F460124

General Info

Members Datasets Scaffolds Average Seq Length
531 271 506 406

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10001542|Ga0105239_100015425
Length 457
Sequence MYILRVVISFNIEHSIFRLALLMKYGIHIIDLCLDSLNLRSMNNIKGNKNFYLILILGMLSAIGPFSIDMYLPAFPDIAKGLHTTVSQVMLSLSSFFIGISAGQLLYGPLLERFGRKKPLYVGLVIYLLASVGCAMAASVNALIWLRALQALGGCVGMVAARAMVRDLFEVKENAKIFSLLMLVVAVSPIIAPTAGGYVTAMLGWRYVFVMLIGINLIILAGIYFWLPESKKPDPNFSLKPAPIIKNFTGVIRHPQFYTYALTAAISAAGLYAYIGGSPYVFMEIFHVSEKQYGWIFALIAMGLIGSSQINSVLLKNYSSEQIIKVALACQSITGALLLCLTFLGWSELFSTIFLIFIFLCCQGFTFPNASALSLASFGHNAGSASALLGAIQMSIGACTSALVSILQNHTAIPMAAVMACCAIGAFSVFMLGRRIITTKCSVEAVEEEDVEMVSTL

Samples

Sample ID Description Type Environment
1 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2738541283 Pedobacter sp. OK701 Isolate Unclassified
4 2738541284 Pedobacter sp. YR016 Isolate Unclassified
5 2738541302 Pedobacter sp. CF074 Isolate Unclassified
6 2739367651 Pedobacter sp. OK291 Isolate Unclassified
7 2739367663 Pedobacter sp. YR510 Isolate Unclassified
8 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
9 2818991437 Pedobacter terrae 518 Isolate Unclassified
10 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
11 2818991444 Filimonas endophytica 3197 Isolate Unclassified
12 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
13 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
14 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
15 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
16 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
17 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
18 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
19 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
20 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
21 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
22 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
23 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
24 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
25 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
26 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
27 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
28 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
29 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
30 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
31 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
32 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
33 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
34 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
35 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
36 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
39 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
40 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
128 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
129 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
131 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
134 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
182 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
183 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
184 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
185 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
186 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
187 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
188 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
189 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
204 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
205 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
206 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
207 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
208 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
211 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
214 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
232 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
244 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
245 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
255 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
256 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
257 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
258 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
259 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
260 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
261 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
262 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
263 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
264 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
265 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
266 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
267 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
268 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
269 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
270 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
271 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.1
Metatranscriptomes 0
Isolates 4.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.91
Nodule 0
Rhizoplane 0
Rhizosphere 84.75
Stem 0
Stem Tuber 0
Unclassified 7.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000655 3300001979 Bacteria 14950
2 JGI25152J39213_1000056 3300002773 Bacteria 75516
3 JGI25150J39212_1000009 3300002774 Bacteria 249509
4 JGI25151J46595_10000017 3300003187 Bacteria 249509
5 JGI25153J46596_10000023 3300003215 Bacteria 249509
6 rootH1_10064257 3300003316 Bacteria 2727
7 rootH2_10195988 3300003320 Bacteria 5123
8 rootL2_10180183 3300003322 Bacteria 2563
9 rootL2_10199986 3300003322 Bacteria 2403
10 rootH1_10006645 3300003323 Bacteria 138273
11 rootH1_10017466 3300003316 Bacteria 4117
12 rootH1_10017466 3300003323 Bacteria 21776
13 rootH1_10130006 3300003323 Unclassified 1479
14 rootH1_10160870 3300003323 Plasmid 4582
15 rootH1_10278832 3300003323 Bacteria 3072
16 JGI25160J50197_1001427 3300003354 Bacteria 11953
17 Ga0055536_1000030 3300003781 Bacteria 153926
18 Ga0055530_10002863 3300003791 Bacteria 10516
19 Ga0065714_10008213 3300005288 Bacteria 6299
20 Ga0065704_10070224 3300005289 Bacteria 60921
21 Ga0065704_10076325 3300005289 Bacteria 5111
22 Ga0065712_10068639 3300005290 Bacteria 9569
23 Ga0070658_10012409 3300005327 Bacteria 6836
24 Ga0070658_10041235 3300005327 Bacteria 3724
25 Ga0070658_10058052 3300005327 Bacteria 3149
26 Ga0070683_100001717 3300005329 Bacteria 17039
27 Ga0070683_100024807 3300005329 Bacteria 5376
28 Ga0070683_100033448 3300005329 Bacteria 4688
29 Ga0070683_100040919 3300005329 Bacteria 4262
30 Ga0070670_100017458 3300005331 Bacteria 6156
31 Ga0070670_100043836 3300005331 Bacteria 3846
32 Ga0070677_10010795 3300005333 Bacteria 3134
33 Ga0068869_100011744 3300005334 Bacteria 5758
34 Ga0068869_100013910 3300005334 Bacteria 5366
35 Ga0070666_10000047 3300005335 Bacteria 106512
36 Ga0070666_10051554 3300005335 Bacteria 2771
37 Ga0070682_100006906 3300005337 Bacteria 6384
38 Ga0070682_100022879 3300005337 Bacteria 3707
39 Ga0068868_100016722 3300005338 Bacteria 5455
40 Ga0068868_100022472 3300005338 Bacteria 4760
41 Ga0068868_100080011 3300005338 Bacteria 2618
42 Ga0068868_100087435 3300005338 Unclassified 2506
43 Ga0070660_100053263 3300005339 Bacteria 3120
44 Ga0070689_100009137 3300005340 Bacteria 7018
45 Ga0070689_100070072 3300005340 Bacteria 2736
46 Ga0070689_100096827 3300005340 Bacteria 2333
47 Ga0070661_100002697 3300005344 Bacteria 12158
48 Ga0070661_100042394 3300005344 Bacteria 3321
49 Ga0070661_100103892 3300005344 Bacteria 2116
50 Ga0070668_100088440 3300005347 Bacteria 2439
51 Ga0070669_100065633 3300005353 Unclassified 2674
52 Ga0070669_100071498 3300005353 Bacteria 2567
53 Ga0070675_100012235 3300005354 Bacteria 6725
54 Ga0070675_100021648 3300005354 Bacteria 5137
55 Ga0070671_100092983 3300005355 Bacteria 2527
56 Ga0070671_100216704 3300005355 Bacteria 1624
57 Ga0070674_100005589 3300005356 Bacteria 7276
58 Ga0070674_100039861 3300005356 Unclassified 3175
59 Ga0070674_100241171 3300005356 Unclassified 1415
60 Ga0070673_100006132 3300005364 Bacteria 7792
61 Ga0070673_100008358 3300005364 Bacteria 6879
62 Ga0070673_100019980 3300005364 Bacteria 4821
63 Ga0070673_100035867 3300005364 Bacteria 3765
64 Ga0070673_100054757 3300005364 Bacteria 3140
65 Ga0070688_100045510 3300005365 Bacteria 2712
66 Ga0070688_100119125 3300005365 Bacteria 1765
67 Ga0070659_100018925 3300005366 Bacteria 5204
68 Ga0070659_100109851 3300005366 Bacteria 2226
69 Ga0070667_100006277 3300005367 Bacteria 9880
70 Ga0070667_100090081 3300005367 Unclassified 2636
71 Ga0070667_100094369 3300005367 Bacteria 2578
72 Ga0070667_100298045 3300005367 Unclassified 1451
73 Ga0070663_100126022 3300005455 Bacteria 1940
74 Ga0070678_100108817 3300005456 Bacteria 2164
75 Ga0070662_100003980 3300005457 Bacteria 9261
76 Ga0070662_100009098 3300005457 Bacteria 6482
77 Ga0070662_100016814 3300005457 Bacteria 4918
78 Ga0070662_100035904 3300005457 Bacteria 3503
79 Ga0070681_10239951 3300005458 Bacteria 1726
80 Ga0070698_100002515 3300005471 Bacteria 20194
81 Ga0070698_100031496 3300005471 Bacteria 5499
82 Ga0070679_100007239 3300005530 Bacteria 10356
83 Ga0070684_100000866 3300005535 Bacteria 21424
84 Ga0070684_100023837 3300005535 Bacteria 5126
85 Ga0070684_100110113 3300005535 Bacteria 2469
86 Ga0068853_100021672 3300005539 Bacteria 5360
87 Ga0068853_100200885 3300005539 Bacteria 1814
88 Ga0068853_100236425 3300005539 Bacteria 1673
89 Ga0070672_100036064 3300005543 Bacteria 3764
90 Ga0070672_100049454 3300005543 Bacteria 3271
91 Ga0070686_100041752 3300005544 Bacteria 2869
92 Ga0070693_100007527 3300005547 Bacteria 5326
93 Ga0070665_100033188 3300005548 Bacteria 5194
94 Ga0068855_100055515 3300005563 Bacteria 4652
95 Ga0068855_100068930 3300005563 Bacteria 4117
96 Ga0068855_100122031 3300005563 Unclassified 2982
97 Ga0070664_100001013 3300005564 Bacteria 22070
98 Ga0070664_100049624 3300005564 Bacteria 3550
99 Ga0070664_100123732 3300005564 Bacteria 2267
100 Ga0070664_100139713 3300005564 Bacteria 2132
101 Ga0068857_100001556 3300005577 Bacteria 18387
102 Ga0068857_100153919 3300005577 Bacteria 2084
103 Ga0068854_100060579 3300005578 Bacteria 2739
104 Ga0068856_100004666 3300005614 Bacteria 13611
105 Ga0068856_100136121 3300005614 Bacteria 2462
106 Ga0068856_100179103 3300005614 Bacteria 2132
107 Ga0068856_100238319 3300005614 Bacteria 1835
108 Ga0068856_100270737 3300005614 Bacteria 1714
109 Ga0070702_100023985 3300005615 Bacteria 3249
110 Ga0068852_100005821 3300005616 Bacteria 8851
111 Ga0068852_100036525 3300005616 Bacteria 4112
112 Ga0068852_100176176 3300005616 Bacteria 2008
113 Ga0068852_100245043 3300005616 Bacteria 1715
114 Ga0068852_100254484 3300005616 Unclassified 1684
115 Ga0068859_100000030 3300005617 Bacteria 175435
116 Ga0068859_100025916 3300005617 Bacteria 5882
117 Ga0068859_100098462 3300005617 Bacteria 2978
118 Ga0068859_100119396 3300005617 Bacteria 2703
119 Ga0068859_100164564 3300005617 Unclassified 2298
120 Ga0068864_100034638 3300005618 Bacteria 4296
121 Ga0068864_100039135 3300005618 Bacteria 4052
122 Ga0068864_100071444 3300005618 Unclassified 3022
123 Ga0068866_10081619 3300005718 Unclassified 1737
124 Ga0068851_10108829 3300005834 Bacteria 1478
125 Ga0068870_10041453 3300005840 Bacteria 2392
126 Ga0068863_100006635 3300005841 Bacteria 11356
127 Ga0068863_100012696 3300005841 Bacteria 8124
128 Ga0068863_100042433 3300005841 Unclassified 4322
129 Ga0068863_100201156 3300005841 Bacteria 1916
130 Ga0068858_100001160 3300005842 Bacteria 27302
131 Ga0068858_100007207 3300005842 Bacteria 10780
132 Ga0068858_100049209 3300005842 Bacteria 3904
133 Ga0068860_100000006 3300005843 Bacteria 461966
134 Ga0068860_100012408 3300005843 Bacteria 8396
135 Ga0068860_100253374 3300005843 Bacteria 1715
136 Ga0075368_10009863 3300006042 Bacteria 3443
137 Ga0075364_10023170 3300006051 Bacteria 3929
138 Ga0075367_10080909 3300006178 Bacteria 1965
139 Ga0075366_10000042 3300006195 Bacteria 45313
140 Ga0075366_10015672 3300006195 Bacteria 4350
141 Ga0097621_100000595 3300006237 Bacteria 25494
142 Ga0097621_100018963 3300006237 Bacteria 5272
143 Ga0097621_100044967 3300006237 Bacteria 3565
144 Ga0097621_100244816 3300006237 Bacteria 1569
145 Ga0097621_100253772 3300006237 Bacteria 1541
146 Ga0075370_10015632 3300006353 Bacteria 4068
147 Ga0068871_100000741 3300006358 Bacteria 22178
148 Ga0068871_100005849 3300006358 Bacteria 8648
149 Ga0068871_100056149 3300006358 Bacteria 3200
150 Ga0075428_100114859 3300006844 Bacteria 2933
151 Ga0097620_100000030 3300006931 Bacteria 175435
152 Ga0097620_100025917 3300006931 Bacteria 5882
153 Ga0097620_100098464 3300006931 Bacteria 2978
154 Ga0097620_100119393 3300006931 Bacteria 2703
155 Ga0097620_100164574 3300006931 Unclassified 2298
156 Ga0105240_10003631 3300009093 Bacteria 23897
157 Ga0105240_10096816 3300009093 Bacteria 3596
158 Ga0105240_10158061 3300009093 Bacteria 2694
159 Ga0105240_10210849 3300009093 Bacteria 2270
160 Ga0105240_10341074 3300009093 Bacteria 1702
161 Ga0111539_10113724 3300009094 Bacteria 3174
162 Ga0111539_10139595 3300009094 Bacteria 2837
163 Ga0105245_10246982 3300009098 Bacteria 1732
164 Ga0105247_10010929 3300009101 Bacteria 5482
165 Ga0105247_10144844 3300009101 Bacteria 1560
166 Ga0114129_10001620 3300009147 Bacteria 30509
167 Ga0105241_10000369 3300009174 Bacteria 34233
168 Ga0105241_10015322 3300009174 Bacteria 5615
169 Ga0105241_10029228 3300009174 Bacteria 4110
170 Ga0105241_10063911 3300009174 Bacteria 2841
171 Ga0105241_10130775 3300009174 Bacteria 2032
172 Ga0105242_10003733 3300009176 Bacteria 11831
173 Ga0105242_10114947 3300009176 Bacteria 2300
174 Ga0105248_10032001 3300009177 Bacteria 5877
175 Ga0105237_10000088 3300009545 Bacteria 124518
176 Ga0105237_10000759 3300009545 Bacteria 44278
177 Ga0105237_10002825 3300009545 Bacteria 21123
178 Ga0105238_10090995 3300009551 Bacteria 3039
179 Ga0105238_10167061 3300009551 Bacteria 2176
180 Ga0105238_10241445 3300009551 Bacteria 1784
181 Ga0105249_10002189 3300009553 Bacteria 16912
182 Ga0105249_10006552 3300009553 Bacteria 10131
183 Ga0105249_10011907 3300009553 Bacteria 7650
184 Ga0105239_10001542 3300010375 Bacteria 30444
185 Ga0105239_10009182 3300010375 Bacteria 11181
186 Ga0105239_10025263 3300010375 Bacteria 6541
187 Ga0105239_10029938 3300010375 Bacteria 5987
188 Ga0105239_10049428 3300010375 Bacteria 4611
189 Ga0105239_10099428 3300010375 Unclassified 3216
190 Ga0105239_10235504 3300010375 Bacteria 2055
191 Ga0105239_10303232 3300010375 Bacteria 1799
192 Ga0157373_10000284 3300013100 Bacteria 40521
193 Ga0157371_10000034 3300013102 Bacteria 223947
194 Ga0157371_10001139 3300013102 Bacteria 28616
195 Ga0157371_10001338 3300013102 Bacteria 25928
196 Ga0157371_10004243 3300013102 Bacteria 12601
197 Ga0157371_10004807 3300013102 Bacteria 11623
198 Ga0157371_10017622 3300013102 Bacteria 5299
199 Ga0157371_10030206 3300013102 Bacteria 3911
200 Ga0157370_10000621 3300013104 Bacteria 44144
201 Ga0157370_10003065 3300013104 Bacteria 19819
202 Ga0157370_10004615 3300013104 Bacteria 15750
203 Ga0157370_10005022 3300013104 Bacteria 14947
204 Ga0157370_10006549 3300013104 Bacteria 12825
205 Ga0157370_10019261 3300013104 Bacteria 6853
206 Ga0157370_10041380 3300013104 Bacteria 4446
207 Ga0157370_10044315 3300013104 Bacteria 4277
208 Ga0157370_10081320 3300013104 Bacteria 3048
209 Ga0157370_10087900 3300013104 Bacteria 2919
210 Ga0157370_10089193 3300013104 Unclassified 2897
211 Ga0157369_10000002 3300013105 Bacteria 524510
212 Ga0157369_10041881 3300013105 Bacteria 4998
213 Ga0157369_10050485 3300013105 Bacteria 4504
214 Ga0157369_10231869 3300013105 Unclassified 1930
215 Ga0157374_10008082 3300013296 Bacteria 8994
216 Ga0157374_10025460 3300013296 Bacteria 5313
217 Ga0157374_10031820 3300013296 Unclassified 4799
218 Ga0157374_10044387 3300013296 Bacteria 4109
219 Ga0157374_10063689 3300013296 Bacteria 3458
220 Ga0157378_10008896 3300013297 Bacteria 8739
221 Ga0157378_10055072 3300013297 Bacteria 3542
222 Ga0163162_10000371 3300013306 Bacteria 40778
223 Ga0163162_10003238 3300013306 Bacteria 15578
224 Ga0163162_10003441 3300013306 Bacteria 15113
225 Ga0163162_10003933 3300013306 Bacteria 14259
226 Ga0163162_10007669 3300013306 Bacteria 10508
227 Ga0163162_10008130 3300013306 Bacteria 10236
228 Ga0163162_10015845 3300013306 Bacteria 7366
229 Ga0163162_10034877 3300013306 Bacteria 5009
230 Ga0163162_10102877 3300013306 Bacteria 2950
231 Ga0163162_10123863 3300013306 Bacteria 2690
232 Ga0163162_10176801 3300013306 Bacteria 2260
233 Ga0163162_10237684 3300013306 Bacteria 1952
234 Ga0157372_10016128 3300013307 Bacteria 8015
235 Ga0157372_10035395 3300013307 Bacteria 5497
236 Ga0157372_10073721 3300013307 Bacteria 3848
237 Ga0157372_10106988 3300013307 Bacteria 3200
238 Ga0157375_10020378 3300013308 Bacteria 6057
239 Ga0157375_10022052 3300013308 Bacteria 5856
240 Ga0157375_10122031 3300013308 Bacteria 2716
241 Ga0157375_10181916 3300013308 Bacteria 2254
242 Ga0157375_10249377 3300013308 Bacteria 1936
243 Ga0157375_10309962 3300013308 Bacteria 1743
244 Ga0163163_10000616 3300014325 Bacteria 30789
245 Ga0163163_10011923 3300014325 Bacteria 7908
246 Ga0163163_10045249 3300014325 Bacteria 4320
247 Ga0163163_10246080 3300014325 Unclassified 1838
248 Ga0163163_10265685 3300014325 Unclassified 1767
249 Ga0157380_10003155 3300014326 Bacteria 11256
250 Ga0182008_10000010 3300014497 Bacteria 301527
251 Ga0182008_10000894 3300014497 Bacteria 20715
252 Ga0182008_10001182 3300014497 Bacteria 17998
253 Ga0157379_10004450 3300014968 Bacteria 12015
254 Ga0157379_10076541 3300014968 Bacteria 2996
255 Ga0157379_10210774 3300014968 Bacteria 1759
256 Ga0157379_10237990 3300014968 Bacteria 1651
257 Ga0157376_10010426 3300014969 Bacteria 6797
258 Ga0157376_10014971 3300014969 Bacteria 5845
259 Ga0157376_10015535 3300014969 Bacteria 5754
260 Ga0157376_10015567 3300014969 Bacteria 5750
261 Ga0157376_10023030 3300014969 Bacteria 4867
262 Ga0157376_10025988 3300014969 Bacteria 4620
263 Ga0182006_1000947 3300015261 Bacteria 19348
264 Ga0182006_1002207 3300015261 Bacteria 10788
265 Ga0182006_1002866 3300015261 Bacteria 9172
266 Ga0182006_1007137 3300015261 Bacteria 5138
267 Ga0182006_1011292 3300015261 Bacteria 3936
268 Ga0182007_10000001 3300015262 Bacteria 1127301
269 Ga0182005_1000107 3300015265 Bacteria 60831
270 Ga0163161_10000211 3300017792 Bacteria 53320
271 Ga0163161_10009282 3300017792 Bacteria 6804
272 Ga0163161_10028994 3300017792 Bacteria 3933
273 Ga0163161_10034090 3300017792 Bacteria 3640
274 Ga0163161_10050652 3300017792 Bacteria 3006
275 Ga0163161_10168897 3300017792 Bacteria 1671
276 Ga0207425_1000007 3300025245 Bacteria 777411
277 Ga0209026_1000537 3300025250 Bacteria 26098
278 Ga0209677_100505 3300025253 Bacteria 21853
279 Ga0209129_1000006 3300025258 Bacteria 777761
280 Ga0209676_1000001 3300025292 Bacteria 1852142
281 Ga0209025_1000025 3300025294 Bacteria 524454
282 Ga0209758_1000016 3300025297 Bacteria 778557
283 Ga0209050_1000018 3300025298 Bacteria 723263
284 Ga0207426_1000052 3300025302 Bacteria 389825
285 Ga0207682_10013735 3300025893 Bacteria 3153
286 Ga0207688_10131192 3300025901 Bacteria 1469
287 Ga0207680_10000084 3300025903 Bacteria 42773
288 Ga0207680_10013412 3300025903 Bacteria 4208
289 Ga0207647_10146580 3300025904 Bacteria 1381
290 Ga0207645_10057655 3300025907 Unclassified 2480
291 Ga0207645_10093049 3300025907 Bacteria 1939
292 Ga0207643_10055016 3300025908 Bacteria 2262
293 Ga0207705_10018467 3300025909 Bacteria 4987
294 Ga0207707_10066217 3300025912 Bacteria 3146
295 Ga0207707_10182642 3300025912 Bacteria 1831
296 Ga0207695_10020921 3300025913 Bacteria 7477
297 Ga0207695_10072815 3300025913 Unclassified 3504
298 Ga0207695_10108507 3300025913 Bacteria 2760
299 Ga0207671_10000842 3300025914 Bacteria 38914
300 Ga0207662_10007356 3300025918 Bacteria 5991
301 Ga0207657_10021723 3300025919 Bacteria 6033
302 Ga0207657_10160617 3300025919 Bacteria 1825
303 Ga0207657_10200113 3300025919 Bacteria 1607
304 Ga0207649_10001616 3300025920 Bacteria 13086
305 Ga0207649_10010847 3300025920 Bacteria 5009
306 Ga0207652_10028657 3300025921 Bacteria 4649
307 Ga0207652_10221440 3300025921 Bacteria 1705
308 Ga0207694_10174547 3300025924 Bacteria 1741
309 Ga0207650_10018318 3300025925 Bacteria 4913
310 Ga0207650_10035881 3300025925 Bacteria 3604
311 Ga0207650_10131482 3300025925 Bacteria 1959
312 Ga0207687_10169310 3300025927 Bacteria 1683
313 Ga0207644_10010721 3300025931 Bacteria 6044
314 Ga0207644_10035017 3300025931 Bacteria 3516
315 Ga0207690_10016996 3300025932 Bacteria 4436
316 Ga0207690_10141090 3300025932 Bacteria 1776
317 Ga0207690_10160229 3300025932 Bacteria 1677
318 Ga0207706_10014897 3300025933 Bacteria 7041
319 Ga0207706_10015676 3300025933 Bacteria 6851
320 Ga0207706_10031098 3300025933 Bacteria 4757
321 Ga0207706_10123944 3300025933 Bacteria 2273
322 Ga0207686_10000863 3300025934 Bacteria 18417
323 Ga0207686_10046909 3300025934 Bacteria 2668
324 Ga0207686_10068132 3300025934 Bacteria 2279
325 Ga0207670_10002761 3300025936 Bacteria 9244
326 Ga0207669_10034485 3300025937 Bacteria 2868
327 Ga0207669_10086196 3300025937 Bacteria 2030
328 Ga0207704_10014800 3300025938 Bacteria 3953
329 Ga0207691_10000054 3300025940 Bacteria 91463
330 Ga0207691_10008921 3300025940 Bacteria 9628
331 Ga0207691_10021348 3300025940 Bacteria 6115
332 Ga0207691_10039482 3300025940 Bacteria 4367
333 Ga0207691_10096027 3300025940 Bacteria 2650
334 Ga0207691_10174434 3300025940 Bacteria 1881
335 Ga0207689_10000829 3300025942 Bacteria 29817
336 Ga0207689_10018125 3300025942 Bacteria 5946
337 Ga0207689_10070226 3300025942 Bacteria 2877
338 Ga0207689_10078193 3300025942 Bacteria 2719
339 Ga0207661_10000392 3300025944 Bacteria 28407
340 Ga0207661_10027321 3300025944 Bacteria 4358
341 Ga0207661_10154767 3300025944 Bacteria 1984
342 Ga0207661_10234528 3300025944 Bacteria 1626
343 Ga0207679_10002477 3300025945 Bacteria 11367
344 Ga0207679_10004724 3300025945 Bacteria 8479
345 Ga0207679_10006721 3300025945 Bacteria 7284
346 Ga0207667_10025808 3300025949 Bacteria 6427
347 Ga0207667_10108606 3300025949 Bacteria 2862
348 Ga0207667_10128581 3300025949 Bacteria 2609
349 Ga0207712_10007953 3300025961 Bacteria 6700
350 Ga0207712_10035510 3300025961 Bacteria 3388
351 Ga0207640_10034946 3300025981 Bacteria 3141
352 Ga0207640_10126545 3300025981 Bacteria 1840
353 Ga0207658_10140838 3300025986 Unclassified 1951
354 Ga0207658_10151788 3300025986 Unclassified 1888
355 Ga0207677_10204643 3300026023 Bacteria 1571
356 Ga0207703_10004566 3300026035 Bacteria 11351
357 Ga0207703_10175009 3300026035 Unclassified 1890
358 Ga0207639_10011521 3300026041 Bacteria 6143
359 Ga0207639_10044350 3300026041 Bacteria 3344
360 Ga0207639_10209919 3300026041 Bacteria 1675
361 Ga0207678_10160279 3300026067 Bacteria 1921
362 Ga0207702_10018874 3300026078 Bacteria 5704
363 Ga0207702_10023529 3300026078 Bacteria 5110
364 Ga0207702_10032342 3300026078 Bacteria 4365
365 Ga0207702_10046883 3300026078 Bacteria 3640
366 Ga0207641_10000061 3300026088 Bacteria 160161
367 Ga0207641_10001211 3300026088 Bacteria 25807
368 Ga0207641_10026342 3300026088 Bacteria 4798
369 Ga0207641_10030185 3300026088 Bacteria 4489
370 Ga0207648_10051943 3300026089 Bacteria 3584
371 Ga0207676_10026393 3300026095 Bacteria 4321
372 Ga0207676_10140387 3300026095 Bacteria 2067
373 Ga0207674_10015242 3300026116 Bacteria 8456
374 Ga0207674_10016092 3300026116 Bacteria 8193
375 Ga0207674_10068170 3300026116 Bacteria 3580
376 Ga0207674_10136179 3300026116 Bacteria 2418
377 Ga0207675_100032380 3300026118 Bacteria 4869
378 Ga0207675_100231392 3300026118 Unclassified 1783
379 Ga0207698_10004824 3300026142 Bacteria 8258
380 Ga0207698_10040255 3300026142 Bacteria 3470
381 Ga0207698_10063774 3300026142 Bacteria 2885
382 Ga0207698_10064846 3300026142 Bacteria 2865
383 Ga0207698_10065544 3300026142 Bacteria 2853
384 Ga0268265_10291035 3300028380 Bacteria 1466
385 Ga0268264_10003369 3300028381 Bacteria 13813
386 Ga0268264_10191918 3300028381 Unclassified 1863
387 Ga0265319_1031487 3300028563 Bacteria 1846
388 Ga0265318_10025512 3300028577 Bacteria 2333
389 Ga0307515_10000057 3300028794 Bacteria 261695
390 Ga0307515_10002798 3300028794 Bacteria 37144
391 Ga0307515_10002819 3300028794 Bacteria 36978
392 Ga0265332_10034399 3300031238 Bacteria 2203
393 Ga0265320_10044342 3300031240 Bacteria 2192
394 Ga0265327_10029952 3300031251 Bacteria 3086
395 Ga0307509_10129274 3300031507 Bacteria 2485
396 Ga0307509_10160808 3300031507 Bacteria 2144
397 Ga0265313_10004225 3300031595 Bacteria 11135
398 Ga0307508_10001709 3300031616 Bacteria 24361
399 Ga0307405_10000046 3300031731 Bacteria 71442
400 Ga0307407_10000090 3300031903 Bacteria 32483
401 Ga0307412_10000018 3300031911 Bacteria 284374
402 Ga0307416_100000195 3300032002 Bacteria 32400
403 Ga0307416_100010171 3300032002 Bacteria 6203
404 Ga0307414_10000563 3300032004 Bacteria 19353
405 Ga0307414_10009803 3300032004 Bacteria 5521
406 Ga0307507_10001027 3300033179 Bacteria 62236
407 Ga0373927_0035913 3300035695 Unclassified 3225
408 Ga0373937_0012356 3300036401 Bacteria 7509
409 Ga0373937_0069050 3300036401 Bacteria 3258
410 Ga0395899_0009741 3300037312 Bacteria 7374
411 Ga0395899_0038058 3300037312 Bacteria 3604
412 Ga0395900_0001587 3300037418 Bacteria 26890
413 Ga0395900_0421467 3300037418 Bacteria 1295
414 Ga0395898_0002566 3300037466 Bacteria 21273
415 Ga0395905_0031915 3300037471 Bacteria 4955
416 Ga0395901_0001075 3300038443 Bacteria 29195
417 Ga0439436_0016608 3300041404 Bacteria 2207
418 Ga0439457_004080 3300042014 Unclassified 3866
419 Ga0439462_0012917 3300042015 Bacteria 2137
420 Ga0450894_008795 3300042131 Bacteria 1307
421 Ga0466972_0000114 3300044658 Bacteria 68658
422 Ga0466972_0034033 3300044658 Bacteria 2498
423 Ga0495627_002880 3300046453 Bacteria 7929
424 Ga0495629_0027578 3300046459 Bacteria 4033
425 Ga0495629_0043135 3300046459 Bacteria 3168
426 Ga0495638_0024220 3300046460 Unclassified 3961
427 Ga0495585_0003042 3300046492 Bacteria 11558
428 Ga0495607_0058869 3300046501 Bacteria 2194
429 Ga0495606_0007520 3300046507 Bacteria 9720
430 Ga0495610_0000126 3300046512 Bacteria 85368
431 Ga0495610_0001202 3300046512 Bacteria 23373
432 Ga0495610_0004181 3300046512 Bacteria 10786
433 Ga0495630_0009510 3300046517 Bacteria 6992
434 Ga0495648_0005321 3300046524 Bacteria 10729
435 Ga0495648_0005651 3300046524 Bacteria 10349
436 Ga0495648_0011090 3300046524 Bacteria 6823
437 Ga0495652_0075974 3300046529 Bacteria 2788
438 Ga0495609_0018191 3300046538 Bacteria 3258
439 Ga0495645_0104623 3300046543 Unclassified 2010
440 Ga0495633_0000067 3300046558 Bacteria 139122
441 Ga0495633_0000147 3300046558 Bacteria 94306
442 Ga0495667_0112760 3300046559 Bacteria 1757
443 Ga0495668_0000069 3300046616 Bacteria 174287
444 Ga0495625_0001618 3300046660 Bacteria 26556
445 Ga0495625_0003182 3300046660 Bacteria 16702
446 Ga0495625_0034238 3300046660 Bacteria 3750
447 Ga0495661_0005226 3300046665 Bacteria 9241
448 Ga0495661_0148003 3300046665 Bacteria 1270
449 Ga0495658_0022137 3300046683 Bacteria 3358
450 Ga0495670_0081915 3300046691 Unclassified 1645
451 Ga0495680_0058894 3300047322 Bacteria 2967
452 Ga0495687_000158 3300047443 Bacteria 103129
453 Ga0495687_003106 3300047443 Bacteria 12423
454 Ga0495684_0011350 3300047471 Bacteria 6878
455 Ga0495686_0113603 3300047472 Bacteria 1621
456 Ga0496122_0000817 3300048925 Bacteria 59596
457 Ga0496123_0005275 3300048926 Bacteria 13103
458 Ga0496124_0093506 3300048927 Unclassified 2447
459 Ga0496125_0000185 3300048928 Bacteria 135607
460 Ga0496125_0077975 3300048928 Bacteria 2550
461 Ga0501032_0010676 3300049569 Bacteria 6611
462 Ga0501033_0035979 3300049570 Bacteria 3711
463 Ga0501034_0034920 3300049571 Bacteria 5099
464 Ga0501034_0082320 3300049571 Bacteria 3220
465 Ga0501034_0149987 3300049571 Bacteria 2308
466 Ga0501037_0072598 3300049573 Bacteria 2502
467 Ga0501037_0079109 3300049573 Bacteria 2386
468 Ga0501038_0041915 3300049574 Bacteria 3990
469 Ga0501038_0100036 3300049574 Bacteria 2416
470 Ga0501043_0010274 3300049579 Bacteria 7336
471 Ga0501043_0120764 3300049579 Unclassified 2055
472 Ga0501047_0060784 3300049581 Bacteria 3645
473 Ga0501047_0078692 3300049581 Bacteria 3170
474 Ga0501070_0327025 3300049586 Bacteria 1246
475 Ga0501225_0012071 3300049705 Bacteria 2427
476 Ga0501266_000778 3300049763 Bacteria 4122
477 Ga0501268_001392 3300049765 Bacteria 3012
478 Ga0501035_0015533 3300049822 Bacteria 7023
479 Ga0501035_0039817 3300049822 Bacteria 4251
480 Ga0501044_0354940 3300049823 Bacteria 1385
481 nmdc:mga0k408_150_c1 3300050493 Bacteria 35565
482 nmdc:mga0k408_5437_c1 3300050493 Bacteria 6780
483 nmdc:mga07m45_91909_c1 3300050496 Bacteria 1739
484 nmdc:mga05p37_1143_c1 3300050507 Bacteria 30508
485 nmdc:mga08y16_112873_c1 3300050511 Bacteria 2829
486 nmdc:mga08y16_390261_c1 3300050511 Bacteria 1426
487 Ga0495601_0076946 3300053077 Bacteria 2137
488 Ga0495619_0008622 3300053085 Bacteria 6450
489 Ga0500644_0047555 3300053088 Bacteria 1456
490 Ga0500583_0030984 3300053092 Bacteria 2346
491 Ga0500641_0000123 3300053096 Bacteria 29195
492 Ga0500556_0027690 3300053104 Bacteria 1896
493 Ga0500562_000077 3300053108 Bacteria 45189
494 Ga0500595_042297 3300053119 Bacteria 1459
495 Ga0500618_000040 3300053125 Bacteria 112548
496 Ga0500652_029285 3300053131 Unclassified 2146
497 Ga0500658_0001530 3300053134 Bacteria 9262
498 Ga0500568_0010981 3300053139 Bacteria 4219
499 Ga0500577_0000779 3300053142 Bacteria 8195
500 Ga0500588_0007664 3300053146 Bacteria 2497
501 Ga0500604_0004839 3300053151 Bacteria 3569
502 Ga0500616_0005769 3300053153 Bacteria 8316
503 Ga0500622_0003971 3300053156 Bacteria 9540
504 Ga0500622_0007338 3300053156 Bacteria 6271
505 Ga0500633_0018456 3300053160 Bacteria 2069
506 Ga0500639_061448 3300053163 Bacteria 1935

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025907 Ga0207645_10093049 Ga0207645_100930492 309
2 3300026142 Ga0207698_10063774 Ga0207698_100637741 337
3 3300026089 Ga0207648_10051943 Ga0207648_100519432 340
4 3300013296 Ga0157374_10063689 Ga0157374_100636895 350
5 3300048928 Ga0496125_0000185 Ga0496125_0000185_68128_69279 350
6 3300046459 Ga0495629_0043135 Ga0495629_0043135_800_1930 353
7 3300046665 Ga0495661_0148003 Ga0495661_0148003_28_1176 353
8 3300046558 Ga0495633_0000067 Ga0495633_0000067_2025_3251 357
9 3300036401 Ga0373937_0069050 Ga0373937_0069050_344_1474 359
10 3300006195 Ga0075366_10000042 Ga0075366_100000423 360
11 3300046660 Ga0495625_0001618 Ga0495625_0001618_1446_2672 360
12 3300050493 nmdc:mga0k408_150_c1 nmdc:mga0k408_150_c1_10457_11683 360
13 3300028794 Ga0307515_10002798 Ga0307515_1000279825 361
14 3300005329 Ga0070683_100033448 Ga0070683_1000334482 362
15 3300005340 Ga0070689_100070072 Ga0070689_1000700721 362
16 3300005354 Ga0070675_100012235 Ga0070675_1000122354 362
17 3300005457 Ga0070662_100009098 Ga0070662_1000090984 362
18 3300005564 Ga0070664_100139713 Ga0070664_1001397132 362
19 3300005577 Ga0068857_100153919 Ga0068857_1001539192 362
20 3300005617 Ga0068859_100025916 Ga0068859_1000259162 362
21 3300006931 Ga0097620_100025917 Ga0097620_1000259172 362
22 3300013296 Ga0157374_10008082 Ga0157374_100080822 362
23 3300013308 Ga0157375_10249377 Ga0157375_102493772 362
24 3300014325 Ga0163163_10011923 Ga0163163_100119234 362
25 3300025944 Ga0207661_10027321 Ga0207661_100273213 362
26 3300025945 Ga0207679_10004724 Ga0207679_100047241 362
27 3300026095 Ga0207676_10140387 Ga0207676_101403872 362
28 3300046459 Ga0495629_0027578 Ga0495629_0027578_766_1992 362
29 3300046492 Ga0495585_0003042 Ga0495585_0003042_7486_8712 362
30 3300046524 Ga0495648_0005651 Ga0495648_0005651_6473_7699 362
31 3300046538 Ga0495609_0018191 Ga0495609_0018191_1108_2334 362
32 3300046660 Ga0495625_0003182 Ga0495625_0003182_14251_15477 362
33 3300046683 Ga0495658_0022137 Ga0495658_0022137_864_2090 362
34 3300028794 Ga0307515_10002819 Ga0307515_100028197 364
35 3300033179 Ga0307507_10001027 Ga0307507_1000102726 364
36 3300046524 Ga0495648_0011090 Ga0495648_0011090_2491_3717 364
37 3300046616 Ga0495668_0000069 Ga0495668_0000069_79909_81135 364
38 3300005353 Ga0070669_100065633 Ga0070669_1000656332 365
39 3300013306 Ga0163162_10003933 Ga0163162_100039334 365
40 3300053156 Ga0500622_0003971 Ga0500622_0003971_5416_6564 367
41 3300013307 Ga0157372_10073721 Ga0157372_100737212 368
42 3300053096 Ga0500641_0000123 Ga0500641_0000123_26774_27925 368
43 3300003322 rootL2_10180183 rootL2_101801832 369
44 3300013104 Ga0157370_10000621 Ga0157370_1000062132 369
45 3300017792 Ga0163161_10034090 Ga0163161_100340903 369
46 3300031616 Ga0307508_10001709 Ga0307508_1000170916 369
47 3300037312 Ga0395899_0009741 Ga0395899_0009741_5128_6282 369
48 3300037466 Ga0395898_0002566 Ga0395898_0002566_1386_2540 369
49 3300038443 Ga0395901_0001075 Ga0395901_0001075_27694_28848 369
50 3300013307 Ga0157372_10016128 Ga0157372_100161283 370
51 3300025981 Ga0207640_10126545 Ga0207640_101265452 370
52 3300031507 Ga0307509_10129274 Ga0307509_101292743 370
53 3300035695 Ga0373927_0035913 Ga0373927_0035913_37_1203 370
54 3300049569 Ga0501032_0010676 Ga0501032_0010676_4578_5744 370
55 3300049570 Ga0501033_0035979 Ga0501033_0035979_2361_3527 370
56 3300049571 Ga0501034_0034920 Ga0501034_0034920_3655_4821 370
57 3300049573 Ga0501037_0079109 Ga0501037_0079109_1069_2235 370
58 3300049574 Ga0501038_0041915 Ga0501038_0041915_1913_3079 370
59 3300049579 Ga0501043_0010274 Ga0501043_0010274_1185_2351 370
60 3300049579 Ga0501043_0120764 Ga0501043_0120764_66_1232 370
61 3300049581 Ga0501047_0060784 Ga0501047_0060784_1437_2603 370
62 3300049822 Ga0501035_0039817 Ga0501035_0039817_1806_2972 370
63 3300053108 Ga0500562_000077 Ga0500562_000077_10702_11952 370
64 3300005334 Ga0068869_100013910 Ga0068869_1000139103 371
65 3300005535 Ga0070684_100023837 Ga0070684_1000238372 371
66 3300005564 Ga0070664_100049624 Ga0070664_1000496242 371
67 3300025901 Ga0207688_10131192 Ga0207688_101311921 371
68 3300025933 Ga0207706_10031098 Ga0207706_100310983 371
69 3300025942 Ga0207689_10018125 Ga0207689_100181253 371
70 3300026116 Ga0207674_10136179 Ga0207674_101361793 371
71 3300005614 Ga0068856_100004666 Ga0068856_1000046665 372
72 3300013308 Ga0157375_10122031 Ga0157375_101220312 372
73 3300014968 Ga0157379_10210774 Ga0157379_102107742 372
74 3300025904 Ga0207647_10146580 Ga0207647_101465801 372
75 3300025912 Ga0207707_10066217 Ga0207707_100662171 372
76 3300025940 Ga0207691_10039482 Ga0207691_100394822 372
77 3300026078 Ga0207702_10023529 Ga0207702_100235292 372
78 3300003323 rootH1_10006645 rootH1_1000664537 373
79 3300005367 Ga0070667_100090081 Ga0070667_1000900812 373
80 3300009174 Ga0105241_10063911 Ga0105241_100639112 373
81 3300005327 Ga0070658_10058052 Ga0070658_100580522 374
82 3300005331 Ga0070670_100043836 Ga0070670_1000438362 374
83 3300005563 Ga0068855_100068930 Ga0068855_1000689304 374
84 3300025925 Ga0207650_10035881 Ga0207650_100358812 374
85 3300031595 Ga0265313_10004225 Ga0265313_100042257 376
86 3300046660 Ga0495625_0034238 Ga0495625_0034238_670_1896 376
87 iso_pu_bacteria 2775506987 2776613097 376
88 3300006237 Ga0097621_100044967 Ga0097621_1000449673 377
89 3300014969 Ga0157376_10023030 Ga0157376_100230303 377
90 3300025253 Ga0209677_100505 Ga0209677_1005056 377
91 3300009545 Ga0105237_10000088 Ga0105237_1000008885 378
92 3300013104 Ga0157370_10004615 Ga0157370_1000461516 378
93 3300013306 Ga0163162_10003238 Ga0163162_100032382 378
94 3300013306 Ga0163162_10003441 Ga0163162_1000344112 378
95 3300013306 Ga0163162_10123863 Ga0163162_101238632 378
96 3300014497 Ga0182008_10000894 Ga0182008_1000089420 378
97 3300014969 Ga0157376_10015567 Ga0157376_100155673 378
98 3300014969 Ga0157376_10025988 Ga0157376_100259882 378
99 3300015261 Ga0182006_1000947 Ga0182006_100094710 378
100 3300046512 Ga0495610_0004181 Ga0495610_0004181_4199_5422 378
101 3300046665 Ga0495661_0005226 Ga0495661_0005226_146_1369 378
102 3300047443 Ga0495687_003106 Ga0495687_003106_7488_8711 378
103 3300048925 Ga0496122_0000817 Ga0496122_0000817_1413_2618 378
104 3300048926 Ga0496123_0005275 Ga0496123_0005275_5680_6885 378
105 3300048928 Ga0496125_0077975 Ga0496125_0077975_778_1983 378
106 3300053125 Ga0500618_000040 Ga0500618_000040_93894_95132 378
107 3300005365 Ga0070688_100119125 Ga0070688_1001191251 379
108 3300049763 Ga0501266_000778 Ga0501266_000778_1808_3058 379
109 3300049765 Ga0501268_001392 Ga0501268_001392_1537_2787 379
110 iso_pu_bacteria 2898713307 2898715169 379
111 iso_pu_bacteria 8055588893 8055589247 379
112 3300005289 Ga0065704_10076325 Ga0065704_100763253 380
113 3300006195 Ga0075366_10015672 Ga0075366_100156723 380
114 3300013102 Ga0157371_10004243 Ga0157371_100042436 380
115 3300013104 Ga0157370_10006549 Ga0157370_1000654912 380
116 3300046507 Ga0495606_0007520 Ga0495606_0007520_6979_8205 380
117 3300050493 nmdc:mga0k408_5437_c1 nmdc:mga0k408_5437_c1_1802_3052 380
118 3300050511 nmdc:mga08y16_390261_c1 nmdc:mga08y16_390261_c1_210_1406 380
119 3300005331 Ga0070670_100017458 Ga0070670_1000174581 381
120 3300005354 Ga0070675_100021648 Ga0070675_1000216483 381
121 3300005355 Ga0070671_100216704 Ga0070671_1002167041 381
122 3300005364 Ga0070673_100006132 Ga0070673_1000061325 381
123 3300005364 Ga0070673_100019980 Ga0070673_1000199804 381
124 3300005457 Ga0070662_100016814 Ga0070662_1000168143 381
125 3300005617 Ga0068859_100098462 Ga0068859_1000984624 381
126 3300005617 Ga0068859_100119396 Ga0068859_1001193962 381
127 3300006237 Ga0097621_100253772 Ga0097621_1002537721 381
128 3300006931 Ga0097620_100098464 Ga0097620_1000984644 381
129 3300006931 Ga0097620_100119393 Ga0097620_1001193932 381
130 3300009093 Ga0105240_10003631 Ga0105240_1000363118 381
131 3300009174 Ga0105241_10015322 Ga0105241_100153223 381
132 3300009551 Ga0105238_10167061 Ga0105238_101670612 381
133 3300010375 Ga0105239_10009182 Ga0105239_100091828 381
134 3300013102 Ga0157371_10017622 Ga0157371_100176227 381
135 3300025913 Ga0207695_10020921 Ga0207695_100209216 381
136 3300025918 Ga0207662_10007356 Ga0207662_100073564 381
137 3300025925 Ga0207650_10018318 Ga0207650_100183184 381
138 3300025940 Ga0207691_10096027 Ga0207691_100960272 381
139 3300025942 Ga0207689_10078193 Ga0207689_100781932 381
140 3300026041 Ga0207639_10209919 Ga0207639_102099191 381
141 3300026142 Ga0207698_10064846 Ga0207698_100648463 381
142 3300031507 Ga0307509_10160808 Ga0307509_101608082 381
143 3300042131 Ga0450894_008795 Ga0450894_008795_47_1246 381
144 3300046529 Ga0495652_0075974 Ga0495652_0075974_143_1369 381
145 3300005289 Ga0065704_10070224 Ga0065704_1007022422 382
146 3300005563 Ga0068855_100122031 Ga0068855_1001220314 382
147 3300006237 Ga0097621_100244816 Ga0097621_1002448162 382
148 3300009093 Ga0105240_10158061 Ga0105240_101580613 382
149 3300009174 Ga0105241_10029228 Ga0105241_100292282 382
150 3300010375 Ga0105239_10099428 Ga0105239_100994282 382
151 3300013102 Ga0157371_10001139 Ga0157371_1000113916 382
152 3300013104 Ga0157370_10087900 Ga0157370_100879002 382
153 3300013105 Ga0157369_10050485 Ga0157369_100504854 382
154 3300013307 Ga0157372_10106988 Ga0157372_101069884 382
155 3300015261 Ga0182006_1011292 Ga0182006_10112922 382
156 3300025913 Ga0207695_10072815 Ga0207695_100728153 382
157 3300025949 Ga0207667_10128581 Ga0207667_101285811 382
158 3300031911 Ga0307412_10000018 Ga0307412_10000018245 382
159 3300032004 Ga0307414_10000563 Ga0307414_1000056316 382
160 3300014497 Ga0182008_10000010 Ga0182008_10000010221 383
161 3300037418 Ga0395900_0001587 Ga0395900_0001587_2595_3800 383
162 iso_pu_bacteria 2738541284 2738760913 383
163 iso_pu_bacteria 2902048731 2902051781 383
164 3300005329 Ga0070683_100001717 Ga0070683_10000171716 384
165 3300005344 Ga0070661_100002697 Ga0070661_10000269712 384
166 3300005366 Ga0070659_100018925 Ga0070659_1000189252 384
167 3300005535 Ga0070684_100000866 Ga0070684_1000008663 384
168 3300005539 Ga0068853_100200885 Ga0068853_1002008852 384
169 3300005564 Ga0070664_100001013 Ga0070664_1000010132 384
170 3300005577 Ga0068857_100001556 Ga0068857_1000015566 384
171 3300006042 Ga0075368_10009863 Ga0075368_100098634 384
172 3300006051 Ga0075364_10023170 Ga0075364_100231702 384
173 3300006178 Ga0075367_10080909 Ga0075367_100809093 384
174 3300006353 Ga0075370_10015632 Ga0075370_100156323 384
175 3300013307 Ga0157372_10035395 Ga0157372_100353953 384
176 3300025920 Ga0207649_10001616 Ga0207649_100016162 384
177 3300025932 Ga0207690_10016996 Ga0207690_100169962 384
178 3300025944 Ga0207661_10000392 Ga0207661_1000039220 384
179 3300025945 Ga0207679_10002477 Ga0207679_1000247710 384
180 3300026041 Ga0207639_10011521 Ga0207639_100115214 384
181 3300026116 Ga0207674_10015242 Ga0207674_100152427 384
182 3300050496 nmdc:mga07m45_91909_c1 nmdc:mga07m45_91909_c1_256_1461 384
183 iso_pu_bacteria 2738541283 2738755930 384
184 3300003323 rootH1_10160870 rootH1_101608704 385
185 3300005327 Ga0070658_10012409 Ga0070658_100124093 385
186 3300005338 Ga0068868_100022472 Ga0068868_1000224722 385
187 3300005339 Ga0070660_100053263 Ga0070660_1000532633 385
188 3300005344 Ga0070661_100042394 Ga0070661_1000423942 385
189 3300005347 Ga0070668_100088440 Ga0070668_1000884403 385
190 3300005356 Ga0070674_100005589 Ga0070674_1000055892 385
191 3300005364 Ga0070673_100035867 Ga0070673_1000358673 385
192 3300005366 Ga0070659_100109851 Ga0070659_1001098511 385
193 3300005455 Ga0070663_100126022 Ga0070663_1001260222 385
194 3300005539 Ga0068853_100021672 Ga0068853_1000216723 385
195 3300005543 Ga0070672_100036064 Ga0070672_1000360643 385
196 3300005548 Ga0070665_100033188 Ga0070665_1000331881 385
197 3300005614 Ga0068856_100136121 Ga0068856_1001361211 385
198 3300005614 Ga0068856_100238319 Ga0068856_1002383192 385
199 3300005614 Ga0068856_100270737 Ga0068856_1002707372 385
200 3300005616 Ga0068852_100036525 Ga0068852_1000365254 385
201 3300009093 Ga0105240_10096816 Ga0105240_100968162 385
202 3300009093 Ga0105240_10210849 Ga0105240_102108493 385
203 3300009098 Ga0105245_10246982 Ga0105245_102469822 385
204 3300009174 Ga0105241_10130775 Ga0105241_101307752 385
205 3300009551 Ga0105238_10090995 Ga0105238_100909951 385
206 3300009551 Ga0105238_10241445 Ga0105238_102414452 385
207 3300010375 Ga0105239_10029938 Ga0105239_100299385 385
208 3300013102 Ga0157371_10001338 Ga0157371_1000133823 385
209 3300013102 Ga0157371_10004807 Ga0157371_100048079 385
210 3300013104 Ga0157370_10019261 Ga0157370_100192614 385
211 3300013104 Ga0157370_10044315 Ga0157370_100443153 385
212 3300013104 Ga0157370_10081320 Ga0157370_100813202 385
213 3300013105 Ga0157369_10041881 Ga0157369_100418813 385
214 3300013297 Ga0157378_10055072 Ga0157378_100550721 385
215 3300015261 Ga0182006_1002207 Ga0182006_10022072 385
216 3300025909 Ga0207705_10018467 Ga0207705_100184672 385
217 3300025913 Ga0207695_10108507 Ga0207695_101085073 385
218 3300025919 Ga0207657_10021723 Ga0207657_100217233 385
219 3300025919 Ga0207657_10200113 Ga0207657_102001132 385
220 3300025920 Ga0207649_10010847 Ga0207649_100108472 385
221 3300025924 Ga0207694_10174547 Ga0207694_101745471 385
222 3300025927 Ga0207687_10169310 Ga0207687_101693101 385
223 3300025932 Ga0207690_10141090 Ga0207690_101410901 385
224 3300025932 Ga0207690_10160229 Ga0207690_101602291 385
225 3300025937 Ga0207669_10034485 Ga0207669_100344851 385
226 3300025940 Ga0207691_10021348 Ga0207691_100213482 385
227 3300025949 Ga0207667_10025808 Ga0207667_100258084 385
228 3300026023 Ga0207677_10204643 Ga0207677_102046431 385
229 3300026067 Ga0207678_10160279 Ga0207678_101602792 385
230 3300026078 Ga0207702_10018874 Ga0207702_100188744 385
231 3300026078 Ga0207702_10046883 Ga0207702_100468834 385
232 3300026142 Ga0207698_10040255 Ga0207698_100402554 385
233 3300028563 Ga0265319_1031487 Ga0265319_10314872 385
234 3300028577 Ga0265318_10025512 Ga0265318_100255122 385
235 3300031238 Ga0265332_10034399 Ga0265332_100343992 385
236 3300031240 Ga0265320_10044342 Ga0265320_100443422 385
237 3300037312 Ga0395899_0038058 Ga0395899_0038058_2044_3294 385
238 3300037418 Ga0395900_0421467 Ga0395900_0421467_68_1279 385
239 3300049571 Ga0501034_0082320 Ga0501034_0082320_1561_2769 385
240 3300049573 Ga0501037_0072598 Ga0501037_0072598_1241_2452 385
241 3300049574 Ga0501038_0100036 Ga0501038_0100036_31_1242 385
242 3300049581 Ga0501047_0078692 Ga0501047_0078692_1371_2582 385
243 3300049586 Ga0501070_0327025 Ga0501070_0327025_14_1225 385
244 3300049822 Ga0501035_0015533 Ga0501035_0015533_5553_6764 385
245 3300013104 Ga0157370_10089193 Ga0157370_100891931 386
246 3300047472 Ga0495686_0113603 Ga0495686_0113603_63_1277 386
247 3300053119 Ga0500595_042297 Ga0500595_042297_206_1420 386
248 3300005329 Ga0070683_100024807 Ga0070683_1000248071 387
249 3300005337 Ga0070682_100006906 Ga0070682_1000069064 387
250 3300005344 Ga0070661_100103892 Ga0070661_1001038921 387
251 3300005456 Ga0070678_100108817 Ga0070678_1001088172 387
252 3300005457 Ga0070662_100035904 Ga0070662_1000359042 387
253 3300005547 Ga0070693_100007527 Ga0070693_1000075272 387
254 3300005616 Ga0068852_100005821 Ga0068852_1000058216 387
255 3300006358 Ga0068871_100056149 Ga0068871_1000561491 387
256 3300014325 Ga0163163_10045249 Ga0163163_100452494 387
257 3300025921 Ga0207652_10221440 Ga0207652_102214401 387
258 3300025933 Ga0207706_10014897 Ga0207706_100148972 387
259 3300025944 Ga0207661_10154767 Ga0207661_101547672 387
260 3300026041 Ga0207639_10044350 Ga0207639_100443501 387
261 3300026078 Ga0207702_10032342 Ga0207702_100323422 387
262 3300026116 Ga0207674_10016092 Ga0207674_100160924 387
263 3300026142 Ga0207698_10065544 Ga0207698_100655443 387
264 3300031251 Ga0265327_10029952 Ga0265327_100299522 387
265 3300049571 Ga0501034_0149987 Ga0501034_0149987_49_1266 387
266 3300044658 Ga0466972_0000114 Ga0466972_0000114_35717_36964 388
267 iso_pu_bacteria 2910245624 2910245902 388
268 3300005335 Ga0070666_10000047 Ga0070666_1000004717 389
269 3300005338 Ga0068868_100080011 Ga0068868_1000800112 389
270 3300005367 Ga0070667_100006277 Ga0070667_1000062774 389
271 3300005616 Ga0068852_100176176 Ga0068852_1001761762 389
272 3300005617 Ga0068859_100000030 Ga0068859_100000030126 389
273 3300005618 Ga0068864_100039135 Ga0068864_1000391353 389
274 3300005834 Ga0068851_10108829 Ga0068851_101088291 389
275 3300005841 Ga0068863_100012696 Ga0068863_1000126968 389
276 3300005842 Ga0068858_100001160 Ga0068858_10000116013 389
277 3300006931 Ga0097620_100000030 Ga0097620_10000003022 389
278 3300009101 Ga0105247_10010929 Ga0105247_100109294 389
279 3300009174 Ga0105241_10000369 Ga0105241_100003695 389
280 3300009176 Ga0105242_10114947 Ga0105242_101149471 389
281 3300009545 Ga0105237_10002825 Ga0105237_1000282512 389
282 3300009553 Ga0105249_10011907 Ga0105249_100119075 389
283 3300010375 Ga0105239_10049428 Ga0105239_100494283 389
284 3300013308 Ga0157375_10181916 Ga0157375_101819163 389
285 3300014968 Ga0157379_10076541 Ga0157379_100765413 389
286 3300025903 Ga0207680_10000084 Ga0207680_1000008419 389
287 3300025914 Ga0207671_10000842 Ga0207671_1000084227 389
288 3300025934 Ga0207686_10068132 Ga0207686_100681322 389
289 3300025942 Ga0207689_10000829 Ga0207689_1000082922 389
290 3300025961 Ga0207712_10007953 Ga0207712_100079534 389
291 3300026035 Ga0207703_10004566 Ga0207703_100045666 389
292 3300026088 Ga0207641_10000061 Ga0207641_1000006153 389
293 3300026095 Ga0207676_10026393 Ga0207676_100263933 389
294 3300026142 Ga0207698_10004824 Ga0207698_100048242 389
295 3300053151 Ga0500604_0004839 Ga0500604_0004839_2207_3418 389
296 iso_pu_bacteria 2849281842 2849282262 389
297 iso_pu_bacteria 2585427687 2586209967 390
298 iso_pu_bacteria 2738541302 2738853211 390
299 iso_pu_bacteria 2739367651 2739588775 390
300 iso_pu_bacteria 2739367663 2739645194 390
301 iso_pu_bacteria 2818991437 2819548763 390
302 iso_pu_bacteria 2842722452 2842726200 390
303 iso_pu_bacteria 2842909656 2842910444 390
304 iso_pu_bacteria 2857627736 2857629174 390
305 iso_pu_bacteria 2904445276 2904445595 390
306 iso_pu_bacteria 2945997725 2946000799 390
307 3300003323 rootH1_10278832 rootH1_102788321 391
308 3300005329 Ga0070683_100040919 Ga0070683_1000409193 391
309 3300013100 Ga0157373_10000284 Ga0157373_1000028414 391
310 3300013306 Ga0163162_10176801 Ga0163162_101768012 391
311 3300015265 Ga0182005_1000107 Ga0182005_100010747 391
312 3300025250 Ga0209026_1000537 Ga0209026_10005372 391
313 3300025925 Ga0207650_10131482 Ga0207650_101314822 391
314 3300046453 Ga0495627_002880 Ga0495627_002880_2126_3367 391
315 3300046558 Ga0495633_0000147 Ga0495633_0000147_13771_15012 391
316 iso_pu_bacteria 2818991442 2819576852 391
317 iso_pu_bacteria 2821136567 2821142975 391
318 iso_pu_bacteria 2904467357 2904470698 391
319 iso_pu_bacteria 2929239360 2929239479 391
320 3300053134 Ga0500658_0001530 Ga0500658_0001530_4175_5428 392
321 3300053142 Ga0500577_0000779 Ga0500577_0000779_4331_5584 392
322 3300053153 Ga0500616_0005769 Ga0500616_0005769_5446_6699 392
323 3300053160 Ga0500633_0018456 Ga0500633_0018456_818_2053 392
324 3300003316 rootH1_10064257 rootH1_100642572 393
325 3300003320 rootH2_10195988 rootH2_101959883 393
326 3300003354 JGI25160J50197_1001427 JGI25160J50197_10014275 393
327 3300005843 Ga0068860_100012408 Ga0068860_1000124086 393
328 3300006237 Ga0097621_100000595 Ga0097621_1000005952 393
329 3300006358 Ga0068871_100000741 Ga0068871_10000074116 393
330 3300009094 Ga0111539_10139595 Ga0111539_101395951 393
331 3300009177 Ga0105248_10032001 Ga0105248_100320016 393
332 3300009545 Ga0105237_10000759 Ga0105237_1000075915 393
333 3300009553 Ga0105249_10006552 Ga0105249_100065527 393
334 3300010375 Ga0105239_10025263 Ga0105239_100252635 393
335 3300013104 Ga0157370_10003065 Ga0157370_1000306511 393
336 3300013306 Ga0163162_10000371 Ga0163162_100003711 393
337 3300014325 Ga0163163_10000616 Ga0163163_1000061610 393
338 3300014969 Ga0157376_10014971 Ga0157376_100149714 393
339 3300017792 Ga0163161_10009282 Ga0163161_100092823 393
340 3300017792 Ga0163161_10028994 Ga0163161_100289941 393
341 3300025302 Ga0207426_1000052 Ga0207426_1000052317 393
342 3300025931 Ga0207644_10010721 Ga0207644_100107216 393
343 3300028381 Ga0268264_10003369 Ga0268264_100033697 393
344 3300046501 Ga0495607_0058869 Ga0495607_0058869_516_1775 393
345 3300050511 nmdc:mga08y16_112873_c1 nmdc:mga08y16_112873_c1_121_1356 393
346 iso_pu_bacteria 2738541278 2738726702 393
347 iso_pu_bacteria 2818991444 2819590729 393
348 3300002773 JGI25152J39213_1000056 JGI25152J39213_100005651 394
349 3300002774 JGI25150J39212_1000009 JGI25150J39212_100000917 394
350 3300003187 JGI25151J46595_10000017 JGI25151J46595_1000001717 394
351 3300003215 JGI25153J46596_10000023 JGI25153J46596_10000023220 394
352 3300003781 Ga0055536_1000030 Ga0055536_1000030105 394
353 3300003791 Ga0055530_10002863 Ga0055530_100028632 394
354 3300005288 Ga0065714_10008213 Ga0065714_100082132 394
355 3300005333 Ga0070677_10010795 Ga0070677_100107952 394
356 3300005356 Ga0070674_100241171 Ga0070674_1002411711 394
357 3300005364 Ga0070673_100054757 Ga0070673_1000547572 394
358 3300005718 Ga0068866_10081619 Ga0068866_100816192 394
359 3300005841 Ga0068863_100042433 Ga0068863_1000424332 394
360 3300013102 Ga0157371_10000034 Ga0157371_1000003417 394
361 3300013104 Ga0157370_10005022 Ga0157370_1000502210 394
362 3300013104 Ga0157370_10041380 Ga0157370_100413804 394
363 3300013105 Ga0157369_10000002 Ga0157369_10000002274 394
364 3300014326 Ga0157380_10003155 Ga0157380_100031554 394
365 3300014497 Ga0182008_10001182 Ga0182008_100011827 394
366 3300015261 Ga0182006_1002866 Ga0182006_10028668 394
367 3300015261 Ga0182006_1007137 Ga0182006_10071373 394
368 3300015262 Ga0182007_10000001 Ga0182007_10000001497 394
369 3300017792 Ga0163161_10000211 Ga0163161_1000021141 394
370 3300017792 Ga0163161_10050652 Ga0163161_100506522 394
371 3300017792 Ga0163161_10168897 Ga0163161_101688972 394
372 3300025245 Ga0207425_1000007 Ga0207425_1000007536 394
373 3300025258 Ga0209129_1000006 Ga0209129_1000006536 394
374 3300025292 Ga0209676_1000001 Ga0209676_1000001993 394
375 3300025294 Ga0209025_1000025 Ga0209025_1000025366 394
376 3300025297 Ga0209758_1000016 Ga0209758_1000016536 394
377 3300025298 Ga0209050_1000018 Ga0209050_1000018590 394
378 3300025893 Ga0207682_10013735 Ga0207682_100137352 394
379 3300025937 Ga0207669_10086196 Ga0207669_100861963 394
380 3300025940 Ga0207691_10008921 Ga0207691_100089212 394
381 3300031731 Ga0307405_10000046 Ga0307405_1000004638 394
382 3300031903 Ga0307407_10000090 Ga0307407_1000009027 394
383 3300032002 Ga0307416_100000195 Ga0307416_10000019526 394
384 3300032004 Ga0307414_10009803 Ga0307414_100098031 394
385 3300044658 Ga0466972_0034033 Ga0466972_0034033_50_1297 394
386 3300046512 Ga0495610_0000126 Ga0495610_0000126_66318_67544 394
387 3300046512 Ga0495610_0001202 Ga0495610_0001202_3781_5007 394
388 3300046543 Ga0495645_0104623 Ga0495645_0104623_58_1302 394
389 3300053131 Ga0500652_029285 Ga0500652_029285_498_1745 394
390 iso_pu_bacteria 2884791551 2884792179 394
391 iso_pu_bacteria 2954016120 2954017669 394
392 3300003322 rootL2_10199986 rootL2_101999862 395
393 3300003323 rootH1_10017466 rootH1_100174668 395
394 3300003323 rootH1_10130006 rootH1_101300061 395
395 3300005290 Ga0065712_10068639 Ga0065712_100686393 395
396 3300005327 Ga0070658_10041235 Ga0070658_100412352 395
397 3300005334 Ga0068869_100011744 Ga0068869_1000117441 395
398 3300005335 Ga0070666_10051554 Ga0070666_100515542 395
399 3300005337 Ga0070682_100022879 Ga0070682_1000228791 395
400 3300005338 Ga0068868_100016722 Ga0068868_1000167224 395
401 3300005338 Ga0068868_100087435 Ga0068868_1000874351 395
402 3300005340 Ga0070689_100009137 Ga0070689_1000091373 395
403 3300005340 Ga0070689_100096827 Ga0070689_1000968272 395
404 3300005353 Ga0070669_100071498 Ga0070669_1000714984 395
405 3300005355 Ga0070671_100092983 Ga0070671_1000929832 395
406 3300005356 Ga0070674_100039861 Ga0070674_1000398612 395
407 3300005364 Ga0070673_100008358 Ga0070673_1000083582 395
408 3300005365 Ga0070688_100045510 Ga0070688_1000455103 395
409 3300005367 Ga0070667_100094369 Ga0070667_1000943691 395
410 3300005367 Ga0070667_100298045 Ga0070667_1002980451 395
411 3300005457 Ga0070662_100003980 Ga0070662_1000039808 395
412 3300005458 Ga0070681_10239951 Ga0070681_102399511 395
413 3300005471 Ga0070698_100002515 Ga0070698_10000251513 395
414 3300005471 Ga0070698_100031496 Ga0070698_1000314965 395
415 3300005530 Ga0070679_100007239 Ga0070679_1000072396 395
416 3300005535 Ga0070684_100110113 Ga0070684_1001101132 395
417 3300005539 Ga0068853_100236425 Ga0068853_1002364251 395
418 3300005543 Ga0070672_100049454 Ga0070672_1000494542 395
419 3300005544 Ga0070686_100041752 Ga0070686_1000417522 395
420 3300005563 Ga0068855_100055515 Ga0068855_1000555154 395
421 3300005564 Ga0070664_100123732 Ga0070664_1001237322 395
422 3300005578 Ga0068854_100060579 Ga0068854_1000605792 395
423 3300005614 Ga0068856_100179103 Ga0068856_1001791032 395
424 3300005615 Ga0070702_100023985 Ga0070702_1000239852 395
425 3300005616 Ga0068852_100245043 Ga0068852_1002450432 395
426 3300005616 Ga0068852_100254484 Ga0068852_1002544842 395
427 3300005617 Ga0068859_100164564 Ga0068859_1001645643 395
428 3300005618 Ga0068864_100034638 Ga0068864_1000346382 395
429 3300005618 Ga0068864_100071444 Ga0068864_1000714441 395
430 3300005840 Ga0068870_10041453 Ga0068870_100414532 395
431 3300005841 Ga0068863_100006635 Ga0068863_1000066354 395
432 3300005841 Ga0068863_100201156 Ga0068863_1002011562 395
433 3300005842 Ga0068858_100007207 Ga0068858_1000072072 395
434 3300005842 Ga0068858_100049209 Ga0068858_1000492094 395
435 3300005843 Ga0068860_100000006 Ga0068860_100000006164 395
436 3300005843 Ga0068860_100253374 Ga0068860_1002533742 395
437 3300006237 Ga0097621_100018963 Ga0097621_1000189632 395
438 3300006358 Ga0068871_100005849 Ga0068871_1000058493 395
439 3300006844 Ga0075428_100114859 Ga0075428_1001148591 395
440 3300006931 Ga0097620_100164574 Ga0097620_1001645743 395
441 3300009093 Ga0105240_10341074 Ga0105240_103410742 395
442 3300009094 Ga0111539_10113724 Ga0111539_101137242 395
443 3300009101 Ga0105247_10144844 Ga0105247_101448441 395
444 3300009147 Ga0114129_10001620 Ga0114129_1000162022 395
445 3300009176 Ga0105242_10003733 Ga0105242_1000373311 395
446 3300009553 Ga0105249_10002189 Ga0105249_100021895 395
447 3300010375 Ga0105239_10001542 Ga0105239_100015425 395
448 3300010375 Ga0105239_10303232 Ga0105239_103032322 395
449 3300013102 Ga0157371_10030206 Ga0157371_100302063 395
450 3300013105 Ga0157369_10231869 Ga0157369_102318692 395
451 3300013296 Ga0157374_10025460 Ga0157374_100254603 395
452 3300013296 Ga0157374_10031820 Ga0157374_100318204 395
453 3300013296 Ga0157374_10044387 Ga0157374_100443872 395
454 3300013297 Ga0157378_10008896 Ga0157378_100088969 395
455 3300013306 Ga0163162_10007669 Ga0163162_100076692 395
456 3300013306 Ga0163162_10008130 Ga0163162_1000813011 395
457 3300013306 Ga0163162_10015845 Ga0163162_100158452 395
458 3300013306 Ga0163162_10034877 Ga0163162_100348773 395
459 3300013306 Ga0163162_10102877 Ga0163162_101028772 395
460 3300013306 Ga0163162_10237684 Ga0163162_102376842 395
461 3300013308 Ga0157375_10020378 Ga0157375_100203785 395
462 3300013308 Ga0157375_10022052 Ga0157375_100220525 395
463 3300013308 Ga0157375_10309962 Ga0157375_103099621 395
464 3300014325 Ga0163163_10246080 Ga0163163_102460801 395
465 3300014325 Ga0163163_10265685 Ga0163163_102656851 395
466 3300014968 Ga0157379_10004450 Ga0157379_100044502 395
467 3300014968 Ga0157379_10237990 Ga0157379_102379901 395
468 3300014969 Ga0157376_10010426 Ga0157376_100104262 395
469 3300014969 Ga0157376_10015535 Ga0157376_100155355 395
470 3300025903 Ga0207680_10013412 Ga0207680_100134122 395
471 3300025907 Ga0207645_10057655 Ga0207645_100576552 395
472 3300025908 Ga0207643_10055016 Ga0207643_100550162 395
473 3300025912 Ga0207707_10182642 Ga0207707_101826421 395
474 3300025919 Ga0207657_10160617 Ga0207657_101606172 395
475 3300025921 Ga0207652_10028657 Ga0207652_100286575 395
476 3300025931 Ga0207644_10035017 Ga0207644_100350173 395
477 3300025933 Ga0207706_10015676 Ga0207706_100156765 395
478 3300025933 Ga0207706_10123944 Ga0207706_101239442 395
479 3300025934 Ga0207686_10000863 Ga0207686_100008633 395
480 3300025934 Ga0207686_10046909 Ga0207686_100469092 395
481 3300025936 Ga0207670_10002761 Ga0207670_100027617 395
482 3300025938 Ga0207704_10014800 Ga0207704_100148004 395
483 3300025940 Ga0207691_10000054 Ga0207691_100000543 395
484 3300025940 Ga0207691_10174434 Ga0207691_101744342 395
485 3300025942 Ga0207689_10070226 Ga0207689_100702263 395
486 3300025944 Ga0207661_10234528 Ga0207661_102345282 395
487 3300025945 Ga0207679_10006721 Ga0207679_100067212 395
488 3300025949 Ga0207667_10108606 Ga0207667_101086062 395
489 3300025961 Ga0207712_10035510 Ga0207712_100355103 395
490 3300025981 Ga0207640_10034946 Ga0207640_100349462 395
491 3300025986 Ga0207658_10140838 Ga0207658_101408382 395
492 3300025986 Ga0207658_10151788 Ga0207658_101517882 395
493 3300026035 Ga0207703_10175009 Ga0207703_101750092 395
494 3300026088 Ga0207641_10001211 Ga0207641_100012116 395
495 3300026088 Ga0207641_10026342 Ga0207641_100263423 395
496 3300026088 Ga0207641_10030185 Ga0207641_100301852 395
497 3300026116 Ga0207674_10068170 Ga0207674_100681702 395
498 3300026118 Ga0207675_100032380 Ga0207675_1000323805 395
499 3300026118 Ga0207675_100231392 Ga0207675_1002313921 395
500 3300028380 Ga0268265_10291035 Ga0268265_102910351 395
501 3300028381 Ga0268264_10191918 Ga0268264_101919182 395
502 3300028794 Ga0307515_10000057 Ga0307515_10000057177 395
503 3300032002 Ga0307416_100010171 Ga0307416_1000101712 395
504 3300036401 Ga0373937_0012356 Ga0373937_0012356_1274_2524 395
505 3300037471 Ga0395905_0031915 Ga0395905_0031915_2175_3425 395
506 3300041404 Ga0439436_0016608 Ga0439436_0016608_736_1989 395
507 3300042014 Ga0439457_004080 Ga0439457_004080_463_1716 395
508 3300042015 Ga0439462_0012917 Ga0439462_0012917_717_1970 395
509 3300046460 Ga0495638_0024220 Ga0495638_0024220_1435_2706 395
510 3300046517 Ga0495630_0009510 Ga0495630_0009510_4816_6066 395
511 3300046524 Ga0495648_0005321 Ga0495648_0005321_8517_9788 395
512 3300046559 Ga0495667_0112760 Ga0495667_0112760_393_1643 395
513 3300046691 Ga0495670_0081915 Ga0495670_0081915_68_1318 395
514 3300047322 Ga0495680_0058894 Ga0495680_0058894_1609_2859 395
515 3300047443 Ga0495687_000158 Ga0495687_000158_40697_41968 395
516 3300047471 Ga0495684_0011350 Ga0495684_0011350_4204_5454 395
517 3300048927 Ga0496124_0093506 Ga0496124_0093506_342_1592 395
518 3300049705 Ga0501225_0012071 Ga0501225_0012071_71_1312 395
519 3300050507 nmdc:mga05p37_1143_c1 nmdc:mga05p37_1143_c1_22230_23480 395
520 3300053077 Ga0495601_0076946 Ga0495601_0076946_498_1748 395
521 3300053085 Ga0495619_0008622 Ga0495619_0008622_50_1300 395
522 3300053088 Ga0500644_0047555 Ga0500644_0047555_181_1431 395
523 3300053092 Ga0500583_0030984 Ga0500583_0030984_375_1649 395
524 3300053104 Ga0500556_0027690 Ga0500556_0027690_315_1565 395
525 3300053139 Ga0500568_0010981 Ga0500568_0010981_1398_2648 395
526 3300053146 Ga0500588_0007664 Ga0500588_0007664_1049_2299 395
527 3300053156 Ga0500622_0007338 Ga0500622_0007338_4231_5481 395
528 3300053163 Ga0500639_061448 Ga0500639_061448_365_1615 395
529 3300001979 JGI24740J21852_10000655 JGI24740J21852_1000065513 398
530 3300010375 Ga0105239_10235504 Ga0105239_102355042 398
531 3300049823 Ga0501044_0354940 Ga0501044_0354940_117_1361 398

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

47

232

0.91

PF07690

MFS_1

Major Facilitator Superfamily

57

402

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zow-assembly1.cif.gz_A crystal structure of e. coli multidrug transporter mdfa in complex with chloramphenicol 0.92 1 378
6euq-assembly1.cif.gz_A mdfa(q131r/l339e) 0.9141 8 379
6oom-assembly2.cif.gz_A-2 protein a 0.9128 1 379
6vs2-assembly1.cif.gz_A protein d 0.912 8 378
4zow-assembly1.cif.gz_A crystal structure of e. coli multidrug transporter mdfa in complex with chloramphenicol 0.8889 1 378
ID Description Score Start End Superfamily
af_P28246_11_389_1.20.1720.10 Mainly Alpha;Up-down Bundle;Multidrug resistance protein D;Multidrug resistance protein D 0.9229 10 376 1.20.1720.10
af_Q2G2I3_14_312_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9226 10 289 1.20.1250.20
af_P0AEY8_20_398_1.20.1720.10 Mainly Alpha;Up-down Bundle;Multidrug resistance protein D;Multidrug resistance protein D 0.92 12 377 1.20.1720.10
af_Q2FVI5_15_392_1.20.1720.10 Mainly Alpha;Up-down Bundle;Multidrug resistance protein D;Multidrug resistance protein D 0.9057 10 376 1.20.1720.10
af_P39386_16_393_1.20.1720.10 Mainly Alpha;Up-down Bundle;Multidrug resistance protein D;Multidrug resistance protein D 0.8989 12 376 1.20.1720.10
ID Description Score Start End GO Terms
AF-A0A0D6MMG2-F1-model_v4 Bcr/CflA family efflux transporter 0.9401 9 376 GO:0005886
GO:0015385
GO:0042910
GO:1990961
AF-A0A2X2BHJ7-F1-model_v4 Bicyclomycin/multidrug efflux system protein 0.9359 189 380 GO:0016020
GO:0022857
AF-A0A0F4QNK6-F1-model_v4 Bcr/CflA family efflux transporter 0.9331 1 389 GO:0005886
GO:0042910
GO:1990961
AF-A0A4Q0T5Q1-F1-model_v4 Multidrug resistance transporter, Bcr/CflA family 0.9328 1 380 GO:0005886
GO:0042910
GO:1990961
AF-D5ULA8-F1-model_v4 Drug resistance transporter, Bcr/CflA subfamily 0.9246 10 378 GO:0005886
GO:0042910
GO:1990961

Feature Viewer

pLDDT pTM Quality
85.55 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map