
1003 Ga0496126_0000087
1004 Ga0496126_0076062
1005 Ga0496126_0300685
1006 Ga0495678_001693
1007 Ga0495682_0001720
1008 Ga0501033_0511675
1009 Ga0501034_0001232
1010 Ga0501034_0680693
1011 Ga0501037_0063713
1012 Ga0501037_1118008
1013 Ga0501038_0086862
1014 Ga0501038_0251306
1015 Ga0501039_0235859
1016 Ga0501040_0921659
1017 Ga0501042_0145347
1018 Ga0501042_0971167
1019 Ga0501043_0142742
1020 Ga0501043_1066126
1021 Ga0501046_0076441
1022 Ga0501047_0213224
1023 Ga0501047_0471579
1024 Ga0501047_0714426
1025 Ga0501047_1001121
1026 Ga0501048_0151090
1027 Ga0501048_0502916
1028 Ga0501067_0140242
1029 Ga0501068_0085155
1030 Ga0501068_0215513
1031 Ga0501068_0238806
1032 Ga0501070_0006066
1033 Ga0501070_0253734
1034 Ga0501070_1108335
1035 Ga0501071_1401107
1036 Ga0501072_0158863
1037 Ga0501073_0227875
1038 Ga0501073_0352592
1039 Ga0501074_0053528
1040 Ga0501075_0014604
1041 Ga0501076_0053079
1042 Ga0501076_1466924
1043 Ga0501080_0074775
1044 Ga0501080_0080893
1045 Ga0501080_0125439
1046 Ga0501080_0153818
1047 Ga0501081_0211925
1048 Ga0501083_0146165
1049 Ga0501083_0449238
1050 Ga0501035_0829288
1051 Ga0501035_0999448
1052 Ga0501044_0050657
1053 Ga0501044_0994155
1054 Ga0500635_0109928
1055 Ga0500646_0011258
1056 Ga0500651_0169909
1057 Ga0500568_0003512
1058 Ga0501084_0301160
1059 Ga0500661_010529
1060 Ga0501082_0000037
1061 2525556455
1062 2630649684
1063 2678266279
1064 2745007511
1065 2929150053

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

29

147

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k0t-assembly1.cif.gz_B crystal structure of pspto -psp protein in complex with d-beta-glucose from pseudomonas syringae pv. tomato str. dc3000 0.9991 4 125
1xrg-assembly1.cif.gz_C conserved hypothetical protein from clostridium thermocellum cth-2968 0.9902 3 124
1xrg-assembly1.cif.gz_A conserved hypothetical protein from clostridium thermocellum cth-2968 0.9899 2 124
3r0p-assembly2.cif.gz_C crystal structure of l-psp putative endoribonuclease from uncultured organism 0.9863 2 125
1nq3-assembly2.cif.gz_E crystal structure of the mammalian tumor associated antigen uk114 0.9847 2 126
ID Description Score Start End Superfamily
3k0tB00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9902 4 125 3.30.1330.40
1nq3C00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9838 2 126 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9808 19 125 3.30.1330.40
af_Q86KR5_2_129_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.978 1 126 3.30.1330.40
3mqwD00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9766 3 125 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A521XWT5-F1-model_v4 RidA family protein 0.9982 2 126 GO:0005829
GO:0019239
AF-A0A6L5C5P4-F1-model_v4 deleted 0.9977 1 126
AF-A0A1S0VBZ2-F1-model_v4 deleted 0.9966 1 126
AF-A0A011PB35-F1-model_v4 Enamine/imine deaminase (EC 3.5.4.-) 0.9965 1 126 GO:0005829
GO:0019239
AF-I4VRJ6-F1-model_v4 Endoribonuclease L-PSP 0.9962 2 126 GO:0005829
GO:0019239

Map