F460228

General Info

Members Datasets Scaffolds Average Seq Length
532 293 521 165

Family's Representative Sequence

Representative Sequence 3300005345|Ga0070692_10164435|Ga0070692_101644352
Length 192
Sequence MMLAHSQQTKNNAGLLLRQGPGVLMSETPPSRALITEAAAELLRRLQARHGALMFHQSGGCCDGSSPMCYLDGEFLVGDRDVLLSILDVGSDGVPVWISGPQFEAWKHTQLVIDVVPGRGGGFSLEAPEGMRFLSRGRAFTDAENQLLANHPPVSGAGYAGGARPPQTGTQIVAEAVDACPVPGGRAAPVQA

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
4 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
5 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
6 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
7 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
8 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
9 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
10 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
11 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
12 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
13 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
159 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
160 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
161 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
169 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
170 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
171 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
172 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
173 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
174 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
175 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
178 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
179 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
180 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
187 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
198 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
205 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
206 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
207 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
217 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
222 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
223 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
224 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
244 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
245 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
248 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
249 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
250 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
251 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
267 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
268 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
269 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
270 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
271 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
272 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
273 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
277 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
278 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
279 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
280 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
282 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
283 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
284 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
285 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
286 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
287 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
288 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
289 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
290 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
291 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
292 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
293 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.93
Metatranscriptomes 0
Isolates 2.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.98
Nodule 0.19
Rhizoplane 12.22
Rhizosphere 60.71
Stem 0
Stem Tuber 0
Unclassified 10.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1002778 3300001977 Bacteria 2759
2 JGI24750J21931_1031643 3300002070 Bacteria 778
3 JGI24744J21845_10022419 3300002077 Bacteria 1241
4 Ga0055540_1000069 3300003792 Bacteria 119560
5 Ga0055540_1001260 3300003792 Bacteria 15428
6 Ga0055540_1004053 3300003792 Bacteria 6806
7 Ga0055540_1004594 3300003792 Bacteria 6135
8 Ga0070676_10265359 3300005328 Bacteria 1151
9 Ga0070690_100403928 3300005330 Bacteria 1004
10 Ga0068869_100214318 3300005334 Bacteria 1524
11 Ga0068869_100667134 3300005334 Bacteria 884
12 Ga0070666_10062630 3300005335 Bacteria 2520
13 Ga0070682_100160790 3300005337 Bacteria 1551
14 Ga0070682_100297656 3300005337 Bacteria 1183
15 Ga0068868_100666336 3300005338 Bacteria 928
16 Ga0068868_101125525 3300005338 Bacteria 723
17 Ga0070660_100907309 3300005339 Bacteria 743
18 Ga0070689_100142744 3300005340 Bacteria 1927
19 Ga0070691_10092103 3300005341 Bacteria 1495
20 Ga0070687_100635367 3300005343 Bacteria 738
21 Ga0070692_10164435 3300005345 Bacteria 1274
22 Ga0070668_100197239 3300005347 Bacteria 1651
23 Ga0070668_100253920 3300005347 Bacteria 1460
24 Ga0070668_101617424 3300005347 Bacteria 594
25 Ga0070674_100088159 3300005356 Bacteria 2233
26 Ga0070674_100668637 3300005356 Bacteria 884
27 Ga0070673_100658546 3300005364 Bacteria 959
28 Ga0070688_100161712 3300005365 Bacteria 1539
29 Ga0070659_100060964 3300005366 Bacteria 2981
30 Ga0070659_100131777 3300005366 Bacteria 2031
31 Ga0070667_100000944 3300005367 Bacteria 26746
32 Ga0070667_100109528 3300005367 Bacteria 2394
33 Ga0070709_10173545 3300005434 Bacteria 1508
34 Ga0070714_100032429 3300005435 Bacteria 4360
35 Ga0070714_100921800 3300005435 Bacteria 849
36 Ga0070710_10188800 3300005437 Bacteria 1295
37 Ga0070701_10259458 3300005438 Bacteria 1053
38 Ga0070700_100130634 3300005441 Bacteria 1694
39 Ga0070694_100481376 3300005444 Bacteria 985
40 Ga0070663_100604730 3300005455 Bacteria 922
41 Ga0070663_100640317 3300005455 Bacteria 898
42 Ga0070663_100760809 3300005455 Bacteria 828
43 Ga0070678_101463519 3300005456 Bacteria 639
44 Ga0070662_100222160 3300005457 Bacteria 1507
45 Ga0070681_10942871 3300005458 Bacteria 782
46 Ga0068867_100412658 3300005459 Bacteria 1142
47 Ga0070685_10259599 3300005466 Bacteria 1155
48 Ga0070684_100527639 3300005535 Bacteria 1095
49 Ga0068853_100020960 3300005539 Bacteria 5440
50 Ga0068853_100745811 3300005539 Bacteria 936
51 Ga0070686_100767197 3300005544 Bacteria 775
52 Ga0070696_100260533 3300005546 Bacteria 1315
53 Ga0070665_100064139 3300005548 Bacteria 3683
54 Ga0070665_100312680 3300005548 Bacteria 1575
55 Ga0070704_100174851 3300005549 Bacteria 1712
56 Ga0070664_100515857 3300005564 Bacteria 1103
57 Ga0068854_100160851 3300005578 Bacteria 1739
58 Ga0068854_100235411 3300005578 Bacteria 1456
59 Ga0070702_100086954 3300005615 Bacteria 1887
60 Ga0068852_100666255 3300005616 Bacteria 1049
61 Ga0068859_100023768 3300005617 Bacteria 6152
62 Ga0068859_100185608 3300005617 Bacteria 2163
63 Ga0068859_101872012 3300005617 Bacteria 662
64 Ga0068864_100244374 3300005618 Bacteria 1664
65 Ga0068864_100460768 3300005618 Bacteria 1217
66 Ga0068861_100259928 3300005719 Bacteria 1486
67 Ga0068851_10398927 3300005834 Bacteria 809
68 Ga0068863_100021903 3300005841 Bacteria 6098
69 Ga0068863_101362837 3300005841 Bacteria 717
70 Ga0068858_100120627 3300005842 Bacteria 2452
71 Ga0068858_100138632 3300005842 Bacteria 2283
72 Ga0068858_100539922 3300005842 Bacteria 1128
73 Ga0068858_101464589 3300005842 Bacteria 673
74 Ga0068860_100001328 3300005843 Bacteria 26867
75 Ga0068860_100746367 3300005843 Bacteria 990
76 Ga0068862_100001052 3300005844 Bacteria 26469
77 Ga0068862_100971569 3300005844 Bacteria 839
78 Ga0081455_10038905 3300005937 Bacteria 4209
79 Ga0081455_10062517 3300005937 Bacteria 3129
80 Ga0070717_10305450 3300006028 Bacteria 1415
81 Ga0075365_10041588 3300006038 Bacteria 3003
82 Ga0075365_10239760 3300006038 Bacteria 1273
83 Ga0075365_10269434 3300006038 Bacteria 1198
84 Ga0075365_10308648 3300006038 Bacteria 1114
85 Ga0075368_10021017 3300006042 Bacteria 2476
86 Ga0075363_100000726 3300006048 Bacteria 11204
87 Ga0075363_100026104 3300006048 Bacteria 2986
88 Ga0075363_100029989 3300006048 Bacteria 2812
89 Ga0075363_100248214 3300006048 Bacteria 1024
90 Ga0075363_100274400 3300006048 Bacteria 974
91 Ga0075364_10001734 3300006051 Bacteria 12004
92 Ga0075364_10008250 3300006051 Bacteria 6222
93 Ga0075364_10013876 3300006051 Bacteria 4966
94 Ga0075364_10107113 3300006051 Bacteria 1863
95 Ga0075364_10372449 3300006051 Bacteria 974
96 Ga0070716_100143485 3300006173 Bacteria 1526
97 Ga0070712_100204988 3300006175 Bacteria 1552
98 Ga0070712_100643249 3300006175 Bacteria 900
99 Ga0070712_100701799 3300006175 Bacteria 863
100 Ga0075362_10040943 3300006177 Bacteria 2041
101 Ga0075362_10238014 3300006177 Bacteria 893
102 Ga0075362_10364656 3300006177 Bacteria 725
103 Ga0075369_10006370 3300006186 Bacteria 4461
104 Ga0075369_10117843 3300006186 Bacteria 1200
105 Ga0075369_10409672 3300006186 Bacteria 639
106 Ga0097621_100454760 3300006237 Bacteria 1154
107 Ga0075370_10001730 3300006353 Bacteria 9708
108 Ga0075370_10011637 3300006353 Bacteria 4628
109 Ga0075370_10055114 3300006353 Bacteria 2259
110 Ga0075370_10079815 3300006353 Bacteria 1880
111 Ga0075370_10088176 3300006353 Bacteria 1788
112 Ga0075370_10220963 3300006353 Bacteria 1120
113 Ga0075434_101633646 3300006871 Bacteria 653
114 Ga0097620_100023766 3300006931 Bacteria 6152
115 Ga0097620_100185623 3300006931 Bacteria 2163
116 Ga0097620_101761514 3300006931 Bacteria 684
117 Ga0097620_101872009 3300006931 Bacteria 662
118 Ga0075435_100575581 3300007076 Bacteria 976
119 Ga0099795_10058860 3300007788 Bacteria 1420
120 Ga0111539_11251089 3300009094 Bacteria 862
121 Ga0105245_10198742 3300009098 Bacteria 1924
122 Ga0105245_10222952 3300009098 Bacteria 1820
123 Ga0105247_10086208 3300009101 Bacteria 1987
124 Ga0105247_10423329 3300009101 Bacteria 954
125 Ga0105243_10691105 3300009148 Bacteria 993
126 Ga0105243_11062844 3300009148 Bacteria 816
127 Ga0105241_11146825 3300009174 Bacteria 734
128 Ga0105242_10189287 3300009176 Bacteria 1821
129 Ga0105242_10545968 3300009176 Bacteria 1110
130 Ga0105242_11383035 3300009176 Bacteria 731
131 Ga0105242_11457881 3300009176 Bacteria 714
132 Ga0105248_10001406 3300009177 Bacteria 26873
133 Ga0105248_10018191 3300009177 Bacteria 7761
134 Ga0105237_10000861 3300009545 Bacteria 41263
135 Ga0105237_10009243 3300009545 Bacteria 10569
136 Ga0105237_11169521 3300009545 Bacteria 776
137 Ga0105237_11451827 3300009545 Bacteria 692
138 Ga0105238_10108400 3300009551 Bacteria 2758
139 Ga0105249_10000927 3300009553 Bacteria 25921
140 Ga0105147_105492 3300009982 Bacteria 1065
141 Ga0099796_10037573 3300010159 Bacteria 1619
142 Ga0105239_10001018 3300010375 Bacteria 39155
143 Ga0105239_10310420 3300010375 Bacteria 1777
144 Ga0105239_10333514 3300010375 Bacteria 1711
145 Ga0105239_10486245 3300010375 Bacteria 1403
146 Ga0105246_10022328 3300011119 Bacteria 4081
147 Ga0105246_10119203 3300011119 Bacteria 1952
148 Ga0105246_11912965 3300011119 Bacteria 570
149 Ga0157371_11086303 3300013102 Bacteria 613
150 Ga0157370_10544896 3300013104 Bacteria 1064
151 Ga0157369_10593392 3300013105 Bacteria 1144
152 Ga0157374_10020342 3300013296 Bacteria 5887
153 Ga0157378_10092624 3300013297 Bacteria 2750
154 Ga0163162_10052602 3300013306 Bacteria 4090
155 Ga0163162_10153836 3300013306 Bacteria 2419
156 Ga0163162_10267015 3300013306 Bacteria 1843
157 Ga0163162_11664273 3300013306 Bacteria 728
158 Ga0163162_11978378 3300013306 Bacteria 668
159 Ga0157375_10402591 3300013308 Bacteria 1535
160 Ga0163163_10085064 3300014325 Bacteria 3170
161 Ga0163163_10163796 3300014325 Bacteria 2269
162 Ga0163163_11246287 3300014325 Bacteria 806
163 Ga0157380_10478914 3300014326 Bacteria 1203
164 Ga0157380_10890153 3300014326 Bacteria 915
165 Ga0157377_10977699 3300014745 Bacteria 639
166 Ga0157379_10085501 3300014968 Bacteria 2827
167 Ga0157379_10126965 3300014968 Bacteria 2295
168 Ga0157376_10904706 3300014969 Bacteria 901
169 Ga0163161_10120696 3300017792 Bacteria 1969
170 Ga0163161_10217854 3300017792 Bacteria 1477
171 Ga0213874_10013458 3300021377 Bacteria 2120
172 Ga0213876_10000967 3300021384 Bacteria 18895
173 Ga0213876_10113505 3300021384 Bacteria 1438
174 Ga0213875_10005153 3300021388 Bacteria 7071
175 Ga0213875_10007691 3300021388 Bacteria 5551
176 Ga0213875_10342650 3300021388 Bacteria 709
177 Ga0209673_1075798 3300025273 Bacteria 785
178 Ga0209025_1068937 3300025294 Bacteria 1267
179 Ga0209051_1000034 3300025303 Bacteria 371498
180 Ga0209051_1000478 3300025303 Bacteria 51782
181 Ga0209051_1002514 3300025303 Bacteria 13013
182 Ga0209051_1007549 3300025303 Bacteria 5924
183 Ga0209051_1010193 3300025303 Bacteria 4776
184 Ga0207656_10294484 3300025321 Bacteria 802
185 Ga0207642_10034893 3300025899 Bacteria 2143
186 Ga0207710_10227852 3300025900 Bacteria 927
187 Ga0207688_10012564 3300025901 Bacteria 4608
188 Ga0207688_10096858 3300025901 Bacteria 1700
189 Ga0207680_10006546 3300025903 Bacteria 5643
190 Ga0207685_10140984 3300025905 Bacteria 1081
191 Ga0207699_10118975 3300025906 Bacteria 1705
192 Ga0207645_10623305 3300025907 Bacteria 733
193 Ga0207671_10007962 3300025914 Bacteria 9078
194 Ga0207671_10017674 3300025914 Bacteria 5493
195 Ga0207693_10120816 3300025915 Bacteria 2057
196 Ga0207687_10612702 3300025927 Bacteria 918
197 Ga0207664_10015922 3300025929 Bacteria 5476
198 Ga0207664_10776480 3300025929 Bacteria 862
199 Ga0207644_10636921 3300025931 Bacteria 887
200 Ga0207690_10032346 3300025932 Bacteria 3356
201 Ga0207686_10164090 3300025934 Bacteria 1560
202 Ga0207686_10771588 3300025934 Bacteria 769
203 Ga0207709_10147973 3300025935 Bacteria 1623
204 Ga0207670_10294805 3300025936 Bacteria 1268
205 Ga0207669_10063742 3300025937 Bacteria 2277
206 Ga0207665_10086694 3300025939 Bacteria 2163
207 Ga0207711_10017724 3300025941 Bacteria 5917
208 Ga0207711_10026386 3300025941 Bacteria 4874
209 Ga0207711_10414316 3300025941 Bacteria 1253
210 Ga0207711_10564504 3300025941 Bacteria 1062
211 Ga0207689_10218696 3300025942 Bacteria 1574
212 Ga0207651_10611717 3300025960 Bacteria 953
213 Ga0207712_10000697 3300025961 Bacteria 25917
214 Ga0207668_10013943 3300025972 Bacteria 4965
215 Ga0207668_10739823 3300025972 Bacteria 867
216 Ga0207668_10975580 3300025972 Bacteria 757
217 Ga0207640_10084250 3300025981 Bacteria 2182
218 Ga0207658_10000469 3300025986 Bacteria 37626
219 Ga0207658_10002139 3300025986 Bacteria 14674
220 Ga0207658_10124871 3300025986 Bacteria 2058
221 Ga0207703_10074448 3300026035 Bacteria 2812
222 Ga0207703_10480044 3300026035 Bacteria 1165
223 Ga0207703_10605356 3300026035 Bacteria 1037
224 Ga0207703_11247007 3300026035 Bacteria 715
225 Ga0207639_10172247 3300026041 Bacteria 1834
226 Ga0207639_10410161 3300026041 Bacteria 1222
227 Ga0207639_10832873 3300026041 Bacteria 861
228 Ga0207678_10137622 3300026067 Bacteria 2084
229 Ga0207678_10220912 3300026067 Bacteria 1622
230 Ga0207708_10198721 3300026075 Bacteria 1599
231 Ga0207641_10001599 3300026088 Bacteria 22123
232 Ga0207641_10109927 3300026088 Bacteria 2442
233 Ga0207648_10232783 3300026089 Bacteria 1639
234 Ga0207676_10411416 3300026095 Bacteria 1266
235 Ga0207675_100065895 3300026118 Bacteria 3385
236 Ga0207675_101576284 3300026118 Bacteria 677
237 Ga0207683_10170619 3300026121 Bacteria 1970
238 Ga0207683_10880211 3300026121 Bacteria 831
239 Ga0209813_10109140 3300027866 Bacteria 951
240 Ga0207428_10617007 3300027907 Bacteria 780
241 Ga0268266_10062457 3300028379 Bacteria 3215
242 Ga0268266_10164281 3300028379 Bacteria 2010
243 Ga0268265_10000952 3300028380 Bacteria 26604
244 Ga0268265_10494526 3300028380 Bacteria 1151
245 Ga0268264_10000177 3300028381 Bacteria 135644
246 Ga0268264_10138341 3300028381 Bacteria 2168
247 Ga0265327_10000863 3300031251 Bacteria 45090
248 Ga0307413_10279450 3300031824 Bacteria 1255
249 Ga0307413_10289814 3300031824 Bacteria 1236
250 Ga0307410_10010732 3300031852 Bacteria 5208
251 Ga0307410_10298759 3300031852 Bacteria 1270
252 Ga0307410_10532602 3300031852 Bacteria 971
253 Ga0307407_10324364 3300031903 Bacteria 1082
254 Ga0307409_101538105 3300031995 Bacteria 693
255 Ga0307416_100164181 3300032002 Bacteria 2058
256 Ga0307416_102070705 3300032002 Bacteria 671
257 Ga0373948_0150114 3300034817 Bacteria 582
258 Ga0373929_0004908 3300035085 Bacteria 2397
259 Ga0373951_0138068 3300035091 Bacteria 675
260 Ga0373962_0186011 3300035242 Bacteria 697
261 Ga0373931_0024368 3300035691 Bacteria 3065
262 Ga0373935_0481796 3300035692 Bacteria 899
263 Ga0373937_0401390 3300036401 Bacteria 1301
264 Ga0316584_0231143 3300036712 Bacteria 1355
265 Ga0436364_0207480 3300037853 Bacteria 20722
266 Ga0436364_1224500 3300037853 Bacteria 9848
267 Ga0436364_1560764 3300037853 Bacteria 2926
268 Ga0436365_0014222 3300039437 Bacteria 2385
269 Ga0436365_1621114 3300039437 Bacteria 79407
270 Ga0436363_0356687 3300039450 Bacteria 1363
271 Ga0436363_0442808 3300039450 Bacteria 5926
272 Ga0439461_0000267 3300041410 Bacteria 7499
273 Ga0439466_0031875 3300041411 Bacteria 1800
274 Ga0439466_0035927 3300041411 Bacteria 1675
275 Ga0439465_0016207 3300041413 Bacteria 2324
276 Ga0439465_0059986 3300041413 Bacteria 1259
277 Ga0451791_1279037 3300041451 Bacteria 848
278 Ga0451793_0215373 3300041452 Bacteria 1252
279 Ga0451793_1265219 3300041452 Bacteria 2968
280 Ga0451793_1596652 3300041452 Bacteria 1125
281 Ga0451795_0191807 3300041456 Bacteria 1532
282 Ga0451851_0457896 3300041507 Bacteria 706
283 Ga0451853_0179266 3300041512 Bacteria 1331
284 Ga0439431_0000332 3300041997 Bacteria 9833
285 Ga0439445_0001861 3300042004 Bacteria 4642
286 Ga0439445_0012302 3300042004 Bacteria 2054
287 Ga0439434_0021364 3300042435 Bacteria 1944
288 Ga0439434_0158508 3300042435 Bacteria 751
289 Ga0466972_0002627 3300044658 Bacteria 8898
290 Ga0466972_0006124 3300044658 Bacteria 6043
291 Ga0466965_0002380 3300044683 Bacteria 7969
292 Ga0466965_0025061 3300044683 Bacteria 2886
293 Ga0466965_0065619 3300044683 Bacteria 1819
294 Ga0466966_0002902 3300044684 Bacteria 11302
295 Ga0466966_0049060 3300044684 Bacteria 2689
296 Ga0466961_0004341 3300044693 Bacteria 8882
297 Ga0466961_0013732 3300044693 Bacteria 5190
298 Ga0466963_0070806 3300044694 Bacteria 2346
299 Ga0466964_0062419 3300044706 Bacteria 1554
300 Ga0466964_0123693 3300044706 Bacteria 1169
301 Ga0466971_0070964 3300044719 Bacteria 1582
302 Ga0466968_0025903 3300044735 Bacteria 2404
303 Ga0466968_0078466 3300044735 Bacteria 1447
304 Ga0466970_0031192 3300044765 Bacteria 2814
305 Ga0466970_0061790 3300044765 Bacteria 2008
306 Ga0466957_0020590 3300044842 Bacteria 3881
307 Ga0466957_0032617 3300044842 Bacteria 3120
308 Ga0466960_0000572 3300044901 Bacteria 12763
309 Ga0466960_0007302 3300044901 Bacteria 4479
310 Ga0466959_0006093 3300045049 Bacteria 8325
311 Ga0466959_0076258 3300045049 Bacteria 2421
312 Ga0466959_0365014 3300045049 Bacteria 983
313 Ga0466958_0015013 3300045836 Bacteria 4431
314 Ga0466958_0069497 3300045836 Bacteria 2153
315 Ga0466958_0132757 3300045836 Bacteria 1564
316 Ga0466958_0910209 3300045836 Bacteria 574
317 Ga0466967_0033506 3300045976 Bacteria 4349
318 Ga0466967_0136365 3300045976 Bacteria 2282
319 Ga0466967_0141388 3300045976 Bacteria 2242
320 Ga0495627_135536 3300046453 Bacteria 691
321 Ga0495603_0008542 3300046455 Bacteria 6189
322 Ga0495629_0114076 3300046459 Bacteria 1883
323 Ga0495638_0002750 3300046460 Bacteria 14133
324 Ga0495638_0153484 3300046460 Bacteria 1334
325 Ga0495641_0192888 3300046461 Bacteria 913
326 Ga0495582_0027106 3300046473 Bacteria 3140
327 Ga0495664_0224177 3300046477 Bacteria 1138
328 Ga0495594_0783785 3300046499 Bacteria 538
329 Ga0495606_0076148 3300046507 Bacteria 2098
330 Ga0495606_0162549 3300046507 Bacteria 1302
331 Ga0495628_0858064 3300046516 Bacteria 632
332 Ga0495644_0127004 3300046523 Bacteria 971
333 Ga0495648_0024754 3300046524 Bacteria 4077
334 Ga0495666_0283910 3300046526 Bacteria 750
335 Ga0495642_0318911 3300046528 Bacteria 682
336 Ga0495665_0072018 3300046531 Bacteria 1820
337 Ga0495640_0498046 3300046533 Bacteria 741
338 Ga0495667_0685424 3300046559 Bacteria 635
339 Ga0495668_0071140 3300046616 Bacteria 1912
340 Ga0495634_0345731 3300046642 Bacteria 891
341 Ga0495625_0155276 3300046660 Bacteria 1536
342 Ga0495635_0062426 3300046663 Bacteria 2559
343 Ga0495613_0100953 3300046689 Bacteria 2084
344 Ga0495649_0249046 3300046694 Bacteria 913
345 Ga0495581_0064192 3300047315 Bacteria 2121
346 Ga0495604_0273366 3300047317 Bacteria 1144
347 Ga0495672_0002921 3300047320 Bacteria 15104
348 Ga0495672_0021042 3300047320 Bacteria 4260
349 Ga0495676_0050433 3300047321 Bacteria 3338
350 Ga0495673_0001467 3300047469 Bacteria 18689
351 Ga0495686_0008890 3300047472 Bacteria 7306
352 Ga0495614_0193205 3300048089 Bacteria 919
353 Ga0495626_0022103 3300048091 Bacteria 3144
354 Ga0496100_0000175 3300048903 Bacteria 35727
355 Ga0496100_0004450 3300048903 Bacteria 7434
356 Ga0496100_0016427 3300048903 Bacteria 4348
357 Ga0496100_0882632 3300048903 Bacteria 702
358 Ga0496101_0000014 3300048904 Bacteria 253487
359 Ga0496101_0000140 3300048904 Bacteria 63955
360 Ga0496101_0004665 3300048904 Bacteria 8673
361 Ga0496101_0165772 3300048904 Bacteria 1696
362 Ga0496101_0359138 3300048904 Bacteria 1145
363 Ga0496101_0534409 3300048904 Bacteria 927
364 Ga0496102_0000041 3300048905 Bacteria 196634
365 Ga0496102_0005380 3300048905 Bacteria 10869
366 Ga0496102_0007713 3300048905 Bacteria 9194
367 Ga0496102_0049028 3300048905 Bacteria 3841
368 Ga0496102_0237953 3300048905 Bacteria 1717
369 Ga0496102_0598996 3300048905 Bacteria 1025
370 Ga0496103_0000058 3300048906 Bacteria 141099
371 Ga0496103_0000183 3300048906 Bacteria 63106
372 Ga0496103_0000474 3300048906 Bacteria 33838
373 Ga0496104_0006161 3300048907 Bacteria 10529
374 Ga0496104_0008084 3300048907 Bacteria 9333
375 Ga0496104_0056174 3300048907 Bacteria 3722
376 Ga0496104_0234481 3300048907 Bacteria 1747
377 Ga0496104_0465721 3300048907 Bacteria 1175
378 Ga0496105_0003856 3300048908 Bacteria 11203
379 Ga0496105_0475621 3300048908 Bacteria 984
380 Ga0496105_0664438 3300048908 Bacteria 803
381 Ga0496105_0926171 3300048908 Bacteria 655
382 Ga0496106_0001516 3300048909 Bacteria 17471
383 Ga0496106_0007881 3300048909 Bacteria 7874
384 Ga0496106_0016728 3300048909 Bacteria 5426
385 Ga0496106_0262416 3300048909 Bacteria 1382
386 Ga0496106_0322908 3300048909 Bacteria 1239
387 Ga0496106_0757842 3300048909 Bacteria 771
388 Ga0496107_0000145 3300048910 Bacteria 35595
389 Ga0496107_0036110 3300048910 Bacteria 3544
390 Ga0496108_0001944 3300048911 Bacteria 16551
391 Ga0496108_0002334 3300048911 Bacteria 15200
392 Ga0496108_0003083 3300048911 Bacteria 13395
393 Ga0496108_0329527 3300048911 Bacteria 1331
394 Ga0496109_0000161 3300048912 Bacteria 65633
395 Ga0496109_0014613 3300048912 Bacteria 6830
396 Ga0496109_0015496 3300048912 Bacteria 6646
397 Ga0496109_0020865 3300048912 Bacteria 5790
398 Ga0496110_0030964 3300048913 Bacteria 4614
399 Ga0496110_0060799 3300048913 Bacteria 3333
400 Ga0496110_0133947 3300048913 Bacteria 2238
401 Ga0496110_0590189 3300048913 Bacteria 1008
402 Ga0496110_0860750 3300048913 Bacteria 812
403 Ga0496111_0006072 3300048914 Bacteria 7807
404 Ga0496111_0651330 3300048914 Bacteria 768
405 Ga0496112_0012706 3300048915 Bacteria 7744
406 Ga0496112_0015397 3300048915 Bacteria 7136
407 Ga0496112_0397333 3300048915 Bacteria 1318
408 Ga0496113_0024001 3300048916 Bacteria 4330
409 Ga0496113_0161269 3300048916 Bacteria 1773
410 Ga0496113_0262934 3300048916 Bacteria 1378
411 Ga0496114_0280650 3300048917 Bacteria 1469
412 Ga0496114_0862036 3300048917 Bacteria 786
413 Ga0496115_0072586 3300048918 Bacteria 2793
414 Ga0496116_0000098 3300048919 Bacteria 196497
415 Ga0496116_0001872 3300048919 Bacteria 22739
416 Ga0496116_0008245 3300048919 Bacteria 9078
417 Ga0496117_0000096 3300048920 Bacteria 196788
418 Ga0496117_0009692 3300048920 Bacteria 8904
419 Ga0496117_0013891 3300048920 Bacteria 6981
420 Ga0496118_0000073 3300048921 Bacteria 196712
421 Ga0496118_0002763 3300048921 Bacteria 23002
422 Ga0496118_0009422 3300048921 Bacteria 9861
423 Ga0496119_0006822 3300048922 Bacteria 10468
424 Ga0496119_0015401 3300048922 Bacteria 5891
425 Ga0496119_0039627 3300048922 Bacteria 3025
426 Ga0496119_0337844 3300048922 Bacteria 733
427 Ga0496119_0427748 3300048922 Bacteria 627
428 Ga0496120_0017707 3300048923 Bacteria 4607
429 Ga0496120_0071781 3300048923 Bacteria 1900
430 Ga0496120_0370193 3300048923 Bacteria 639
431 Ga0496121_0000002 3300048924 Bacteria 1494588
432 Ga0496121_0000354 3300048924 Bacteria 94725
433 Ga0496121_0076675 3300048924 Bacteria 2665
434 Ga0496121_0602698 3300048924 Bacteria 677
435 Ga0496122_0001055 3300048925 Bacteria 48077
436 Ga0496122_0053602 3300048925 Bacteria 3039
437 Ga0496123_0004209 3300048926 Bacteria 15361
438 Ga0496124_0000002 3300048927 Bacteria 1494588
439 Ga0496124_0302011 3300048927 Bacteria 1155
440 Ga0496124_0409270 3300048927 Bacteria 939
441 Ga0496125_0000002 3300048928 Bacteria 1480920
442 Ga0496126_0000009 3300048929 Bacteria 750350
443 Ga0496126_0001057 3300048929 Bacteria 46555
444 Ga0496126_0002185 3300048929 Bacteria 27192
445 Ga0496126_0027364 3300048929 Bacteria 5447
446 Ga0496126_0097527 3300048929 Bacteria 2576
447 Ga0501032_0016343 3300049569 Bacteria 5221
448 Ga0501033_0101513 3300049570 Bacteria 2099
449 Ga0501033_0116734 3300049570 Bacteria 1939
450 Ga0501034_0012635 3300049571 Bacteria 8712
451 Ga0501034_0012949 3300049571 Bacteria 8598
452 Ga0501034_0509787 3300049571 Bacteria 1116
453 Ga0501034_0549943 3300049571 Bacteria 1064
454 Ga0501034_0870061 3300049571 Bacteria 790
455 Ga0501036_0030333 3300049572 Bacteria 4570
456 Ga0501037_0000190 3300049573 Bacteria 56966
457 Ga0501038_0015799 3300049574 Bacteria 6859
458 Ga0501039_0010473 3300049575 Bacteria 7065
459 Ga0501043_0001031 3300049579 Bacteria 24463
460 Ga0501070_0005228 3300049586 Bacteria 11064
461 Ga0501070_0048999 3300049586 Bacteria 3508
462 Ga0501071_0085929 3300049587 Bacteria 2307
463 Ga0501073_0100386 3300049589 Bacteria 2009
464 Ga0501080_0066865 3300049742 Bacteria 3343
465 Ga0501035_0001193 3300049822 Bacteria 27068
466 Ga0501035_0196586 3300049822 Bacteria 1732
467 Ga0501044_0000320 3300049823 Bacteria 60627
468 Ga0501044_0086715 3300049823 Bacteria 3162
469 nmdc:mga03683_64535_c1 3300050489 Bacteria 921
470 nmdc:mga03n38_105_c2 3300050490 Bacteria 16032
471 nmdc:mga03n38_175526_c1 3300050490 Bacteria 1095
472 nmdc:mga03n38_431932_c1 3300050490 Bacteria 730
473 nmdc:mga03n38_5213_c1 3300050490 Bacteria 4402
474 nmdc:mga03n38_570449_c1 3300050490 Bacteria 642
475 nmdc:mga03n38_772136_c1 3300050490 Bacteria 558
476 nmdc:mga03n38_8751_c1 3300050490 Bacteria 3649
477 nmdc:mga00v17_195766_c1 3300050491 Bacteria 1306
478 nmdc:mga00v17_247510_c1 3300050491 Bacteria 1156
479 nmdc:mga00v17_354362_c1 3300050491 Bacteria 954
480 nmdc:mga00v17_725847_c1 3300050491 Bacteria 636
481 nmdc:mga00v17_8673_c1 3300050491 Bacteria 5477
482 nmdc:mga00v17_913739_c1 3300050491 Bacteria 555
483 nmdc:mga0yw44_255985_c1 3300050492 Bacteria 1166
484 nmdc:mga0yw44_288311_c1 3300050492 Bacteria 1098
485 nmdc:mga0yw44_385197_c1 3300050492 Bacteria 947
486 nmdc:mga0yw44_533785_c1 3300050492 Bacteria 796
487 nmdc:mga0k408_191257_c1 3300050493 Bacteria 1221
488 nmdc:mga06z11_259907_c1 3300050494 Bacteria 1024
489 nmdc:mga04h51_34328_c1 3300050495 Bacteria 1620
490 nmdc:mga07m45_113748_c2 3300050496 Bacteria 1120
491 nmdc:mga07m45_13258_c2 3300050496 Bacteria 3834
492 nmdc:mga07m45_268517_c1 3300050496 Bacteria 992
493 nmdc:mga07m45_32491_c1 3300050496 Bacteria 2894
494 nmdc:mga07m45_781_c1 3300050496 Bacteria 13679
495 nmdc:mga08y16_504156_c1 3300050511 Bacteria 1229
496 nmdc:mga0n895_1899225_c1 3300050512 Bacteria 554
497 nmdc:mga0sz30_15777_c1 3300050516 Bacteria 2990
498 nmdc:mga0sz30_35783_c2 3300050516 Bacteria 1302
499 nmdc:mga0sz30_64772_c1 3300050516 Bacteria 1566
500 Ga0495601_0133646 3300053077 Bacteria 1617
501 Ga0500610_0049828 3300053079 Bacteria 2179
502 Ga0500635_0016452 3300053080 Bacteria 2200
503 Ga0495655_0003859 3300053083 Bacteria 2513
504 Ga0495655_0207148 3300053083 Bacteria 644
505 Ga0495619_0080735 3300053085 Bacteria 2189
506 Ga0500643_018136 3300053087 Bacteria 2342
507 Ga0500641_0036335 3300053096 Bacteria 1971
508 Ga0500556_0065834 3300053104 Bacteria 1344
509 Ga0500562_004189 3300053108 Bacteria 3642
510 Ga0500608_225177 3300053122 Bacteria 753
511 Ga0500658_0264463 3300053134 Bacteria 791
512 Ga0500568_0068332 3300053139 Bacteria 1364
513 Ga0500568_0102703 3300053139 Bacteria 1072
514 Ga0500568_0119250 3300053139 Bacteria 983
515 Ga0500588_0091694 3300053146 Bacteria 1034
516 Ga0500588_0272805 3300053146 Bacteria 638
517 Ga0500616_0006838 3300053153 Bacteria 7373
518 Ga0500627_0008363 3300053158 Bacteria 3670
519 Ga0500627_0142692 3300053158 Bacteria 1082
520 Ga0500645_000104 3300053730 Bacteria 67349
521 Ga0466962_0011429 3300061719 Bacteria 4274

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005347 Ga0070668_101617424 Ga0070668_1016174241 128
2 3300005618 Ga0068864_100460768 Ga0068864_1004607682 131
3 3300005841 Ga0068863_101362837 Ga0068863_1013628372 131
4 3300006871 Ga0075434_101633646 Ga0075434_1016336462 131
5 3300007076 Ga0075435_100575581 Ga0075435_1005755812 131
6 3300026088 Ga0207641_10109927 Ga0207641_101099273 131
7 3300026095 Ga0207676_10411416 Ga0207676_104114162 131
8 3300014325 Ga0163163_11246287 Ga0163163_112462871 133
9 3300014325 Ga0163163_10163796 Ga0163163_101637962 135
10 3300034817 Ga0373948_0150114 Ga0373948_0150114_69_497 135
11 3300035085 Ga0373929_0004908 Ga0373929_0004908_1314_1742 135
12 3300035091 Ga0373951_0138068 Ga0373951_0138068_223_651 135
13 3300035691 Ga0373931_0024368 Ga0373931_0024368_68_496 135
14 3300048907 Ga0496104_0006161 Ga0496104_0006161_2742_3170 135
15 3300048908 Ga0496105_0926171 Ga0496105_0926171_27_455 135
16 3300048909 Ga0496106_0262416 Ga0496106_0262416_920_1348 135
17 3300048911 Ga0496108_0003083 Ga0496108_0003083_5608_6036 135
18 3300048912 Ga0496109_0015496 Ga0496109_0015496_5190_5618 135
19 3300048913 Ga0496110_0133947 Ga0496110_0133947_685_1113 135
20 3300048914 Ga0496111_0651330 Ga0496111_0651330_169_597 135
21 3300048915 Ga0496112_0015397 Ga0496112_0015397_4755_5183 135
22 3300048915 Ga0496112_0397333 Ga0496112_0397333_880_1287 135
23 3300048916 Ga0496113_0262934 Ga0496113_0262934_778_1206 135
24 3300050512 nmdc:mga0n895_1899225_c1 nmdc:mga0n895_1899225_c1_29_457 135
25 3300053122 Ga0500608_225177 Ga0500608_225177_302_709 135
26 3300006048 Ga0075363_100000726 Ga0075363_10000072613 146
27 3300006051 Ga0075364_10008250 Ga0075364_100082502 146
28 3300006353 Ga0075370_10055114 Ga0075370_100551142 146
29 3300021377 Ga0213874_10013458 Ga0213874_100134582 146
30 3300039450 Ga0436363_0442808 Ga0436363_0442808_3981_4463 146
31 3300050490 nmdc:mga03n38_5213_c1 nmdc:mga03n38_5213_c1_2777_3349 146
32 3300050496 nmdc:mga07m45_13258_c2 nmdc:mga07m45_13258_c2_722_1294 146
33 3300044719 Ga0466971_0070964 Ga0466971_0070964_644_1087 147
34 3300045836 Ga0466958_0910209 Ga0466958_0910209_93_536 147
35 3300044684 Ga0466966_0002902 Ga0466966_0002902_10187_10681 150
36 3300044735 Ga0466968_0078466 Ga0466968_0078466_557_1051 150
37 3300044842 Ga0466957_0032617 Ga0466957_0032617_722_1216 150
38 3300049571 Ga0501034_0870061 Ga0501034_0870061_124_582 152
39 iso_pu_bacteria 2643221715 2644638929 152
40 iso_pu_bacteria 2902810491 2902814053 152
41 3300005937 Ga0081455_10038905 Ga0081455_100389056 154
42 3300025303 Ga0209051_1010193 Ga0209051_10101932 154
43 3300049822 Ga0501035_0196586 Ga0501035_0196586_269_748 154
44 3300011119 Ga0105246_11912965 Ga0105246_119129651 155
45 3300021384 Ga0213876_10000967 Ga0213876_1000096713 155
46 3300021388 Ga0213875_10007691 Ga0213875_100076913 155
47 3300037853 Ga0436364_1224500 Ga0436364_1224500_3369_3869 155
48 3300039437 Ga0436365_1621114 Ga0436365_1621114_49387_49887 155
49 3300050490 nmdc:mga03n38_772136_c1 nmdc:mga03n38_772136_c1_79_546 155
50 3300050491 nmdc:mga00v17_247510_c1 nmdc:mga00v17_247510_c1_329_796 155
51 3300050496 nmdc:mga07m45_268517_c1 nmdc:mga07m45_268517_c1_331_798 155
52 3300053146 Ga0500588_0091694 Ga0500588_0091694_16_483 155
53 3300053158 Ga0500627_0008363 Ga0500627_0008363_140_607 155
54 3300006051 Ga0075364_10001734 Ga0075364_100017345 156
55 3300031852 Ga0307410_10298759 Ga0307410_102987592 156
56 3300032002 Ga0307416_102070705 Ga0307416_1020707052 156
57 3300041410 Ga0439461_0000267 Ga0439461_0000267_5729_6199 156
58 3300041411 Ga0439466_0035927 Ga0439466_0035927_779_1261 156
59 3300041413 Ga0439465_0059986 Ga0439465_0059986_100_582 156
60 3300041997 Ga0439431_0000332 Ga0439431_0000332_8618_9088 156
61 3300042004 Ga0439445_0001861 Ga0439445_0001861_4030_4500 156
62 3300042004 Ga0439445_0012302 Ga0439445_0012302_548_1030 156
63 3300042435 Ga0439434_0021364 Ga0439434_0021364_976_1446 156
64 3300046460 Ga0495638_0002750 Ga0495638_0002750_12925_13395 156
65 3300050490 nmdc:mga03n38_175526_c1 nmdc:mga03n38_175526_c1_423_905 156
66 3300050491 nmdc:mga00v17_8673_c1 nmdc:mga00v17_8673_c1_2066_2536 156
67 3300050493 nmdc:mga0k408_191257_c1 nmdc:mga0k408_191257_c1_377_859 156
68 3300050494 nmdc:mga06z11_259907_c1 nmdc:mga06z11_259907_c1_357_839 156
69 3300050495 nmdc:mga04h51_34328_c1 nmdc:mga04h51_34328_c1_986_1468 156
70 3300053104 Ga0500556_0065834 Ga0500556_0065834_713_1183 156
71 3300053139 Ga0500568_0119250 Ga0500568_0119250_65_535 156
72 3300053146 Ga0500588_0272805 Ga0500588_0272805_115_585 156
73 iso_pu_bacteria 2738541264 2738665823 156
74 iso_pu_bacteria 2738541356 2739144957 156
75 3300005842 Ga0068858_100539922 Ga0068858_1005399222 157
76 3300005843 Ga0068860_100746367 Ga0068860_1007463672 157
77 3300025941 Ga0207711_10414316 Ga0207711_104143162 157
78 3300026035 Ga0207703_10605356 Ga0207703_106053562 157
79 3300048903 Ga0496100_0016427 Ga0496100_0016427_3100_3591 157
80 3300048905 Ga0496102_0237953 Ga0496102_0237953_212_703 157
81 3300048907 Ga0496104_0234481 Ga0496104_0234481_1103_1594 157
82 3300048908 Ga0496105_0475621 Ga0496105_0475621_173_667 157
83 3300048909 Ga0496106_0322908 Ga0496106_0322908_654_1145 157
84 3300048913 Ga0496110_0860750 Ga0496110_0860750_10_501 157
85 3300048917 Ga0496114_0862036 Ga0496114_0862036_226_717 157
86 3300049569 Ga0501032_0016343 Ga0501032_0016343_1262_1762 157
87 3300049570 Ga0501033_0101513 Ga0501033_0101513_377_877 157
88 3300049571 Ga0501034_0012949 Ga0501034_0012949_2752_3252 157
89 3300049572 Ga0501036_0030333 Ga0501036_0030333_2373_2873 157
90 3300049573 Ga0501037_0000190 Ga0501037_0000190_5070_5570 157
91 3300049574 Ga0501038_0015799 Ga0501038_0015799_1278_1778 157
92 3300049575 Ga0501039_0010473 Ga0501039_0010473_5082_5582 157
93 3300049579 Ga0501043_0001031 Ga0501043_0001031_22480_22980 157
94 3300049586 Ga0501070_0005228 Ga0501070_0005228_6341_6841 157
95 3300049587 Ga0501071_0085929 Ga0501071_0085929_1559_2059 157
96 3300049589 Ga0501073_0100386 Ga0501073_0100386_1465_1965 157
97 3300049823 Ga0501044_0086715 Ga0501044_0086715_903_1403 157
98 3300013306 Ga0163162_11978378 Ga0163162_119783782 158
99 3300025929 Ga0207664_10776480 Ga0207664_107764802 158
100 3300044658 Ga0466972_0002627 Ga0466972_0002627_703_1182 158
101 3300044683 Ga0466965_0025061 Ga0466965_0025061_1452_1931 158
102 3300044735 Ga0466968_0025903 Ga0466968_0025903_1657_2136 158
103 3300044842 Ga0466957_0020590 Ga0466957_0020590_2382_2861 158
104 3300044901 Ga0466960_0007302 Ga0466960_0007302_2359_2838 158
105 3300045049 Ga0466959_0006093 Ga0466959_0006093_7029_7508 158
106 3300045836 Ga0466958_0069497 Ga0466958_0069497_868_1347 158
107 3300045976 Ga0466967_0136365 Ga0466967_0136365_884_1363 158
108 3300046453 Ga0495627_135536 Ga0495627_135536_35_511 158
109 3300046528 Ga0495642_0318911 Ga0495642_0318911_20_496 158
110 3300005334 Ga0068869_100667134 Ga0068869_1006671342 159
111 3300005435 Ga0070714_100032429 Ga0070714_1000324292 159
112 3300006028 Ga0070717_10305450 Ga0070717_103054503 159
113 3300006175 Ga0070712_100204988 Ga0070712_1002049883 159
114 3300009094 Ga0111539_11251089 Ga0111539_112510892 159
115 3300013104 Ga0157370_10544896 Ga0157370_105448962 159
116 3300013306 Ga0163162_10267015 Ga0163162_102670152 159
117 3300021388 Ga0213875_10342650 Ga0213875_103426502 159
118 3300025901 Ga0207688_10096858 Ga0207688_100968582 159
119 3300025906 Ga0207699_10118975 Ga0207699_101189752 159
120 3300025929 Ga0207664_10015922 Ga0207664_100159222 159
121 3300026118 Ga0207675_101576284 Ga0207675_1015762842 159
122 3300026121 Ga0207683_10880211 Ga0207683_108802111 159
123 3300027907 Ga0207428_10617007 Ga0207428_106170072 159
124 3300035692 Ga0373935_0481796 Ga0373935_0481796_264_743 159
125 3300036401 Ga0373937_0401390 Ga0373937_0401390_743_1222 159
126 3300037853 Ga0436364_1560764 Ga0436364_1560764_2247_2744 159
127 3300041452 Ga0451793_1596652 Ga0451793_1596652_510_989 159
128 3300041507 Ga0451851_0457896 Ga0451851_0457896_152_631 159
129 3300044658 Ga0466972_0006124 Ga0466972_0006124_2717_3196 159
130 3300044683 Ga0466965_0002380 Ga0466965_0002380_3026_3505 159
131 3300044901 Ga0466960_0000572 Ga0466960_0000572_2965_3444 159
132 3300046455 Ga0495603_0008542 Ga0495603_0008542_4523_5002 159
133 3300046459 Ga0495629_0114076 Ga0495629_0114076_1051_1530 159
134 3300046461 Ga0495641_0192888 Ga0495641_0192888_200_679 159
135 3300046473 Ga0495582_0027106 Ga0495582_0027106_1191_1670 159
136 3300046477 Ga0495664_0224177 Ga0495664_0224177_502_981 159
137 3300046499 Ga0495594_0783785 Ga0495594_0783785_18_497 159
138 3300046516 Ga0495628_0858064 Ga0495628_0858064_137_616 159
139 3300046526 Ga0495666_0283910 Ga0495666_0283910_110_589 159
140 3300046531 Ga0495665_0072018 Ga0495665_0072018_1266_1745 159
141 3300046533 Ga0495640_0498046 Ga0495640_0498046_239_718 159
142 3300046559 Ga0495667_0685424 Ga0495667_0685424_56_535 159
143 3300046642 Ga0495634_0345731 Ga0495634_0345731_203_682 159
144 3300046689 Ga0495613_0100953 Ga0495613_0100953_290_769 159
145 3300047315 Ga0495581_0064192 Ga0495581_0064192_535_1014 159
146 3300047317 Ga0495604_0273366 Ga0495604_0273366_373_852 159
147 3300047321 Ga0495676_0050433 Ga0495676_0050433_2482_2961 159
148 3300048089 Ga0495614_0193205 Ga0495614_0193205_34_513 159
149 3300048904 Ga0496101_0534409 Ga0496101_0534409_405_884 159
150 3300048905 Ga0496102_0598996 Ga0496102_0598996_114_593 159
151 3300048907 Ga0496104_0465721 Ga0496104_0465721_454_933 159
152 3300048911 Ga0496108_0329527 Ga0496108_0329527_137_616 159
153 3300048912 Ga0496109_0014613 Ga0496109_0014613_5192_5671 159
154 3300048913 Ga0496110_0590189 Ga0496110_0590189_56_535 159
155 3300048915 Ga0496112_0012706 Ga0496112_0012706_1402_1881 159
156 3300048916 Ga0496113_0024001 Ga0496113_0024001_486_965 159
157 3300049570 Ga0501033_0116734 Ga0501033_0116734_821_1312 159
158 3300049571 Ga0501034_0012635 Ga0501034_0012635_4937_5428 159
159 3300049822 Ga0501035_0001193 Ga0501035_0001193_5888_6379 159
160 3300049823 Ga0501044_0000320 Ga0501044_0000320_11329_11820 159
161 3300050490 nmdc:mga03n38_8751_c1 nmdc:mga03n38_8751_c1_137_616 159
162 3300050511 nmdc:mga08y16_504156_c1 nmdc:mga08y16_504156_c1_517_996 159
163 3300053077 Ga0495601_0133646 Ga0495601_0133646_461_940 159
164 3300053083 Ga0495655_0003859 Ga0495655_0003859_922_1401 159
165 3300053085 Ga0495619_0080735 Ga0495619_0080735_429_908 159
166 iso_pu_bacteria 2842134933 2842135125 159
167 3300006038 Ga0075365_10239760 Ga0075365_102397603 160
168 3300006038 Ga0075365_10269434 Ga0075365_102694341 160
169 3300006038 Ga0075365_10308648 Ga0075365_103086483 160
170 3300006048 Ga0075363_100029989 Ga0075363_1000299894 160
171 3300006048 Ga0075363_100248214 Ga0075363_1002482142 160
172 3300006186 Ga0075369_10117843 Ga0075369_101178433 160
173 3300006186 Ga0075369_10409672 Ga0075369_104096722 160
174 3300006353 Ga0075370_10220963 Ga0075370_102209632 160
175 3300021384 Ga0213876_10113505 Ga0213876_101135052 160
176 3300031852 Ga0307410_10532602 Ga0307410_105326021 160
177 3300039437 Ga0436365_0014222 Ga0436365_0014222_834_1355 160
178 3300039450 Ga0436363_0356687 Ga0436363_0356687_60_581 160
179 3300041512 Ga0451853_0179266 Ga0451853_0179266_736_1224 160
180 3300044683 Ga0466965_0065619 Ga0466965_0065619_45_530 160
181 3300044693 Ga0466961_0004341 Ga0466961_0004341_181_675 160
182 3300044694 Ga0466963_0070806 Ga0466963_0070806_1000_1494 160
183 3300044765 Ga0466970_0061790 Ga0466970_0061790_651_1145 160
184 3300045049 Ga0466959_0076258 Ga0466959_0076258_1620_2114 160
185 3300045836 Ga0466958_0015013 Ga0466958_0015013_3859_4353 160
186 3300046460 Ga0495638_0153484 Ga0495638_0153484_698_1192 160
187 3300048904 Ga0496101_0165772 Ga0496101_0165772_361_855 160
188 3300048916 Ga0496113_0161269 Ga0496113_0161269_15_509 160
189 3300048922 Ga0496119_0337844 Ga0496119_0337844_134_616 160
190 3300048923 Ga0496120_0370193 Ga0496120_0370193_146_628 160
191 3300048925 Ga0496122_0053602 Ga0496122_0053602_929_1411 160
192 3300048927 Ga0496124_0409270 Ga0496124_0409270_414_908 160
193 3300048929 Ga0496126_0002185 Ga0496126_0002185_7534_8016 160
194 3300048929 Ga0496126_0027364 Ga0496126_0027364_2548_3042 160
195 3300049586 Ga0501070_0048999 Ga0501070_0048999_1611_2099 160
196 3300049742 Ga0501080_0066865 Ga0501080_0066865_2677_3165 160
197 3300050492 nmdc:mga0yw44_255985_c1 nmdc:mga0yw44_255985_c1_316_807 160
198 3300050492 nmdc:mga0yw44_288311_c1 nmdc:mga0yw44_288311_c1_154_660 160
199 3300050492 nmdc:mga0yw44_533785_c1 nmdc:mga0yw44_533785_c1_10_504 160
200 3300050496 nmdc:mga07m45_113748_c2 nmdc:mga07m45_113748_c2_414_905 160
201 3300050516 nmdc:mga0sz30_35783_c2 nmdc:mga0sz30_35783_c2_403_897 160
202 3300053087 Ga0500643_018136 Ga0500643_018136_1777_2271 160
203 3300053139 Ga0500568_0068332 Ga0500568_0068332_382_879 160
204 3300053139 Ga0500568_0102703 Ga0500568_0102703_171_665 160
205 3300053730 Ga0500645_000104 Ga0500645_000104_257_751 160
206 iso_pu_bacteria 2929212328 2929213210 160
207 3300003792 Ga0055540_1000069 Ga0055540_100006913 161
208 3300005335 Ga0070666_10062630 Ga0070666_100626302 161
209 3300005367 Ga0070667_100000944 Ga0070667_10000094418 161
210 3300005617 Ga0068859_100023768 Ga0068859_1000237689 161
211 3300005719 Ga0068861_100259928 Ga0068861_1002599282 161
212 3300005841 Ga0068863_100021903 Ga0068863_1000219032 161
213 3300005842 Ga0068858_100120627 Ga0068858_1001206272 161
214 3300005842 Ga0068858_101464589 Ga0068858_1014645891 161
215 3300005843 Ga0068860_100001328 Ga0068860_10000132824 161
216 3300005844 Ga0068862_100001052 Ga0068862_10000105222 161
217 3300006177 Ga0075362_10040943 Ga0075362_100409431 161
218 3300006931 Ga0097620_100023766 Ga0097620_1000237669 161
219 3300009148 Ga0105243_10691105 Ga0105243_106911051 161
220 3300009177 Ga0105248_10001406 Ga0105248_100014069 161
221 3300009545 Ga0105237_11451827 Ga0105237_114518272 161
222 3300009551 Ga0105238_10108400 Ga0105238_101084004 161
223 3300009553 Ga0105249_10000927 Ga0105249_100009277 161
224 3300010375 Ga0105239_10310420 Ga0105239_103104201 161
225 3300013306 Ga0163162_10052602 Ga0163162_100526023 161
226 3300014325 Ga0163163_10085064 Ga0163163_100850643 161
227 3300014968 Ga0157379_10085501 Ga0157379_100855014 161
228 3300025303 Ga0209051_1000034 Ga0209051_1000034256 161
229 3300025903 Ga0207680_10006546 Ga0207680_100065463 161
230 3300025941 Ga0207711_10017724 Ga0207711_100177249 161
231 3300025961 Ga0207712_10000697 Ga0207712_100006977 161
232 3300025986 Ga0207658_10000469 Ga0207658_1000046923 161
233 3300025986 Ga0207658_10002139 Ga0207658_1000213911 161
234 3300026035 Ga0207703_10074448 Ga0207703_100744481 161
235 3300026035 Ga0207703_11247007 Ga0207703_112470071 161
236 3300026088 Ga0207641_10001599 Ga0207641_1000159914 161
237 3300028379 Ga0268266_10062457 Ga0268266_100624573 161
238 3300028380 Ga0268265_10000952 Ga0268265_1000095222 161
239 3300028381 Ga0268264_10000177 Ga0268264_1000017724 161
240 3300031251 Ga0265327_10000863 Ga0265327_1000086325 161
241 3300044706 Ga0466964_0062419 Ga0466964_0062419_1001_1540 161
242 3300045976 Ga0466967_0141388 Ga0466967_0141388_105_644 161
243 3300048903 Ga0496100_0000175 Ga0496100_0000175_20195_20683 161
244 3300048904 Ga0496101_0000140 Ga0496101_0000140_42584_43072 161
245 3300048905 Ga0496102_0005380 Ga0496102_0005380_4957_5442 161
246 3300048905 Ga0496102_0007713 Ga0496102_0007713_5169_5657 161
247 3300048906 Ga0496103_0000183 Ga0496103_0000183_42387_42875 161
248 3300048906 Ga0496103_0000474 Ga0496103_0000474_19243_19728 161
249 3300048909 Ga0496106_0001516 Ga0496106_0001516_13705_14193 161
250 3300048910 Ga0496107_0000145 Ga0496107_0000145_20804_21292 161
251 3300048911 Ga0496108_0002334 Ga0496108_0002334_4425_4913 161
252 3300048912 Ga0496109_0000161 Ga0496109_0000161_44300_44788 161
253 3300048913 Ga0496110_0030964 Ga0496110_0030964_3993_4481 161
254 3300048914 Ga0496111_0006072 Ga0496111_0006072_4181_4669 161
255 3300048918 Ga0496115_0072586 Ga0496115_0072586_2290_2778 161
256 3300048919 Ga0496116_0001872 Ga0496116_0001872_7135_7623 161
257 3300048919 Ga0496116_0008245 Ga0496116_0008245_5167_5652 161
258 3300048920 Ga0496117_0009692 Ga0496117_0009692_4985_5470 161
259 3300048920 Ga0496117_0013891 Ga0496117_0013891_5040_5528 161
260 3300048921 Ga0496118_0002763 Ga0496118_0002763_5957_6442 161
261 3300048921 Ga0496118_0009422 Ga0496118_0009422_4206_4694 161
262 3300048922 Ga0496119_0006822 Ga0496119_0006822_6265_6753 161
263 3300048922 Ga0496119_0015401 Ga0496119_0015401_4004_4489 161
264 3300048923 Ga0496120_0017707 Ga0496120_0017707_4090_4575 161
265 3300048924 Ga0496121_0000002 Ga0496121_0000002_582985_583473 161
266 3300048924 Ga0496121_0602698 Ga0496121_0602698_127_651 161
267 3300048925 Ga0496122_0001055 Ga0496122_0001055_20861_21349 161
268 3300048926 Ga0496123_0004209 Ga0496123_0004209_10936_11424 161
269 3300048927 Ga0496124_0000002 Ga0496124_0000002_911116_911604 161
270 3300048927 Ga0496124_0302011 Ga0496124_0302011_314_799 161
271 3300048928 Ga0496125_0000002 Ga0496125_0000002_582985_583473 161
272 3300048929 Ga0496126_0000009 Ga0496126_0000009_166878_167366 161
273 3300053096 Ga0500641_0036335 Ga0500641_0036335_427_930 161
274 3300005338 Ga0068868_101125525 Ga0068868_1011255251 162
275 3300005455 Ga0070663_100640317 Ga0070663_1006403172 162
276 3300006051 Ga0075364_10107113 Ga0075364_101071133 162
277 3300006051 Ga0075364_10372449 Ga0075364_103724492 162
278 3300006177 Ga0075362_10364656 Ga0075362_103646562 162
279 3300009101 Ga0105247_10423329 Ga0105247_104233292 162
280 3300021388 Ga0213875_10005153 Ga0213875_100051535 162
281 3300025972 Ga0207668_10975580 Ga0207668_109755802 162
282 3300031995 Ga0307409_101538105 Ga0307409_1015381052 162
283 3300037853 Ga0436364_0207480 Ga0436364_0207480_10862_11431 162
284 3300050490 nmdc:mga03n38_570449_c1 nmdc:mga03n38_570449_c1_58_549 162
285 3300050491 nmdc:mga00v17_195766_c1 nmdc:mga00v17_195766_c1_525_1022 162
286 3300050491 nmdc:mga00v17_913739_c1 nmdc:mga00v17_913739_c1_22_519 162
287 iso_pu_bacteria 2902792274 2902794462 162
288 iso_pu_bacteria 2902837492 2902839414 162
289 3300005337 Ga0070682_100160790 Ga0070682_1001607903 163
290 3300005338 Ga0068868_100666336 Ga0068868_1006663362 163
291 3300005339 Ga0070660_100907309 Ga0070660_1009073091 163
292 3300005366 Ga0070659_100060964 Ga0070659_1000609641 163
293 3300005455 Ga0070663_100760809 Ga0070663_1007608092 163
294 3300005544 Ga0070686_100767197 Ga0070686_1007671971 163
295 3300005578 Ga0068854_100160851 Ga0068854_1001608512 163
296 3300005615 Ga0070702_100086954 Ga0070702_1000869542 163
297 3300005618 Ga0068864_100244374 Ga0068864_1002443743 163
298 3300005834 Ga0068851_10398927 Ga0068851_103989271 163
299 3300006048 Ga0075363_100274400 Ga0075363_1002744002 163
300 3300006353 Ga0075370_10079815 Ga0075370_100798153 163
301 3300009098 Ga0105245_10222952 Ga0105245_102229524 163
302 3300009545 Ga0105237_10000861 Ga0105237_100008612 163
303 3300009545 Ga0105237_10009243 Ga0105237_100092436 163
304 3300010375 Ga0105239_10001018 Ga0105239_100010182 163
305 3300010375 Ga0105239_10333514 Ga0105239_103335142 163
306 3300011119 Ga0105246_10119203 Ga0105246_101192032 163
307 3300013306 Ga0163162_10153836 Ga0163162_101538362 163
308 3300014745 Ga0157377_10977699 Ga0157377_109776991 163
309 3300017792 Ga0163161_10120696 Ga0163161_101206964 163
310 3300025321 Ga0207656_10294484 Ga0207656_102944842 163
311 3300025914 Ga0207671_10007962 Ga0207671_100079626 163
312 3300025914 Ga0207671_10017674 Ga0207671_100176742 163
313 3300025932 Ga0207690_10032346 Ga0207690_100323461 163
314 3300025972 Ga0207668_10739823 Ga0207668_107398231 163
315 3300025981 Ga0207640_10084250 Ga0207640_100842502 163
316 3300026041 Ga0207639_10832873 Ga0207639_108328732 163
317 3300026067 Ga0207678_10137622 Ga0207678_101376221 163
318 3300026118 Ga0207675_100065895 Ga0207675_1000658952 163
319 3300031824 Ga0307413_10279450 Ga0307413_102794502 163
320 3300041411 Ga0439466_0031875 Ga0439466_0031875_1284_1775 163
321 3300041413 Ga0439465_0016207 Ga0439465_0016207_1651_2142 163
322 3300042435 Ga0439434_0158508 Ga0439434_0158508_92_583 163
323 3300045976 Ga0466967_0033506 Ga0466967_0033506_1522_2064 163
324 3300046523 Ga0495644_0127004 Ga0495644_0127004_193_690 163
325 3300046524 Ga0495648_0024754 Ga0495648_0024754_1697_2194 163
326 3300046616 Ga0495668_0071140 Ga0495668_0071140_522_1019 163
327 3300047320 Ga0495672_0002921 Ga0495672_0002921_3822_4319 163
328 3300047469 Ga0495673_0001467 Ga0495673_0001467_9738_10235 163
329 3300048091 Ga0495626_0022103 Ga0495626_0022103_59_550 163
330 3300048922 Ga0496119_0427748 Ga0496119_0427748_13_510 163
331 3300048929 Ga0496126_0097527 Ga0496126_0097527_1774_2271 163
332 3300049571 Ga0501034_0509787 Ga0501034_0509787_153_695 163
333 3300050491 nmdc:mga00v17_725847_c1 nmdc:mga00v17_725847_c1_82_573 163
334 3300053108 Ga0500562_004189 Ga0500562_004189_887_1378 163
335 3300053153 Ga0500616_0006838 Ga0500616_0006838_6467_6988 163
336 iso_pu_bacteria 2643221687 2644487308 163
337 3300005347 Ga0070668_100197239 Ga0070668_1001972391 164
338 3300005356 Ga0070674_100668637 Ga0070674_1006686371 164
339 3300005535 Ga0070684_100527639 Ga0070684_1005276391 164
340 3300006048 Ga0075363_100026104 Ga0075363_1000261042 164
341 3300006051 Ga0075364_10013876 Ga0075364_100138764 164
342 3300006175 Ga0070712_100643249 Ga0070712_1006432491 164
343 3300006177 Ga0075362_10238014 Ga0075362_102380141 164
344 3300006186 Ga0075369_10006370 Ga0075369_100063702 164
345 3300006353 Ga0075370_10001730 Ga0075370_100017303 164
346 3300006931 Ga0097620_101761514 Ga0097620_1017615141 164
347 3300007788 Ga0099795_10058860 Ga0099795_100588603 164
348 3300009176 Ga0105242_10189287 Ga0105242_101892872 164
349 3300009176 Ga0105242_10545968 Ga0105242_105459682 164
350 3300009177 Ga0105248_10018191 Ga0105248_100181912 164
351 3300009982 Ga0105147_105492 Ga0105147_1054921 164
352 3300013297 Ga0157378_10092624 Ga0157378_100926242 164
353 3300013308 Ga0157375_10402591 Ga0157375_104025912 164
354 3300014326 Ga0157380_10478914 Ga0157380_104789142 164
355 3300025927 Ga0207687_10612702 Ga0207687_106127022 164
356 3300025931 Ga0207644_10636921 Ga0207644_106369211 164
357 3300025937 Ga0207669_10063742 Ga0207669_100637422 164
358 3300025941 Ga0207711_10026386 Ga0207711_100263862 164
359 3300025972 Ga0207668_10013943 Ga0207668_100139432 164
360 3300031824 Ga0307413_10289814 Ga0307413_102898142 164
361 3300031852 Ga0307410_10010732 Ga0307410_100107324 164
362 3300031903 Ga0307407_10324364 Ga0307407_103243642 164
363 3300032002 Ga0307416_100164181 Ga0307416_1001641812 164
364 3300036712 Ga0316584_0231143 Ga0316584_0231143_21_569 164
365 3300044684 Ga0466966_0049060 Ga0466966_0049060_499_993 164
366 3300044693 Ga0466961_0013732 Ga0466961_0013732_2716_3210 164
367 3300044706 Ga0466964_0123693 Ga0466964_0123693_564_1058 164
368 3300044765 Ga0466970_0031192 Ga0466970_0031192_1379_1873 164
369 3300045049 Ga0466959_0365014 Ga0466959_0365014_173_667 164
370 3300045836 Ga0466958_0132757 Ga0466958_0132757_66_560 164
371 3300046507 Ga0495606_0076148 Ga0495606_0076148_400_900 164
372 3300046507 Ga0495606_0162549 Ga0495606_0162549_14_559 164
373 3300046660 Ga0495625_0155276 Ga0495625_0155276_728_1222 164
374 3300046663 Ga0495635_0062426 Ga0495635_0062426_989_1489 164
375 3300046694 Ga0495649_0249046 Ga0495649_0249046_136_633 164
376 3300047320 Ga0495672_0021042 Ga0495672_0021042_3193_3741 164
377 3300048903 Ga0496100_0004450 Ga0496100_0004450_6633_7148 164
378 3300048904 Ga0496101_0000014 Ga0496101_0000014_205476_205976 164
379 3300048904 Ga0496101_0004665 Ga0496101_0004665_52_567 164
380 3300048905 Ga0496102_0000041 Ga0496102_0000041_74707_75207 164
381 3300048906 Ga0496103_0000058 Ga0496103_0000058_48724_49224 164
382 3300048907 Ga0496104_0008084 Ga0496104_0008084_36_551 164
383 3300048908 Ga0496105_0003856 Ga0496105_0003856_9028_9543 164
384 3300048909 Ga0496106_0007881 Ga0496106_0007881_286_801 164
385 3300048909 Ga0496106_0016728 Ga0496106_0016728_4331_4831 164
386 3300048910 Ga0496107_0036110 Ga0496107_0036110_538_1053 164
387 3300048919 Ga0496116_0000098 Ga0496116_0000098_74570_75070 164
388 3300048920 Ga0496117_0000096 Ga0496117_0000096_74861_75361 164
389 3300048921 Ga0496118_0000073 Ga0496118_0000073_121428_121928 164
390 3300048922 Ga0496119_0039627 Ga0496119_0039627_2212_2712 164
391 3300048923 Ga0496120_0071781 Ga0496120_0071781_133_645 164
392 3300048924 Ga0496121_0000354 Ga0496121_0000354_61492_61992 164
393 3300048924 Ga0496121_0076675 Ga0496121_0076675_265_813 164
394 3300048929 Ga0496126_0001057 Ga0496126_0001057_29688_30188 164
395 3300050489 nmdc:mga03683_64535_c1 nmdc:mga03683_64535_c1_211_759 164
396 3300050490 nmdc:mga03n38_105_c2 nmdc:mga03n38_105_c2_4925_5473 164
397 3300050490 nmdc:mga03n38_431932_c1 nmdc:mga03n38_431932_c1_150_701 164
398 3300050496 nmdc:mga07m45_781_c1 nmdc:mga07m45_781_c1_691_1239 164
399 3300050516 nmdc:mga0sz30_15777_c1 nmdc:mga0sz30_15777_c1_1409_2005 164
400 3300053079 Ga0500610_0049828 Ga0500610_0049828_1622_2116 164
401 3300053080 Ga0500635_0016452 Ga0500635_0016452_1260_1775 164
402 3300053134 Ga0500658_0264463 Ga0500658_0264463_109_603 164
403 3300053158 Ga0500627_0142692 Ga0500627_0142692_348_842 164
404 3300061719 Ga0466962_0011429 Ga0466962_0011429_989_1483 164
405 iso_pu_bacteria 2738541274 2738702668 164
406 iso_pu_bacteria 2738543028 2739329578 164
407 3300005435 Ga0070714_100921800 Ga0070714_1009218002 165
408 3300006038 Ga0075365_10041588 Ga0075365_100415882 165
409 3300006042 Ga0075368_10021017 Ga0075368_100210173 165
410 3300006353 Ga0075370_10011637 Ga0075370_100116371 165
411 3300013306 Ga0163162_11664273 Ga0163162_116642732 165
412 3300025294 Ga0209025_1068937 Ga0209025_10689372 165
413 3300027866 Ga0209813_10109140 Ga0209813_101091402 165
414 3300035242 Ga0373962_0186011 Ga0373962_0186011_117_614 165
415 3300050492 nmdc:mga0yw44_385197_c1 nmdc:mga0yw44_385197_c1_148_708 165
416 3300003792 Ga0055540_1004053 Ga0055540_10040532 166
417 3300005539 Ga0068853_100020960 Ga0068853_1000209601 166
418 3300005548 Ga0070665_100312680 Ga0070665_1003126802 166
419 3300005616 Ga0068852_100666255 Ga0068852_1006662551 166
420 3300005617 Ga0068859_101872012 Ga0068859_1018720121 166
421 3300006931 Ga0097620_101872009 Ga0097620_1018720091 166
422 3300009176 Ga0105242_11457881 Ga0105242_114578811 166
423 3300025303 Ga0209051_1000478 Ga0209051_100047845 166
424 3300025934 Ga0207686_10771588 Ga0207686_107715882 166
425 3300026035 Ga0207703_10480044 Ga0207703_104800441 166
426 3300026041 Ga0207639_10172247 Ga0207639_101722471 166
427 3300041451 Ga0451791_1279037 Ga0451791_1279037_326_832 166
428 3300041452 Ga0451793_0215373 Ga0451793_0215373_105_605 166
429 3300041456 Ga0451795_0191807 Ga0451795_0191807_542_1048 166
430 3300047472 Ga0495686_0008890 Ga0495686_0008890_6620_7123 166
431 3300003792 Ga0055540_1001260 Ga0055540_10012607 167
432 3300003792 Ga0055540_1004594 Ga0055540_10045946 167
433 3300005937 Ga0081455_10062517 Ga0081455_100625173 167
434 3300006353 Ga0075370_10088176 Ga0075370_100881762 167
435 3300025273 Ga0209673_1075798 Ga0209673_10757981 167
436 3300025303 Ga0209051_1002514 Ga0209051_10025146 167
437 3300025303 Ga0209051_1007549 Ga0209051_10075493 167
438 3300041452 Ga0451793_1265219 Ga0451793_1265219_1080_1613 167
439 3300049571 Ga0501034_0549943 Ga0501034_0549943_235_747 167
440 3300050491 nmdc:mga00v17_354362_c1 nmdc:mga00v17_354362_c1_233_751 167
441 3300050496 nmdc:mga07m45_32491_c1 nmdc:mga07m45_32491_c1_1991_2509 167
442 3300050516 nmdc:mga0sz30_64772_c1 nmdc:mga0sz30_64772_c1_130_663 167
443 3300001977 JGI24746J21847_1002778 JGI24746J21847_10027781 168
444 3300002070 JGI24750J21931_1031643 JGI24750J21931_10316432 168
445 3300002077 JGI24744J21845_10022419 JGI24744J21845_100224191 168
446 3300005328 Ga0070676_10265359 Ga0070676_102653592 168
447 3300005330 Ga0070690_100403928 Ga0070690_1004039282 168
448 3300005334 Ga0068869_100214318 Ga0068869_1002143181 168
449 3300005337 Ga0070682_100297656 Ga0070682_1002976562 168
450 3300005340 Ga0070689_100142744 Ga0070689_1001427442 168
451 3300005341 Ga0070691_10092103 Ga0070691_100921033 168
452 3300005343 Ga0070687_100635367 Ga0070687_1006353671 168
453 3300005345 Ga0070692_10164435 Ga0070692_101644352 168
454 3300005347 Ga0070668_100253920 Ga0070668_1002539202 168
455 3300005356 Ga0070674_100088159 Ga0070674_1000881594 168
456 3300005364 Ga0070673_100658546 Ga0070673_1006585461 168
457 3300005365 Ga0070688_100161712 Ga0070688_1001617122 168
458 3300005366 Ga0070659_100131777 Ga0070659_1001317774 168
459 3300005367 Ga0070667_100109528 Ga0070667_1001095283 168
460 3300005434 Ga0070709_10173545 Ga0070709_101735453 168
461 3300005437 Ga0070710_10188800 Ga0070710_101888001 168
462 3300005438 Ga0070701_10259458 Ga0070701_102594581 168
463 3300005441 Ga0070700_100130634 Ga0070700_1001306342 168
464 3300005444 Ga0070694_100481376 Ga0070694_1004813762 168
465 3300005455 Ga0070663_100604730 Ga0070663_1006047301 168
466 3300005456 Ga0070678_101463519 Ga0070678_1014635191 168
467 3300005457 Ga0070662_100222160 Ga0070662_1002221602 168
468 3300005458 Ga0070681_10942871 Ga0070681_109428713 168
469 3300005459 Ga0068867_100412658 Ga0068867_1004126582 168
470 3300005466 Ga0070685_10259599 Ga0070685_102595992 168
471 3300005539 Ga0068853_100745811 Ga0068853_1007458112 168
472 3300005546 Ga0070696_100260533 Ga0070696_1002605332 168
473 3300005548 Ga0070665_100064139 Ga0070665_1000641396 168
474 3300005549 Ga0070704_100174851 Ga0070704_1001748511 168
475 3300005564 Ga0070664_100515857 Ga0070664_1005158573 168
476 3300005578 Ga0068854_100235411 Ga0068854_1002354113 168
477 3300005617 Ga0068859_100185608 Ga0068859_1001856082 168
478 3300005842 Ga0068858_100138632 Ga0068858_1001386325 168
479 3300005844 Ga0068862_100971569 Ga0068862_1009715692 168
480 3300006173 Ga0070716_100143485 Ga0070716_1001434851 168
481 3300006175 Ga0070712_100701799 Ga0070712_1007017992 168
482 3300006237 Ga0097621_100454760 Ga0097621_1004547601 168
483 3300006931 Ga0097620_100185623 Ga0097620_1001856233 168
484 3300009098 Ga0105245_10198742 Ga0105245_101987422 168
485 3300009101 Ga0105247_10086208 Ga0105247_100862082 168
486 3300009148 Ga0105243_11062844 Ga0105243_110628442 168
487 3300009174 Ga0105241_11146825 Ga0105241_111468252 168
488 3300009176 Ga0105242_11383035 Ga0105242_113830352 168
489 3300009545 Ga0105237_11169521 Ga0105237_111695212 168
490 3300010159 Ga0099796_10037573 Ga0099796_100375732 168
491 3300010375 Ga0105239_10486245 Ga0105239_104862452 168
492 3300011119 Ga0105246_10022328 Ga0105246_100223283 168
493 3300013102 Ga0157371_11086303 Ga0157371_110863031 168
494 3300013105 Ga0157369_10593392 Ga0157369_105933922 168
495 3300013296 Ga0157374_10020342 Ga0157374_100203423 168
496 3300014326 Ga0157380_10890153 Ga0157380_108901532 168
497 3300014968 Ga0157379_10126965 Ga0157379_101269653 168
498 3300014969 Ga0157376_10904706 Ga0157376_109047062 168
499 3300017792 Ga0163161_10217854 Ga0163161_102178544 168
500 3300025899 Ga0207642_10034893 Ga0207642_100348933 168
501 3300025900 Ga0207710_10227852 Ga0207710_102278522 168
502 3300025901 Ga0207688_10012564 Ga0207688_100125643 168
503 3300025905 Ga0207685_10140984 Ga0207685_101409842 168
504 3300025907 Ga0207645_10623305 Ga0207645_106233051 168
505 3300025915 Ga0207693_10120816 Ga0207693_101208163 168
506 3300025934 Ga0207686_10164090 Ga0207686_101640904 168
507 3300025935 Ga0207709_10147973 Ga0207709_101479733 168
508 3300025936 Ga0207670_10294805 Ga0207670_102948052 168
509 3300025939 Ga0207665_10086694 Ga0207665_100866943 168
510 3300025941 Ga0207711_10564504 Ga0207711_105645042 168
511 3300025942 Ga0207689_10218696 Ga0207689_102186963 168
512 3300025960 Ga0207651_10611717 Ga0207651_106117172 168
513 3300025986 Ga0207658_10124871 Ga0207658_101248713 168
514 3300026041 Ga0207639_10410161 Ga0207639_104101611 168
515 3300026067 Ga0207678_10220912 Ga0207678_102209123 168
516 3300026075 Ga0207708_10198721 Ga0207708_101987212 168
517 3300026089 Ga0207648_10232783 Ga0207648_102327832 168
518 3300026121 Ga0207683_10170619 Ga0207683_101706192 168
519 3300028379 Ga0268266_10164281 Ga0268266_101642813 168
520 3300028380 Ga0268265_10494526 Ga0268265_104945261 168
521 3300028381 Ga0268264_10138341 Ga0268264_101383413 168
522 3300048903 Ga0496100_0882632 Ga0496100_0882632_172_678 168
523 3300048904 Ga0496101_0359138 Ga0496101_0359138_611_1117 168
524 3300048905 Ga0496102_0049028 Ga0496102_0049028_2908_3414 168
525 3300048907 Ga0496104_0056174 Ga0496104_0056174_275_781 168
526 3300048908 Ga0496105_0664438 Ga0496105_0664438_96_602 168
527 3300048909 Ga0496106_0757842 Ga0496106_0757842_247_753 168
528 3300048911 Ga0496108_0001944 Ga0496108_0001944_4513_5019 168
529 3300048912 Ga0496109_0020865 Ga0496109_0020865_4034_4540 168
530 3300048913 Ga0496110_0060799 Ga0496110_0060799_1540_2046 168
531 3300048917 Ga0496114_0280650 Ga0496114_0280650_527_1033 168
532 3300053083 Ga0495655_0207148 Ga0495655_0207148_90_596 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05610

DUF779

Protein of unknown function (DUF779)

42

139

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.5543 8 109
3q91-assembly1.cif.gz_B crystal structure of human uridine diphosphate glucose pyrophosphatase (nudt14) 0.5459 28 75
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.5255 11 109
1x0g-assembly1.cif.gz_C crystal structure of isca with the [2fe-2s] cluster 0.5182 9 134
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.5152 8 109
ID Description Score Start End Superfamily
af_O53744_16_113_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8996 19 115 2.60.300.12
af_O53744_16_113_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8821 19 115 2.60.300.12
af_O96161_49_160_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.6031 9 94 2.60.300.12
af_O43045_97_205_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.5604 9 109 2.60.300.12
af_P9WMN5_14_118_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.5569 10 112 2.60.300.12
ID Description Score Start End GO Terms
AF-A0A7T0W8U4-F1-model_v4 deleted 0.958 8 126
AF-A0A0J6W152-F1-model_v4 DUF779 domain-containing protein 0.9484 5 159
AF-A0A7I7UGU0-F1-model_v4 Acetaldehyde dehydrogenase 0.9372 6 144
AF-A0A7M0XT82-F1-model_v4 deleted 0.9359 4 149
AF-A0A7I7M0M4-F1-model_v4 deleted 0.9335 2 152

Feature Viewer

pLDDT pTM Quality
85.67 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map