F460142

General Info

Members Datasets Scaffolds Average Seq Length
531 195 1062 70

Family's Representative Sequence

Representative Sequence 3300025925|Ga0207650_10619418|Ga0207650_106194182
Length 84
Sequence VPAAQCPAPDKGFQMMRDDLATLVQQMIDRGILFDDAQREFERMFITRALAKTNYNVCKAAKMTGLHRNTLSRKMSAYKIRKTA

Samples

Sample ID Description Type Environment
1 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
113 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
115 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
156 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
157 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
167 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
168 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
169 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
175 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
180 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
181 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
182 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
192 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.88
Nodule 0
Rhizoplane 0.94
Rhizosphere 96.99
Stem 0
Stem Tuber 0
Unclassified 6.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207650_10619418 3300025925 Bacteria 911
2 Ga0065712_10808873 3300005290 Bacteria 510
3 Ga0065715_10106689 3300005293 Bacteria 2812
4 Ga0065715_10267860 3300005293 Bacteria 1119
5 Ga0065715_11168942 3300005293 Unclassified 505
6 Ga0065707_10083636 3300005295 Bacteria 8573
7 Ga0065707_10109531 3300005295 Bacteria 2465
8 Ga0065707_10163268 3300005295 Bacteria 1523
9 Ga0065707_11157760 3300005295 Unclassified 503
10 Ga0070676_11310947 3300005328 Bacteria 553
11 Ga0070690_100318403 3300005330 Bacteria 1120
12 Ga0070690_100529211 3300005330 Bacteria 886
13 Ga0070670_101023305 3300005331 Bacteria 752
14 Ga0070670_101142356 3300005331 Bacteria 711
15 Ga0068869_100257149 3300005334 Bacteria 1397
16 Ga0070680_100708704 3300005336 Bacteria 866
17 Ga0070682_101175145 3300005337 Bacteria 646
18 Ga0070689_100037943 3300005340 Bacteria 3685
19 Ga0070689_100697703 3300005340 Bacteria 886
20 Ga0070689_101089459 3300005340 Bacteria 714
21 Ga0070689_101468001 3300005340 Bacteria 617
22 Ga0070689_101496912 3300005340 Bacteria 611
23 Ga0070689_101650003 3300005340 Bacteria 583
24 Ga0070689_101676606 3300005340 Unclassified 578
25 Ga0070669_100184106 3300005353 Bacteria 1635
26 Ga0070669_100384864 3300005353 Bacteria 1144
27 Ga0070669_101449931 3300005353 Bacteria 596
28 Ga0070675_100422002 3300005354 Bacteria 1193
29 Ga0070675_100842506 3300005354 Bacteria 839
30 Ga0070675_101107739 3300005354 Bacteria 728
31 Ga0070671_100312394 3300005355 Bacteria 1339
32 Ga0070674_101875382 3300005356 Bacteria 544
33 Ga0070673_100871413 3300005364 Bacteria 834
34 Ga0070688_100217884 3300005365 Bacteria 1344
35 Ga0070688_100512439 3300005365 Bacteria 907
36 Ga0070688_100852301 3300005365 Bacteria 716
37 Ga0070688_100989304 3300005365 Bacteria 668
38 Ga0070667_100348081 3300005367 Bacteria 1341
39 Ga0070701_10037013 3300005438 Bacteria 2462
40 Ga0070705_100819314 3300005440 Bacteria 742
41 Ga0070705_101042459 3300005440 Bacteria 666
42 Ga0070708_100097623 3300005445 Bacteria 2686
43 Ga0070678_101410313 3300005456 Unclassified 650
44 Ga0070678_101625103 3300005456 Bacteria 607
45 Ga0070681_11497808 3300005458 Bacteria 599
46 Ga0068867_101702937 3300005459 Bacteria 591
47 Ga0070685_10096454 3300005466 Bacteria 1799
48 Ga0070706_101216908 3300005467 Bacteria 692
49 Ga0070698_101572867 3300005471 Unclassified 609
50 Ga0070699_100412645 3300005518 Bacteria 1222
51 Ga0070699_101983500 3300005518 Bacteria 532
52 Ga0068853_100618837 3300005539 Bacteria 1029
53 Ga0070686_100199084 3300005544 Bacteria 1435
54 Ga0070686_100891781 3300005544 Bacteria 723
55 Ga0070665_102507647 3300005548 Bacteria 517
56 Ga0070704_100225226 3300005549 Bacteria 1527
57 Ga0070704_101863467 3300005549 Unclassified 557
58 Ga0068857_101115910 3300005577 Bacteria 762
59 Ga0068857_102427121 3300005577 Unclassified 515
60 Ga0068856_101851094 3300005614 Bacteria 615
61 Ga0070702_100367384 3300005615 Bacteria 1019
62 Ga0068859_100190252 3300005617 Bacteria 2136
63 Ga0068859_100199272 3300005617 Bacteria 2086
64 Ga0068859_100833050 3300005617 Bacteria 1009
65 Ga0068859_101012400 3300005617 Bacteria 912
66 Ga0068859_101197393 3300005617 Bacteria 837
67 Ga0068864_100453038 3300005618 Bacteria 1227
68 Ga0068864_101030562 3300005618 Unclassified 817
69 Ga0068866_10441118 3300005718 Bacteria 849
70 Ga0068861_100547804 3300005719 Bacteria 1054
71 Ga0068861_100940794 3300005719 Bacteria 821
72 Ga0068861_101242508 3300005719 Bacteria 722
73 Ga0068863_100309525 3300005841 Bacteria 1533
74 Ga0068863_100877485 3300005841 Bacteria 897
75 Ga0068858_100991530 3300005842 Bacteria 823
76 Ga0068858_102323527 3300005842 Bacteria 530
77 Ga0068860_100485960 3300005843 Bacteria 1231
78 Ga0068860_100880854 3300005843 Bacteria 911
79 Ga0068862_100312778 3300005844 Bacteria 1448
80 Ga0068862_100566288 3300005844 Bacteria 1087
81 Ga0068862_101386047 3300005844 Bacteria 706
82 Ga0068862_101787073 3300005844 Bacteria 624
83 Ga0068862_102723052 3300005844 Unclassified 506
84 Ga0081538_10146106 3300005981 Bacteria 1080
85 Ga0081539_10427651 3300005985 Unclassified 549
86 Ga0075364_10007620 3300006051 Bacteria 6437
87 Ga0075432_10513042 3300006058 Bacteria 536
88 Ga0075367_10004665 3300006178 Bacteria 6722
89 Ga0075427_10040108 3300006194 Bacteria 787
90 Ga0075366_10638435 3300006195 Bacteria 660
91 Ga0075366_11021360 3300006195 Bacteria 516
92 Ga0097621_100334166 3300006237 Bacteria 1344
93 Ga0097621_100669965 3300006237 Bacteria 953
94 Ga0097621_101745846 3300006237 Unclassified 593
95 Ga0097621_101823912 3300006237 Unclassified 580
96 Ga0068871_100821624 3300006358 Bacteria 858
97 Ga0075428_100041348 3300006844 Bacteria 5070
98 Ga0075428_100125007 3300006844 Bacteria 2799
99 Ga0075428_100534550 3300006844 Bacteria 1254
100 Ga0075428_101065284 3300006844 Bacteria 855
101 Ga0075430_100026786 3300006846 Bacteria 4903
102 Ga0075430_100073381 3300006846 Bacteria 2870
103 Ga0075431_100018273 3300006847 Bacteria 7134
104 Ga0075431_100637873 3300006847 Bacteria 1047
105 Ga0075433_10002179 3300006852 Bacteria 14842
106 Ga0075433_10069844 3300006852 Bacteria 3086
107 Ga0075433_10198755 3300006852 Bacteria 1783
108 Ga0075433_10366913 3300006852 Bacteria 1271
109 Ga0075434_100001038 3300006871 Bacteria 22646
110 Ga0075434_100157165 3300006871 Bacteria 2293
111 Ga0075434_100409508 3300006871 Bacteria 1377
112 Ga0075434_100549330 3300006871 Bacteria 1175
113 Ga0075429_100021547 3300006880 Bacteria 5586
114 Ga0075429_100064622 3300006880 Bacteria 3187
115 Ga0075429_100796343 3300006880 Bacteria 828
116 Ga0075429_101431362 3300006880 Unclassified 602
117 Ga0075429_101667592 3300006880 Bacteria 554
118 Ga0068865_100084711 3300006881 Bacteria 2285
119 Ga0068865_101155002 3300006881 Bacteria 684
120 Ga0097620_100190257 3300006931 Bacteria 2136
121 Ga0097620_100199277 3300006931 Bacteria 2086
122 Ga0097620_100832986 3300006931 Bacteria 1009
123 Ga0097620_101012421 3300006931 Bacteria 912
124 Ga0097620_101197342 3300006931 Bacteria 837
125 Ga0075435_100338659 3300007076 Bacteria 1289
126 Ga0075435_101367573 3300007076 Bacteria 620
127 Ga0075435_101636458 3300007076 Bacteria 565
128 Ga0105251_10200909 3300009011 Bacteria 898
129 Ga0111539_10000384 3300009094 Bacteria 54554
130 Ga0111539_10001278 3300009094 Bacteria 33608
131 Ga0111539_10071256 3300009094 Bacteria 4101
132 Ga0111539_10144135 3300009094 Bacteria 2788
133 Ga0111539_10156642 3300009094 Bacteria 2665
134 Ga0111539_10295199 3300009094 Bacteria 1886
135 Ga0111539_10313555 3300009094 Bacteria 1826
136 Ga0111539_10948908 3300009094 Bacteria 1000
137 Ga0111539_10986932 3300009094 Bacteria 979
138 Ga0105245_11314292 3300009098 Bacteria 772
139 Ga0105245_12663642 3300009098 Unclassified 553
140 Ga0114129_10000306 3300009147 Bacteria 57109
141 Ga0114129_10025154 3300009147 Bacteria 8438
142 Ga0114129_10109706 3300009147 Bacteria 3809
143 Ga0114129_10122972 3300009147 Bacteria 3570
144 Ga0114129_10269389 3300009147 Bacteria 2279
145 Ga0114129_10732860 3300009147 Bacteria 1267
146 Ga0105243_10337754 3300009148 Bacteria 1379
147 Ga0105243_10504649 3300009148 Bacteria 1147
148 Ga0105243_10911907 3300009148 Bacteria 875
149 Ga0105243_12542976 3300009148 Bacteria 551
150 Ga0105242_10472503 3300009176 Bacteria 1186
151 Ga0105242_10703222 3300009176 Bacteria 989
152 Ga0105242_10821533 3300009176 Bacteria 922
153 Ga0105242_11465120 3300009176 Bacteria 712
154 Ga0105248_10042818 3300009177 Bacteria 5077
155 Ga0105248_10216722 3300009177 Bacteria 2156
156 Ga0105248_10365435 3300009177 Bacteria 1624
157 Ga0105248_11811750 3300009177 Bacteria 692
158 Ga0105248_12716377 3300009177 Bacteria 565
159 Ga0105249_10134786 3300009553 Bacteria 2362
160 Ga0105249_10414872 3300009553 Bacteria 1379
161 Ga0105249_11455338 3300009553 Bacteria 757
162 Ga0105249_12186302 3300009553 Unclassified 626
163 Ga0105249_12939847 3300009553 Unclassified 547
164 Ga0157370_11332104 3300013104 Bacteria 647
165 Ga0163162_10055263 3300013306 Bacteria 3996
166 Ga0163162_10294832 3300013306 Bacteria 1753
167 Ga0163162_11708679 3300013306 Bacteria 719
168 Ga0163162_12321975 3300013306 Bacteria 616
169 Ga0157375_10870462 3300013308 Bacteria 1046
170 Ga0157375_12137559 3300013308 Unclassified 666
171 Ga0163163_10000017 3300014325 Bacteria 208781
172 Ga0163163_10852133 3300014325 Bacteria 975
173 Ga0163163_11062824 3300014325 Bacteria 873
174 Ga0163163_11968065 3300014325 Bacteria 644
175 Ga0157380_10130140 3300014326 Bacteria 2145
176 Ga0157380_10351344 3300014326 Bacteria 1380
177 Ga0157380_10488989 3300014326 Bacteria 1192
178 Ga0157380_10511718 3300014326 Bacteria 1169
179 Ga0157380_10519037 3300014326 Bacteria 1161
180 Ga0157380_11491188 3300014326 Bacteria 729
181 Ga0157379_11445473 3300014968 Bacteria 667
182 Ga0157376_10049860 3300014969 Bacteria 3470
183 Ga0157376_10567866 3300014969 Bacteria 1125
184 Ga0157376_13085086 3300014969 Bacteria 504
185 Ga0163161_12021661 3300017792 Bacteria 513
186 Ga0207680_10876891 3300025903 Bacteria 643
187 Ga0207684_10258708 3300025910 Bacteria 1502
188 Ga0207681_10188726 3300025923 Bacteria 1575
189 Ga0207681_11354593 3300025923 Bacteria 597
190 Ga0207650_10502142 3300025925 Bacteria 1014
191 Ga0207659_10117488 3300025926 Bacteria 2033
192 Ga0207644_10336533 3300025931 Bacteria 1223
193 Ga0207706_10514599 3300025933 Bacteria 1032
194 Ga0207686_10304519 3300025934 Bacteria 1185
195 Ga0207686_10354145 3300025934 Bacteria 1106
196 Ga0207709_10487137 3300025935 Bacteria 960
197 Ga0207709_10629785 3300025935 Bacteria 852
198 Ga0207670_10020669 3300025936 Bacteria 4050
199 Ga0207670_10189447 3300025936 Bacteria 1555
200 Ga0207670_10546293 3300025936 Bacteria 946
201 Ga0207670_10869847 3300025936 Bacteria 754
202 Ga0207670_11146591 3300025936 Unclassified 657
203 Ga0207670_11162349 3300025936 Bacteria 653
204 Ga0207704_10068835 3300025938 Bacteria 2233
205 Ga0207704_11819241 3300025938 Unclassified 524
206 Ga0207711_10014776 3300025941 Bacteria 6488
207 Ga0207711_11436475 3300025941 Bacteria 632
208 Ga0207711_11875775 3300025941 Bacteria 542
209 Ga0207689_10795525 3300025942 Bacteria 798
210 Ga0207651_10463747 3300025960 Bacteria 1089
211 Ga0207651_10816018 3300025960 Bacteria 828
212 Ga0207712_10480470 3300025961 Bacteria 1059
213 Ga0207712_10511138 3300025961 Bacteria 1028
214 Ga0207712_10904041 3300025961 Bacteria 780
215 Ga0207712_10918479 3300025961 Bacteria 774
216 Ga0207668_10596691 3300025972 Bacteria 962
217 Ga0207658_10782611 3300025986 Bacteria 865
218 Ga0207703_10950861 3300026035 Bacteria 823
219 Ga0207703_12056551 3300026035 Bacteria 547
220 Ga0207708_10697958 3300026075 Bacteria 867
221 Ga0207641_11165008 3300026088 Bacteria 770
222 Ga0207641_11225393 3300026088 Bacteria 750
223 Ga0207648_10342679 3300026089 Bacteria 1346
224 Ga0207648_10590384 3300026089 Bacteria 1023
225 Ga0207648_12053149 3300026089 Bacteria 533
226 Ga0207676_10992021 3300026095 Bacteria 827
227 Ga0207676_12511330 3300026095 Unclassified 512
228 Ga0207674_11436502 3300026116 Bacteria 659
229 Ga0207675_100247892 3300026118 Bacteria 1723
230 Ga0207675_100617429 3300026118 Bacteria 1088
231 Ga0207675_101037627 3300026118 Bacteria 839
232 Ga0207675_101057951 3300026118 Bacteria 831
233 Ga0207675_101196463 3300026118 Bacteria 780
234 Ga0210002_1088986 3300027617 Bacteria 554
235 Ga0209813_10045578 3300027866 Bacteria 1351
236 Ga0207428_10001175 3300027907 Bacteria 28199
237 Ga0207428_10006010 3300027907 Bacteria 11240
238 Ga0207428_10269018 3300027907 Bacteria 1267
239 Ga0207428_10317203 3300027907 Bacteria 1152
240 Ga0207428_10851080 3300027907 Bacteria 646
241 Ga0268265_11927700 3300028380 Unclassified 598
242 Ga0268265_12020221 3300028380 Bacteria 584
243 Ga0268265_12068854 3300028380 Bacteria 576
244 Ga0268264_10666703 3300028381 Bacteria 1031
245 Ga0268264_11564709 3300028381 Bacteria 670
246 Ga0268264_12313794 3300028381 Unclassified 544
247 Ga0265338_11204044 3300028800 Unclassified 508
248 Ga0307408_102155049 3300031548 Bacteria 538
249 Ga0307413_11837921 3300031824 Unclassified 543
250 Ga0307410_10091206 3300031852 Bacteria 2163
251 Ga0307406_11624935 3300031901 Bacteria 571
252 Ga0307415_100058427 3300032126 Bacteria 2656
253 Ga0373934_0024333 3300035086 Bacteria 2341
254 Ga0373923_0534498 3300035111 Bacteria 574
255 Ga0373956_0009647 3300035119 Bacteria 3930
256 Ga0373957_0029155 3300035120 Bacteria 2015
257 Ga0373955_0182003 3300035172 Bacteria 1247
258 Ga0373961_0235910 3300035241 Bacteria 657
259 Ga0373933_0024927 3300035724 Bacteria 3428
260 Ga0373947_0648531 3300035725 Bacteria 720
261 Ga0373937_0000653 3300036401 Bacteria 30406
262 Ga0451807_0758639 3300041486 Bacteria 1012
263 Ga0451853_2832330 3300041512 Bacteria 668
264 Ga0451576_0005669 3300045051 Bacteria 15592
265 Ga0495592_0165331 3300046454 Bacteria 1519
266 Ga0495592_0268610 3300046454 Bacteria 1120
267 Ga0495592_0394390 3300046454 Bacteria 878
268 Ga0495603_0443255 3300046455 Bacteria 744
269 Ga0495651_0494388 3300046462 Bacteria 784
270 Ga0495639_0122884 3300046475 Bacteria 1239
271 Ga0495628_0503216 3300046516 Bacteria 875
272 Ga0495628_0641631 3300046516 Bacteria 755
273 Ga0495633_0375303 3300046558 Bacteria 644
274 Ga0495599_0133031 3300046678 Bacteria 1544
275 Ga0495599_0353943 3300046678 Bacteria 880
276 Ga0495658_0933333 3300046683 Bacteria 555
277 Ga0495600_0187077 3300046809 Bacteria 1333
278 Ga0495672_0158010 3300047320 Bacteria 1169
279 Ga0495684_0332116 3300047471 Bacteria 1084
280 Ga0495684_0611970 3300047471 Bacteria 734
281 Ga0496104_0556865 3300048907 Bacteria 1057
282 Ga0496105_0123141 3300048908 Bacteria 2138
283 Ga0496109_1483207 3300048912 Bacteria 613
284 Ga0496114_1057459 3300048917 Bacteria 696
285 Ga0501299_021939 3300049522 Bacteria 1175
286 Ga0501031_0003040 3300049568 Bacteria 10721
287 Ga0501031_0026492 3300049568 Bacteria 3780
288 Ga0501031_0375858 3300049568 Bacteria 919
289 Ga0501031_0453832 3300049568 Bacteria 828
290 Ga0501032_0007443 3300049569 Bacteria 7995
291 Ga0501032_0009867 3300049569 Bacteria 6902
292 Ga0501032_0032625 3300049569 Bacteria 3568
293 Ga0501032_0040811 3300049569 Bacteria 3153
294 Ga0501032_0388999 3300049569 Bacteria 896
295 Ga0501033_0015678 3300049570 Bacteria 5746
296 Ga0501033_0026613 3300049570 Bacteria 4351
297 Ga0501033_0034726 3300049570 Bacteria 3780
298 Ga0501033_0107457 3300049570 Bacteria 2032
299 Ga0501034_0014104 3300049571 Bacteria 8233
300 Ga0501034_0080994 3300049571 Bacteria 3249
301 Ga0501034_0092589 3300049571 Bacteria 3019
302 Ga0501034_0138792 3300049571 Bacteria 2411
303 Ga0501034_0176920 3300049571 Bacteria 2099
304 Ga0501034_0270418 3300049571 Bacteria 1640
305 Ga0501034_0365507 3300049571 Bacteria 1369
306 Ga0501036_0004857 3300049572 Bacteria 10861
307 Ga0501036_0006161 3300049572 Bacteria 9729
308 Ga0501036_0006855 3300049572 Bacteria 9256
309 Ga0501036_0026801 3300049572 Bacteria 4869
310 Ga0501036_0069432 3300049572 Bacteria 2980
311 Ga0501036_0172961 3300049572 Bacteria 1819
312 Ga0501036_0497440 3300049572 Bacteria 1014
313 Ga0501036_1026880 3300049572 Bacteria 674
314 Ga0501037_0004384 3300049573 Bacteria 10248
315 Ga0501037_0022109 3300049573 Bacteria 4705
316 Ga0501037_0059178 3300049573 Bacteria 2795
317 Ga0501037_0380159 3300049573 Bacteria 971
318 Ga0501037_0381615 3300049573 Bacteria 968
319 Ga0501037_1004063 3300049573 Bacteria 543
320 Ga0501038_0004708 3300049574 Bacteria 12691
321 Ga0501038_0039198 3300049574 Bacteria 4145
322 Ga0501038_0053656 3300049574 Bacteria 3469
323 Ga0501038_0106315 3300049574 Bacteria 2329
324 Ga0501038_0134667 3300049574 Bacteria 2025
325 Ga0501038_0407744 3300049574 Bacteria 1050
326 Ga0501038_0422136 3300049574 Bacteria 1029
327 Ga0501039_0022050 3300049575 Bacteria 4887
328 Ga0501039_0036508 3300049575 Bacteria 3793
329 Ga0501039_0038523 3300049575 Bacteria 3691
330 Ga0501039_0070834 3300049575 Bacteria 2708
331 Ga0501039_0461545 3300049575 Bacteria 997
332 Ga0501040_0083094 3300049576 Bacteria 2221
333 Ga0501041_0048356 3300049577 Bacteria 2591
334 Ga0501042_0009837 3300049578 Bacteria 6387
335 Ga0501042_0043317 3300049578 Bacteria 3205
336 Ga0501042_0074691 3300049578 Bacteria 2426
337 Ga0501043_0001635 3300049579 Bacteria 19478
338 Ga0501043_0004175 3300049579 Bacteria 11808
339 Ga0501043_0012531 3300049579 Bacteria 6630
340 Ga0501043_0088673 3300049579 Bacteria 2431
341 Ga0501043_0143088 3300049579 Bacteria 1872
342 Ga0501043_0170196 3300049579 Bacteria 1699
343 Ga0501043_0249829 3300049579 Bacteria 1366
344 Ga0501043_0364780 3300049579 Bacteria 1096
345 Ga0501043_0391780 3300049579 Bacteria 1050
346 Ga0501043_0845204 3300049579 Bacteria 659
347 Ga0501046_0002032 3300049580 Bacteria 19220
348 Ga0501046_0003006 3300049580 Bacteria 15582
349 Ga0501046_0017863 3300049580 Bacteria 5913
350 Ga0501046_0075578 3300049580 Bacteria 2611
351 Ga0501046_0104515 3300049580 Bacteria 2171
352 Ga0501046_0139753 3300049580 Bacteria 1833
353 Ga0501046_0971084 3300049580 Bacteria 590
354 Ga0501047_0001011 3300049581 Bacteria 28409
355 Ga0501047_0020871 3300049581 Bacteria 6292
356 Ga0501047_0022449 3300049581 Bacteria 6059
357 Ga0501047_0093462 3300049581 Bacteria 2886
358 Ga0501047_0128281 3300049581 Bacteria 2416
359 Ga0501047_0244364 3300049581 Bacteria 1644
360 Ga0501047_0418506 3300049581 Bacteria 1171
361 Ga0501047_0738901 3300049581 Bacteria 800
362 Ga0501047_1199516 3300049581 Unclassified 572
363 Ga0501048_0010819 3300049582 Bacteria 6802
364 Ga0501048_0027382 3300049582 Bacteria 4142
365 Ga0501048_0028980 3300049582 Bacteria 4018
366 Ga0501048_0098575 3300049582 Bacteria 2061
367 Ga0501048_0125798 3300049582 Bacteria 1812
368 Ga0501048_0346882 3300049582 Bacteria 1059
369 Ga0501048_0550704 3300049582 Bacteria 828
370 Ga0501048_1260699 3300049582 Unclassified 531
371 Ga0501067_0013513 3300049583 Bacteria 4523
372 Ga0501067_0042437 3300049583 Bacteria 2525
373 Ga0501067_0047196 3300049583 Bacteria 2389
374 Ga0501067_0098093 3300049583 Bacteria 1628
375 Ga0501067_0406219 3300049583 Bacteria 760
376 Ga0501068_0021856 3300049584 Bacteria 3738
377 Ga0501068_0032068 3300049584 Bacteria 3123
378 Ga0501068_0042104 3300049584 Bacteria 2746
379 Ga0501068_0821954 3300049584 Unclassified 610
380 Ga0501068_1056371 3300049584 Bacteria 536
381 Ga0501069_0001096 3300049585 Bacteria 13057
382 Ga0501069_0009290 3300049585 Bacteria 5189
383 Ga0501069_0056899 3300049585 Bacteria 2179
384 Ga0501069_0161005 3300049585 Bacteria 1292
385 Ga0501070_0010415 3300049586 Bacteria 7860
386 Ga0501070_0121219 3300049586 Bacteria 2161
387 Ga0501070_0137224 3300049586 Bacteria 2019
388 Ga0501070_0341279 3300049586 Bacteria 1217
389 Ga0501070_0374709 3300049586 Bacteria 1153
390 Ga0501070_0468282 3300049586 Bacteria 1014
391 Ga0501071_0005929 3300049587 Bacteria 7904
392 Ga0501071_0018307 3300049587 Bacteria 4848
393 Ga0501072_0036977 3300049588 Bacteria 3829
394 Ga0501072_0120700 3300049588 Bacteria 2088
395 Ga0501072_0158355 3300049588 Bacteria 1806
396 Ga0501072_0163095 3300049588 Bacteria 1778
397 Ga0501072_0311515 3300049588 Bacteria 1251
398 Ga0501073_0003822 3300049589 Bacteria 11298
399 Ga0501073_0040843 3300049589 Bacteria 3280
400 Ga0501073_0069465 3300049589 Bacteria 2454
401 Ga0501073_0092339 3300049589 Bacteria 2104
402 Ga0501073_0099120 3300049589 Bacteria 2023
403 Ga0501073_0242549 3300049589 Bacteria 1244
404 Ga0501073_0300410 3300049589 Bacteria 1107
405 Ga0501073_0591588 3300049589 Bacteria 766
406 Ga0501073_0653917 3300049589 Bacteria 725
407 Ga0501074_0005094 3300049590 Bacteria 9436
408 Ga0501074_0021564 3300049590 Bacteria 4677
409 Ga0501074_0043286 3300049590 Bacteria 3258
410 Ga0501074_0054676 3300049590 Bacteria 2878
411 Ga0501074_0189866 3300049590 Bacteria 1465
412 Ga0501075_0473644 3300049591 Bacteria 955
413 Ga0501075_0542006 3300049591 Bacteria 888
414 Ga0501076_0050644 3300049592 Bacteria 3286
415 Ga0501076_0301761 3300049592 Bacteria 1313
416 Ga0501076_1527063 3300049592 Unclassified 548
417 Ga0501077_0174304 3300049593 Bacteria 1366
418 Ga0501077_1087600 3300049593 Unclassified 515
419 Ga0501202_178780 3300049652 Bacteria 571
420 Ga0501249_029744 3300049679 Bacteria 1215
421 Ga0501253_174083 3300049683 Bacteria 556
422 Ga0501245_083100 3300049708 Bacteria 622
423 Ga0501079_0016346 3300049741 Bacteria 5669
424 Ga0501079_0076625 3300049741 Bacteria 2586
425 Ga0501079_0125183 3300049741 Bacteria 1999
426 Ga0501079_0135668 3300049741 Bacteria 1916
427 Ga0501079_0319813 3300049741 Bacteria 1215
428 Ga0501079_0394338 3300049741 Bacteria 1086
429 Ga0501079_0690210 3300049741 Bacteria 803
430 Ga0501079_1499970 3300049741 Unclassified 530
431 Ga0501079_1547263 3300049741 Bacteria 522
432 Ga0501080_0008021 3300049742 Bacteria 9566
433 Ga0501080_0012802 3300049742 Bacteria 7694
434 Ga0501080_0020028 3300049742 Bacteria 6191
435 Ga0501080_0104871 3300049742 Bacteria 2621
436 Ga0501080_0111540 3300049742 Bacteria 2535
437 Ga0501080_0216508 3300049742 Bacteria 1754
438 Ga0501080_0346741 3300049742 Bacteria 1341
439 Ga0501080_0370049 3300049742 Bacteria 1292
440 Ga0501080_0593628 3300049742 Bacteria 984
441 Ga0501080_1861566 3300049742 Unclassified 504
442 Ga0501081_0025319 3300049743 Bacteria 3991
443 Ga0501081_0263766 3300049743 Bacteria 1259
444 Ga0501081_0884213 3300049743 Bacteria 673
445 Ga0501083_0007536 3300049744 Bacteria 7712
446 Ga0501083_0009671 3300049744 Bacteria 6809
447 Ga0501083_0077381 3300049744 Bacteria 2207
448 Ga0501083_0077392 3300049744 Bacteria 2207
449 Ga0501083_0173480 3300049744 Bacteria 1409
450 Ga0501083_0290155 3300049744 Bacteria 1064
451 Ga0501083_0402498 3300049744 Bacteria 890
452 Ga0501268_047091 3300049765 Bacteria 826
453 Ga0501283_004785 3300049779 Bacteria 1840
454 Ga0501035_0000420 3300049822 Bacteria 47763
455 Ga0501035_0017235 3300049822 Bacteria 6658
456 Ga0501035_0055727 3300049822 Bacteria 3528
457 Ga0501035_0160689 3300049822 Bacteria 1944
458 Ga0501035_0268680 3300049822 Bacteria 1444
459 Ga0501035_0275129 3300049822 Bacteria 1424
460 Ga0501035_0438915 3300049822 Bacteria 1081
461 Ga0501044_0007640 3300049823 Bacteria 11887
462 Ga0501044_0051283 3300049823 Bacteria 4254
463 Ga0501044_0052182 3300049823 Bacteria 4214
464 Ga0501044_0120772 3300049823 Bacteria 2621
465 Ga0501044_0218221 3300049823 Bacteria 1858
466 Ga0501044_0222154 3300049823 Bacteria 1839
467 Ga0501044_0570708 3300049823 Bacteria 1027
468 Ga0501044_0793600 3300049823 Bacteria 826
469 Ga0501045_0013967 3300049824 Bacteria 5684
470 Ga0501045_0164981 3300049824 Bacteria 1650
471 Ga0501045_0196187 3300049824 Bacteria 1504
472 Ga0501045_0561077 3300049824 Bacteria 847
473 Ga0501045_0981468 3300049824 Bacteria 620
474 Ga0501045_1241702 3300049824 Bacteria 543
475 nmdc:mga03683_201165_c1 3300050489 Bacteria 914
476 nmdc:mga00v17_33641_c1 3300050491 Bacteria 3039
477 nmdc:mga0k408_210221_c1 3300050493 Bacteria 1162
478 nmdc:mga06z11_14794_c1 3300050494 Bacteria 3465
479 nmdc:mga05p37_1105389_c1 3300050507 Bacteria 830
480 nmdc:mga05p37_123421_c1 3300050507 Bacteria 3181
481 nmdc:mga05p37_1431546_c1 3300050507 Bacteria 694
482 nmdc:mga05p37_269491_c1 3300050507 Bacteria 2035
483 nmdc:mga05p37_91220_c1 3300050507 Bacteria 3754
484 nmdc:mga05p37_99758_c1 3300050507 Bacteria 3576
485 nmdc:mga05p37_9_c1 3300050507 Bacteria 151480
486 nmdc:mga09592_140127_c1 3300050508 Bacteria 2084
487 nmdc:mga09592_1709762_c1 3300050508 Bacteria 507
488 nmdc:mga09592_53746_c2 3300050508 Bacteria 2046
489 nmdc:mga09592_75133_c1 3300050508 Bacteria 2872
490 nmdc:mga0qj67_591003_c1 3300050509 Bacteria 888
491 nmdc:mga0qj67_911361_c1 3300050509 Bacteria 692
492 nmdc:mga06r32_1127413_c1 3300050510 Bacteria 733
493 nmdc:mga06r32_63309_c1 3300050510 Bacteria 3565
494 nmdc:mga08y16_1215943_c1 3300050511 Unclassified 724
495 nmdc:mga08y16_270163_c1 3300050511 Bacteria 1755
496 nmdc:mga08y16_3176_c1 3300050511 Bacteria 17014
497 nmdc:mga08y16_402463_c1 3300050511 Bacteria 1401
498 nmdc:mga08y16_447773_c1 3300050511 Bacteria 1317
499 nmdc:mga08y16_5837_c1 3300050511 Bacteria 12901
500 nmdc:mga08y16_743107_c1 3300050511 Bacteria 978
501 nmdc:mga08y16_87575_c1 3300050511 Bacteria 3245
502 nmdc:mga0n895_1156_c1 3300050512 Bacteria 19326
503 nmdc:mga0n895_162397_c1 3300050512 Bacteria 2266
504 nmdc:mga0n895_289127_c1 3300050512 Bacteria 1662
505 nmdc:mga0rr50_1321229_c1 3300050513 Bacteria 611
506 nmdc:mga0rr50_977909_c1 3300050513 Bacteria 721
507 nmdc:mga0a205_102127_c1 3300050515 Bacteria 2766
508 nmdc:mga0a205_14864_c1 3300050515 Bacteria 7265
509 nmdc:mga0a205_159614_c1 3300050515 Bacteria 2152
510 nmdc:mga0a205_667_c1 3300050515 Bacteria 27369
511 nmdc:mga0a205_867135_c1 3300050515 Bacteria 750
512 Ga0495595_0234599 3300053084 Bacteria 917
513 Ga0500568_0332904 3300053139 Bacteria 550
514 Ga0501084_0008818 3300054114 Bacteria 8346
515 Ga0501084_0010058 3300054114 Bacteria 7817
516 Ga0501084_0201025 3300054114 Bacteria 1681
517 Ga0501084_0403654 3300054114 Bacteria 1155
518 Ga0501084_1133551 3300054114 Bacteria 656
519 Ga0501084_1135334 3300054114 Bacteria 656
520 Ga0501084_1555372 3300054114 Bacteria 553
521 Ga0501084_1645065 3300054114 Bacteria 537
522 Ga0501082_0009805 3300060353 Bacteria 8253
523 Ga0501082_0011276 3300060353 Bacteria 7683
524 Ga0501082_0034171 3300060353 Bacteria 4386
525 Ga0501082_0049965 3300060353 Bacteria 3606
526 Ga0501082_0101369 3300060353 Bacteria 2490
527 Ga0501082_0382275 3300060353 Bacteria 1228
528 Ga0501082_1074844 3300060353 Bacteria 703
529 Ga0530510_0134487 3300061734 Bacteria 1820
530 Ga0530510_0169439 3300061734 Bacteria 1617
531 Ga0530510_1023054 3300061734 Bacteria 632
532 Ga0207650_10619418
533 Ga0065712_10808873
534 Ga0065715_10106689
535 Ga0065715_10267860
536 Ga0065715_11168942
537 Ga0065707_10083636
538 Ga0065707_10109531
539 Ga0065707_10163268
540 Ga0065707_11157760
541 Ga0070676_11310947
542 Ga0070690_100318403
543 Ga0070690_100529211
544 Ga0070670_101023305
545 Ga0070670_101142356
546 Ga0068869_100257149
547 Ga0070680_100708704
548 Ga0070682_101175145
549 Ga0070689_100037943
550 Ga0070689_100697703
551 Ga0070689_101089459
552 Ga0070689_101468001
553 Ga0070689_101496912
554 Ga0070689_101650003
555 Ga0070689_101676606
556 Ga0070669_100184106
557 Ga0070669_100384864
558 Ga0070669_101449931
559 Ga0070675_100422002
560 Ga0070675_100842506
561 Ga0070675_101107739
562 Ga0070671_100312394
563 Ga0070674_101875382
564 Ga0070673_100871413
565 Ga0070688_100217884
566 Ga0070688_100512439
567 Ga0070688_100852301
568 Ga0070688_100989304
569 Ga0070667_100348081
570 Ga0070701_10037013
571 Ga0070705_100819314
572 Ga0070705_101042459
573 Ga0070708_100097623
574 Ga0070678_101410313
575 Ga0070678_101625103
576 Ga0070681_11497808
577 Ga0068867_101702937
578 Ga0070685_10096454
579 Ga0070706_101216908
580 Ga0070698_101572867
581 Ga0070699_100412645
582 Ga0070699_101983500
583 Ga0068853_100618837
584 Ga0070686_100199084
585 Ga0070686_100891781
586 Ga0070665_102507647
587 Ga0070704_100225226
588 Ga0070704_101863467
589 Ga0068857_101115910
590 Ga0068857_102427121
591 Ga0068856_101851094
592 Ga0070702_100367384
593 Ga0068859_100190252
594 Ga0068859_100199272
595 Ga0068859_100833050
596 Ga0068859_101012400
597 Ga0068859_101197393
598 Ga0068864_100453038
599 Ga0068864_101030562
600 Ga0068866_10441118
601 Ga0068861_100547804
602 Ga0068861_100940794
603 Ga0068861_101242508
604 Ga0068863_100309525
605 Ga0068863_100877485
606 Ga0068858_100991530
607 Ga0068858_102323527
608 Ga0068860_100485960
609 Ga0068860_100880854
610 Ga0068862_100312778
611 Ga0068862_100566288
612 Ga0068862_101386047
613 Ga0068862_101787073
614 Ga0068862_102723052
615 Ga0081538_10146106
616 Ga0081539_10427651
617 Ga0075364_10007620
618 Ga0075432_10513042
619 Ga0075367_10004665
620 Ga0075427_10040108
621 Ga0075366_10638435
622 Ga0075366_11021360
623 Ga0097621_100334166
624 Ga0097621_100669965
625 Ga0097621_101745846
626 Ga0097621_101823912
627 Ga0068871_100821624
628 Ga0075428_100041348
629 Ga0075428_100125007
630 Ga0075428_100534550
631 Ga0075428_101065284
632 Ga0075430_100026786
633 Ga0075430_100073381
634 Ga0075431_100018273
635 Ga0075431_100637873
636 Ga0075433_10002179
637 Ga0075433_10069844
638 Ga0075433_10198755
639 Ga0075433_10366913
640 Ga0075434_100001038
641 Ga0075434_100157165
642 Ga0075434_100409508
643 Ga0075434_100549330
644 Ga0075429_100021547
645 Ga0075429_100064622
646 Ga0075429_100796343
647 Ga0075429_101431362
648 Ga0075429_101667592
649 Ga0068865_100084711
650 Ga0068865_101155002
651 Ga0097620_100190257
652 Ga0097620_100199277
653 Ga0097620_100832986
654 Ga0097620_101012421
655 Ga0097620_101197342
656 Ga0075435_100338659
657 Ga0075435_101367573
658 Ga0075435_101636458
659 Ga0105251_10200909
660 Ga0111539_10000384
661 Ga0111539_10001278
662 Ga0111539_10071256
663 Ga0111539_10144135
664 Ga0111539_10156642
665 Ga0111539_10295199
666 Ga0111539_10313555
667 Ga0111539_10948908
668 Ga0111539_10986932
669 Ga0105245_11314292
670 Ga0105245_12663642
671 Ga0114129_10000306
672 Ga0114129_10025154
673 Ga0114129_10109706
674 Ga0114129_10122972
675 Ga0114129_10269389
676 Ga0114129_10732860
677 Ga0105243_10337754
678 Ga0105243_10504649
679 Ga0105243_10911907
680 Ga0105243_12542976
681 Ga0105242_10472503
682 Ga0105242_10703222
683 Ga0105242_10821533
684 Ga0105242_11465120
685 Ga0105248_10042818
686 Ga0105248_10216722
687 Ga0105248_10365435
688 Ga0105248_11811750
689 Ga0105248_12716377
690 Ga0105249_10134786
691 Ga0105249_10414872
692 Ga0105249_11455338
693 Ga0105249_12186302
694 Ga0105249_12939847
695 Ga0157370_11332104
696 Ga0163162_10055263
697 Ga0163162_10294832
698 Ga0163162_11708679
699 Ga0163162_12321975
700 Ga0157375_10870462
701 Ga0157375_12137559
702 Ga0163163_10000017
703 Ga0163163_10852133
704 Ga0163163_11062824
705 Ga0163163_11968065
706 Ga0157380_10130140
707 Ga0157380_10351344
708 Ga0157380_10488989
709 Ga0157380_10511718
710 Ga0157380_10519037
711 Ga0157380_11491188
712 Ga0157379_11445473
713 Ga0157376_10049860
714 Ga0157376_10567866
715 Ga0157376_13085086
716 Ga0163161_12021661
717 Ga0207680_10876891
718 Ga0207684_10258708
719 Ga0207681_10188726
720 Ga0207681_11354593
721 Ga0207650_10502142
722 Ga0207659_10117488
723 Ga0207644_10336533
724 Ga0207706_10514599
725 Ga0207686_10304519
726 Ga0207686_10354145
727 Ga0207709_10487137
728 Ga0207709_10629785
729 Ga0207670_10020669
730 Ga0207670_10189447
731 Ga0207670_10546293
732 Ga0207670_10869847
733 Ga0207670_11146591
734 Ga0207670_11162349
735 Ga0207704_10068835
736 Ga0207704_11819241
737 Ga0207711_10014776
738 Ga0207711_11436475
739 Ga0207711_11875775
740 Ga0207689_10795525
741 Ga0207651_10463747
742 Ga0207651_10816018
743 Ga0207712_10480470
744 Ga0207712_10511138
745 Ga0207712_10904041
746 Ga0207712_10918479
747 Ga0207668_10596691
748 Ga0207658_10782611
749 Ga0207703_10950861
750 Ga0207703_12056551
751 Ga0207708_10697958
752 Ga0207641_11165008
753 Ga0207641_11225393
754 Ga0207648_10342679
755 Ga0207648_10590384
756 Ga0207648_12053149
757 Ga0207676_10992021
758 Ga0207676_12511330
759 Ga0207674_11436502
760 Ga0207675_100247892
761 Ga0207675_100617429
762 Ga0207675_101037627
763 Ga0207675_101057951
764 Ga0207675_101196463
765 Ga0210002_1088986
766 Ga0209813_10045578
767 Ga0207428_10001175
768 Ga0207428_10006010
769 Ga0207428_10269018
770 Ga0207428_10317203
771 Ga0207428_10851080
772 Ga0268265_11927700
773 Ga0268265_12020221
774 Ga0268265_12068854
775 Ga0268264_10666703
776 Ga0268264_11564709
777 Ga0268264_12313794
778 Ga0265338_11204044
779 Ga0307408_102155049
780 Ga0307413_11837921
781 Ga0307410_10091206
782 Ga0307406_11624935
783 Ga0307415_100058427
784 Ga0373934_0024333
785 Ga0373923_0534498
786 Ga0373956_0009647
787 Ga0373957_0029155
788 Ga0373955_0182003
789 Ga0373961_0235910
790 Ga0373933_0024927
791 Ga0373947_0648531
792 Ga0373937_0000653
793 Ga0451807_0758639
794 Ga0451853_2832330
795 Ga0451576_0005669
796 Ga0495592_0165331
797 Ga0495592_0268610
798 Ga0495592_0394390
799 Ga0495603_0443255
800 Ga0495651_0494388
801 Ga0495639_0122884
802 Ga0495628_0503216
803 Ga0495628_0641631
804 Ga0495633_0375303
805 Ga0495599_0133031
806 Ga0495599_0353943
807 Ga0495658_0933333
808 Ga0495600_0187077
809 Ga0495672_0158010
810 Ga0495684_0332116
811 Ga0495684_0611970
812 Ga0496104_0556865
813 Ga0496105_0123141
814 Ga0496109_1483207
815 Ga0496114_1057459
816 Ga0501299_021939
817 Ga0501031_0003040
818 Ga0501031_0026492
819 Ga0501031_0375858
820 Ga0501031_0453832
821 Ga0501032_0007443
822 Ga0501032_0009867
823 Ga0501032_0032625
824 Ga0501032_0040811
825 Ga0501032_0388999
826 Ga0501033_0015678
827 Ga0501033_0026613
828 Ga0501033_0034726
829 Ga0501033_0107457
830 Ga0501034_0014104
831 Ga0501034_0080994
832 Ga0501034_0092589
833 Ga0501034_0138792
834 Ga0501034_0176920
835 Ga0501034_0270418
836 Ga0501034_0365507
837 Ga0501036_0004857
838 Ga0501036_0006161
839 Ga0501036_0006855
840 Ga0501036_0026801
841 Ga0501036_0069432
842 Ga0501036_0172961
843 Ga0501036_0497440
844 Ga0501036_1026880
845 Ga0501037_0004384
846 Ga0501037_0022109
847 Ga0501037_0059178
848 Ga0501037_0380159
849 Ga0501037_0381615
850 Ga0501037_1004063
851 Ga0501038_0004708
852 Ga0501038_0039198
853 Ga0501038_0053656
854 Ga0501038_0106315
855 Ga0501038_0134667
856 Ga0501038_0407744
857 Ga0501038_0422136
858 Ga0501039_0022050
859 Ga0501039_0036508
860 Ga0501039_0038523
861 Ga0501039_0070834
862 Ga0501039_0461545
863 Ga0501040_0083094
864 Ga0501041_0048356
865 Ga0501042_0009837
866 Ga0501042_0043317
867 Ga0501042_0074691
868 Ga0501043_0001635
869 Ga0501043_0004175
870 Ga0501043_0012531
871 Ga0501043_0088673
872 Ga0501043_0143088
873 Ga0501043_0170196
874 Ga0501043_0249829
875 Ga0501043_0364780
876 Ga0501043_0391780
877 Ga0501043_0845204
878 Ga0501046_0002032
879 Ga0501046_0003006
880 Ga0501046_0017863
881 Ga0501046_0075578
882 Ga0501046_0104515
883 Ga0501046_0139753
884 Ga0501046_0971084
885 Ga0501047_0001011
886 Ga0501047_0020871
887 Ga0501047_0022449
888 Ga0501047_0093462
889 Ga0501047_0128281
890 Ga0501047_0244364
891 Ga0501047_0418506
892 Ga0501047_0738901
893 Ga0501047_1199516
894 Ga0501048_0010819
895 Ga0501048_0027382
896 Ga0501048_0028980
897 Ga0501048_0098575
898 Ga0501048_0125798
899 Ga0501048_0346882
900 Ga0501048_0550704
901 Ga0501048_1260699
902 Ga0501067_0013513
903 Ga0501067_0042437
904 Ga0501067_0047196
905 Ga0501067_0098093
906 Ga0501067_0406219
907 Ga0501068_0021856
908 Ga0501068_0032068
909 Ga0501068_0042104
910 Ga0501068_0821954
911 Ga0501068_1056371
912 Ga0501069_0001096
913 Ga0501069_0009290
914 Ga0501069_0056899
915 Ga0501069_0161005
916 Ga0501070_0010415
917 Ga0501070_0121219
918 Ga0501070_0137224
919 Ga0501070_0341279
920 Ga0501070_0374709
921 Ga0501070_0468282
922 Ga0501071_0005929
923 Ga0501071_0018307
924 Ga0501072_0036977
925 Ga0501072_0120700
926 Ga0501072_0158355
927 Ga0501072_0163095
928 Ga0501072_0311515
929 Ga0501073_0003822
930 Ga0501073_0040843
931 Ga0501073_0069465
932 Ga0501073_0092339
933 Ga0501073_0099120
934 Ga0501073_0242549
935 Ga0501073_0300410
936 Ga0501073_0591588
937 Ga0501073_0653917
938 Ga0501074_0005094
939 Ga0501074_0021564
940 Ga0501074_0043286
941 Ga0501074_0054676
942 Ga0501074_0189866
943 Ga0501075_0473644
944 Ga0501075_0542006
945 Ga0501076_0050644
946 Ga0501076_0301761
947 Ga0501076_1527063
948 Ga0501077_0174304
949 Ga0501077_1087600
950 Ga0501202_178780
951 Ga0501249_029744
952 Ga0501253_174083
953 Ga0501245_083100
954 Ga0501079_0016346
955 Ga0501079_0076625
956 Ga0501079_0125183
957 Ga0501079_0135668
958 Ga0501079_0319813
959 Ga0501079_0394338
960 Ga0501079_0690210
961 Ga0501079_1499970
962 Ga0501079_1547263
963 Ga0501080_0008021
964 Ga0501080_0012802
965 Ga0501080_0020028
966 Ga0501080_0104871
967 Ga0501080_0111540
968 Ga0501080_0216508
969 Ga0501080_0346741
970 Ga0501080_0370049
971 Ga0501080_0593628
972 Ga0501080_1861566
973 Ga0501081_0025319
974 Ga0501081_0263766
975 Ga0501081_0884213
976 Ga0501083_0007536
977 Ga0501083_0009671
978 Ga0501083_0077381
979 Ga0501083_0077392
980 Ga0501083_0173480
981 Ga0501083_0290155
982 Ga0501083_0402498
983 Ga0501268_047091
984 Ga0501283_004785
985 Ga0501035_0000420
986 Ga0501035_0017235
987 Ga0501035_0055727
988 Ga0501035_0160689
989 Ga0501035_0268680
990 Ga0501035_0275129
991 Ga0501035_0438915
992 Ga0501044_0007640
993 Ga0501044_0051283
994 Ga0501044_0052182
995 Ga0501044_0120772
996 Ga0501044_0218221
997 Ga0501044_0222154
998 Ga0501044_0570708
999 Ga0501044_0793600
1000 Ga0501045_0013967
1001 Ga0501045_0164981
1002 Ga0501045_0196187
1003 Ga0501045_0561077
1004 Ga0501045_0981468
1005 Ga0501045_1241702
1006 nmdc:mga03683_201165_c1
1007 nmdc:mga00v17_33641_c1
1008 nmdc:mga0k408_210221_c1
1009 nmdc:mga06z11_14794_c1
1010 nmdc:mga05p37_1105389_c1
1011 nmdc:mga05p37_123421_c1
1012 nmdc:mga05p37_1431546_c1
1013 nmdc:mga05p37_269491_c1
1014 nmdc:mga05p37_91220_c1
1015 nmdc:mga05p37_99758_c1
1016 nmdc:mga05p37_9_c1
1017 nmdc:mga09592_140127_c1
1018 nmdc:mga09592_1709762_c1
1019 nmdc:mga09592_53746_c2
1020 nmdc:mga09592_75133_c1
1021 nmdc:mga0qj67_591003_c1
1022 nmdc:mga0qj67_911361_c1
1023 nmdc:mga06r32_1127413_c1
1024 nmdc:mga06r32_63309_c1
1025 nmdc:mga08y16_1215943_c1
1026 nmdc:mga08y16_270163_c1
1027 nmdc:mga08y16_3176_c1
1028 nmdc:mga08y16_402463_c1
1029 nmdc:mga08y16_447773_c1
1030 nmdc:mga08y16_5837_c1
1031 nmdc:mga08y16_743107_c1
1032 nmdc:mga08y16_87575_c1
1033 nmdc:mga0n895_1156_c1
1034 nmdc:mga0n895_162397_c1
1035 nmdc:mga0n895_289127_c1
1036 nmdc:mga0rr50_1321229_c1
1037 nmdc:mga0rr50_977909_c1
1038 nmdc:mga0a205_102127_c1
1039 nmdc:mga0a205_14864_c1
1040 nmdc:mga0a205_159614_c1
1041 nmdc:mga0a205_667_c1
1042 nmdc:mga0a205_867135_c1
1043 Ga0495595_0234599
1044 Ga0500568_0332904
1045 Ga0501084_0008818
1046 Ga0501084_0010058
1047 Ga0501084_0201025
1048 Ga0501084_0403654
1049 Ga0501084_1133551
1050 Ga0501084_1135334
1051 Ga0501084_1555372
1052 Ga0501084_1645065
1053 Ga0501082_0009805
1054 Ga0501082_0011276
1055 Ga0501082_0034171
1056 Ga0501082_0049965
1057 Ga0501082_0101369
1058 Ga0501082_0382275
1059 Ga0501082_1074844
1060 Ga0530510_0134487
1061 Ga0530510_0169439
1062 Ga0530510_1023054

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02954

HTH_8

Bacterial regulatory protein, Fis family

37

78

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rqi-assembly1.cif.gz_A-2 crystal structure of a response regulator protein from burkholderia pseudomallei with a phosphorylated aspartic acid, calcium ion and citrate 0.9696 27 59
2esn-assembly1.cif.gz_C the crystal structure of probable transcriptional regulator pa0477 from pseudomonas aeruginosa 0.9659 31 62
4fth-assembly1.cif.gz_B crystal structure of ntrc4 dna-binding domain bound to double-stranded dna 0.9637 19 69
3e7l-assembly2.cif.gz_D crystal structure of sigma54 activator ntrc4's dna binding domain 0.9627 19 67
2m8g-assembly1.cif.gz_X structure, function, and tethering of dna-binding domains in 54 transcriptional activators 0.9624 19 67
ID Description Score Start End Superfamily
af_Q58520_10_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9809 31 63 1.10.10.10
3rqiA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9696 27 59 1.10.10.60
3e7lC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9687 19 67 1.10.10.60
4fthB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9637 19 69 1.10.10.60
3e7lD00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9627 19 67 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7Y5F770-F1-model_v4 Sigma-54-dependent Fis family transcriptional regulator 1.006 19 67 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A3N6AQW5-F1-model_v4 deleted 1.003 21 67
AF-A0A379SU29-F1-model_v4 Regulatory protein 1 19 67 GO:0005524
GO:0006355
GO:0043565
AF-A0A538T2A5-F1-model_v4 Tetratricopeptide repeat protein 0.9986 19 67 GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A381RHU1-F1-model_v4 DNA binding HTH domain-containing protein 0.9981 3 68 GO:0043565

Map