F460065
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 531 | 299 | 526 | 268 |
Family's Representative Sequence
| Representative Sequence | 3300003791|Ga0055530_10000020|Ga0055530_1000002074 |
| Length | 303 |
| Sequence | MSVSQAAAISVALSGMPTAQTPPLGAEIMQMDEDFMPEPVNPQGGDIVRRHRLPTRLWHWTNALSVIVMLMSGLMIFNAHPRLYWGKYGANPDHSWLAITPGHLHVGSIVIATPGLLGVTPAGGREVAFPPLVTIPSHYDLAGAREWHLAFAWLLVVPGVLFWLWGFARRHFSRDLAPHRAELSPRHLWDDIKAHARLRFPKGPAAARYNILQKLAYCSVIFVLLPGIILTGLTMSPGMDAAWPWLPAVFAGRQSARSIHFLCAMGLAAFIVVHLIMVVLAGPINEIRSMVTGRYRLPEEKES |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 2 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 3 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 4 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 5 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 6 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 7 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 11 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 87 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 88 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 89 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 90 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 94 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 95 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 96 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 99 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 100 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 135 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 199 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 200 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 202 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 203 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 204 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 209 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 210 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 211 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 212 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 213 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 214 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 215 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 216 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 217 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 218 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 219 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 220 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 221 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 222 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 223 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 224 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 225 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 226 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 227 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 228 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 234 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 235 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 236 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 237 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 238 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 239 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 241 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 242 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 243 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 244 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 245 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 246 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 247 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 248 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 249 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 250 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 251 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 252 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 253 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 254 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 255 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 256 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 282 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 283 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 284 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 285 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 286 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 294 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 295 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 296 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 297 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.68 |
| Metatranscriptomes | 0.38 |
| Isolates | 0.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.46 |
| Nodule | 0 |
| Rhizoplane | 4.14 |
| Rhizosphere | 84.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1014123 | 3300001904 | Bacteria | 1286 |
| 2 | JGI24740J21852_10059448 | 3300001979 | Bacteria | 1059 |
| 3 | JGI24739J22299_10004810 | 3300001989 | Bacteria | 5149 |
| 4 | JGI24739J22299_10023874 | 3300001989 | Bacteria | 2158 |
| 5 | JGI24739J22299_10065670 | 3300001989 | Bacteria | 1137 |
| 6 | JGI24739J22299_10085331 | 3300001989 | Bacteria | 966 |
| 7 | JGI24737J22298_10001866 | 3300001990 | Bacteria | 7531 |
| 8 | JGI24737J22298_10019416 | 3300001990 | Bacteria | 2173 |
| 9 | JGI24743J22301_10027664 | 3300001991 | Bacteria | 1107 |
| 10 | JGI24735J21928_10001761 | 3300002067 | Bacteria | 7614 |
| 11 | JGI24735J21928_10006888 | 3300002067 | Bacteria | 3721 |
| 12 | JGI24735J21928_10033129 | 3300002067 | Bacteria | 1527 |
| 13 | JGI24735J21928_10043054 | 3300002067 | Bacteria | 1314 |
| 14 | JGI24738J21930_10001232 | 3300002075 | Bacteria | 7193 |
| 15 | JGI24738J21930_10005382 | 3300002075 | Bacteria | 3070 |
| 16 | JGI24738J21930_10005787 | 3300002075 | Bacteria | 2938 |
| 17 | JGI24738J21930_10008922 | 3300002075 | Bacteria | 2271 |
| 18 | JGI24751J29686_10003616 | 3300002459 | Bacteria | 3116 |
| 19 | JGI25165J46597_1000120 | 3300003214 | Bacteria | 136275 |
| 20 | rootH1_10024748 | 3300003316 | Bacteria | 7794 |
| 21 | rootH2_10180706 | 3300003320 | Bacteria | 1791 |
| 22 | rootH1_10022509 | 3300003323 | Bacteria | 3130 |
| 23 | Ga0055542_1005275 | 3300003762 | Bacteria | 2949 |
| 24 | Ga0055530_10000020 | 3300003791 | Bacteria | 139957 |
| 25 | Ga0055531_10000184 | 3300003794 | Bacteria | 69676 |
| 26 | Ga0070658_10000624 | 3300005327 | Bacteria | 30563 |
| 27 | Ga0070658_10010382 | 3300005327 | Bacteria | 7468 |
| 28 | Ga0070658_10014437 | 3300005327 | Bacteria | 6339 |
| 29 | Ga0070658_10061105 | 3300005327 | Bacteria | 3069 |
| 30 | Ga0070658_10137302 | 3300005327 | Bacteria | 2041 |
| 31 | Ga0070658_10140243 | 3300005327 | Bacteria | 2019 |
| 32 | Ga0070676_10005613 | 3300005328 | Bacteria | 6686 |
| 33 | Ga0070676_10039924 | 3300005328 | Bacteria | 2716 |
| 34 | Ga0070690_100001067 | 3300005330 | Bacteria | 14061 |
| 35 | Ga0070670_100001783 | 3300005331 | Bacteria | 17520 |
| 36 | Ga0068869_100000110 | 3300005334 | Bacteria | 39194 |
| 37 | Ga0070666_10012602 | 3300005335 | Bacteria | 5340 |
| 38 | Ga0070666_10020283 | 3300005335 | Bacteria | 4296 |
| 39 | Ga0070680_100012070 | 3300005336 | Bacteria | 6707 |
| 40 | Ga0068868_100000016 | 3300005338 | Bacteria | 102357 |
| 41 | Ga0068868_100051291 | 3300005338 | Bacteria | 3244 |
| 42 | Ga0070660_100000103 | 3300005339 | Bacteria | 52286 |
| 43 | Ga0070660_100000383 | 3300005339 | Bacteria | 29464 |
| 44 | Ga0070660_100018381 | 3300005339 | Bacteria | 5108 |
| 45 | Ga0070660_100416669 | 3300005339 | Bacteria | 1112 |
| 46 | Ga0070689_100014910 | 3300005340 | Bacteria | 5656 |
| 47 | Ga0070689_100020680 | 3300005340 | Bacteria | 4886 |
| 48 | Ga0070691_10002311 | 3300005341 | Bacteria | 8447 |
| 49 | Ga0070687_100000686 | 3300005343 | Bacteria | 11295 |
| 50 | Ga0070661_100024378 | 3300005344 | Bacteria | 4339 |
| 51 | Ga0070692_10017503 | 3300005345 | Bacteria | 3427 |
| 52 | Ga0070668_100009171 | 3300005347 | Bacteria | 7339 |
| 53 | Ga0070669_100001148 | 3300005353 | Bacteria | 19338 |
| 54 | Ga0070669_100554667 | 3300005353 | Bacteria | 958 |
| 55 | Ga0070675_100001202 | 3300005354 | Bacteria | 18818 |
| 56 | Ga0070675_100124054 | 3300005354 | Bacteria | 2196 |
| 57 | Ga0070675_100266571 | 3300005354 | Bacteria | 1502 |
| 58 | Ga0070671_100001262 | 3300005355 | Bacteria | 18969 |
| 59 | Ga0070671_100003296 | 3300005355 | Bacteria | 12597 |
| 60 | Ga0070671_100021924 | 3300005355 | Bacteria | 5218 |
| 61 | Ga0070671_100450710 | 3300005355 | Bacteria | 1104 |
| 62 | Ga0070674_100005431 | 3300005356 | Bacteria | 7363 |
| 63 | Ga0070674_100216712 | 3300005356 | Bacteria | 1487 |
| 64 | Ga0070673_100000017 | 3300005364 | Bacteria | 112829 |
| 65 | Ga0070673_100000673 | 3300005364 | Bacteria | 18823 |
| 66 | Ga0070673_100518509 | 3300005364 | Bacteria | 1080 |
| 67 | Ga0070688_100005651 | 3300005365 | Bacteria | 6601 |
| 68 | Ga0070659_100005781 | 3300005366 | Bacteria | 8905 |
| 69 | Ga0070659_100355476 | 3300005366 | Bacteria | 1230 |
| 70 | Ga0070659_100561206 | 3300005366 | Bacteria | 978 |
| 71 | Ga0070667_100001801 | 3300005367 | Bacteria | 19071 |
| 72 | Ga0070667_100177525 | 3300005367 | Bacteria | 1882 |
| 73 | Ga0070703_10057015 | 3300005406 | Bacteria | 1267 |
| 74 | Ga0070709_10000225 | 3300005434 | Bacteria | 36698 |
| 75 | Ga0070714_100153766 | 3300005435 | Bacteria | 2075 |
| 76 | Ga0070713_100180342 | 3300005436 | Bacteria | 1897 |
| 77 | Ga0070710_10004828 | 3300005437 | Bacteria | 6375 |
| 78 | Ga0070701_10000713 | 3300005438 | Bacteria | 11773 |
| 79 | Ga0070701_10356714 | 3300005438 | Bacteria | 915 |
| 80 | Ga0070711_100000237 | 3300005439 | Bacteria | 28263 |
| 81 | Ga0070711_100020012 | 3300005439 | Bacteria | 4306 |
| 82 | Ga0070705_100002200 | 3300005440 | Bacteria | 9894 |
| 83 | Ga0070700_100009880 | 3300005441 | Bacteria | 5249 |
| 84 | Ga0070694_100015896 | 3300005444 | Bacteria | 4736 |
| 85 | Ga0070663_100000497 | 3300005455 | Bacteria | 20743 |
| 86 | Ga0070663_100002166 | 3300005455 | Bacteria | 10982 |
| 87 | Ga0070678_100003959 | 3300005456 | Bacteria | 8327 |
| 88 | Ga0070678_100233334 | 3300005456 | Bacteria | 1535 |
| 89 | Ga0070662_100004743 | 3300005457 | Bacteria | 8616 |
| 90 | Ga0068867_100000013 | 3300005459 | Bacteria | 112835 |
| 91 | Ga0068867_100022146 | 3300005459 | Bacteria | 4540 |
| 92 | Ga0068867_100029825 | 3300005459 | Bacteria | 3932 |
| 93 | Ga0070685_10163859 | 3300005466 | Bacteria | 1419 |
| 94 | Ga0070707_100657140 | 3300005468 | Bacteria | 1011 |
| 95 | Ga0070679_100437285 | 3300005530 | Bacteria | 1253 |
| 96 | Ga0070684_100118086 | 3300005535 | Bacteria | 2384 |
| 97 | Ga0070697_100004352 | 3300005536 | Bacteria | 10861 |
| 98 | Ga0068853_100001129 | 3300005539 | Bacteria | 18917 |
| 99 | Ga0068853_100008844 | 3300005539 | Bacteria | 8100 |
| 100 | Ga0070672_100008366 | 3300005543 | Bacteria | 7072 |
| 101 | Ga0070672_100082847 | 3300005543 | Bacteria | 2574 |
| 102 | Ga0070686_100000710 | 3300005544 | Bacteria | 19361 |
| 103 | Ga0070686_100042171 | 3300005544 | Bacteria | 2857 |
| 104 | Ga0070695_100004563 | 3300005545 | Bacteria | 8129 |
| 105 | Ga0070693_100006067 | 3300005547 | Bacteria | 5850 |
| 106 | Ga0070665_100060047 | 3300005548 | Bacteria | 3811 |
| 107 | Ga0070665_100076966 | 3300005548 | Bacteria | 3342 |
| 108 | Ga0070665_100142799 | 3300005548 | Bacteria | 2397 |
| 109 | Ga0070665_100537097 | 3300005548 | Bacteria | 1181 |
| 110 | Ga0070704_100150630 | 3300005549 | Bacteria | 1828 |
| 111 | Ga0068855_100000911 | 3300005563 | Bacteria | 36718 |
| 112 | Ga0068855_100019337 | 3300005563 | Bacteria | 8184 |
| 113 | Ga0068855_100826492 | 3300005563 | Bacteria | 983 |
| 114 | Ga0070664_100005810 | 3300005564 | Bacteria | 9952 |
| 115 | Ga0070664_100377769 | 3300005564 | Bacteria | 1293 |
| 116 | Ga0068857_100002722 | 3300005577 | Bacteria | 14509 |
| 117 | Ga0068857_100005194 | 3300005577 | Bacteria | 11079 |
| 118 | Ga0068857_100018172 | 3300005577 | Bacteria | 6168 |
| 119 | Ga0068854_100000389 | 3300005578 | Bacteria | 27589 |
| 120 | Ga0068854_100000411 | 3300005578 | Bacteria | 26860 |
| 121 | Ga0068854_100016181 | 3300005578 | Bacteria | 4965 |
| 122 | Ga0068854_100040544 | 3300005578 | Bacteria | 3286 |
| 123 | Ga0068854_100066331 | 3300005578 | Bacteria | 2627 |
| 124 | Ga0068856_100004302 | 3300005614 | Bacteria | 14214 |
| 125 | Ga0068856_100184065 | 3300005614 | Bacteria | 2102 |
| 126 | Ga0070702_100000088 | 3300005615 | Bacteria | 27195 |
| 127 | Ga0068852_100001585 | 3300005616 | Bacteria | 15462 |
| 128 | Ga0068852_100006411 | 3300005616 | Bacteria | 8502 |
| 129 | Ga0068859_100001433 | 3300005617 | Bacteria | 24186 |
| 130 | Ga0068859_100002269 | 3300005617 | Bacteria | 19505 |
| 131 | Ga0068864_100003629 | 3300005618 | Bacteria | 12763 |
| 132 | Ga0068866_10003168 | 3300005718 | Bacteria | 6770 |
| 133 | Ga0068866_10032063 | 3300005718 | Bacteria | 2537 |
| 134 | Ga0068861_100000952 | 3300005719 | Bacteria | 17599 |
| 135 | Ga0068851_10125032 | 3300005834 | Bacteria | 1386 |
| 136 | Ga0068863_100005989 | 3300005841 | Bacteria | 11923 |
| 137 | Ga0068858_100002072 | 3300005842 | Bacteria | 20404 |
| 138 | Ga0068858_100156193 | 3300005842 | Bacteria | 2146 |
| 139 | Ga0068860_100003105 | 3300005843 | Bacteria | 17168 |
| 140 | Ga0068860_100003367 | 3300005843 | Bacteria | 16456 |
| 141 | Ga0068862_100007091 | 3300005844 | Bacteria | 9308 |
| 142 | Ga0081455_10002340 | 3300005937 | Bacteria | 22617 |
| 143 | Ga0075363_100000317 | 3300006048 | Bacteria | 14291 |
| 144 | Ga0075364_10258777 | 3300006051 | Bacteria | 1183 |
| 145 | Ga0075432_10002338 | 3300006058 | Bacteria | 6316 |
| 146 | Ga0070715_10000291 | 3300006163 | Bacteria | 12275 |
| 147 | Ga0070716_100004593 | 3300006173 | Bacteria | 6620 |
| 148 | Ga0070712_100017594 | 3300006175 | Bacteria | 4629 |
| 149 | Ga0070712_100421939 | 3300006175 | Bacteria | 1106 |
| 150 | Ga0075362_10000030 | 3300006177 | Bacteria | 56135 |
| 151 | Ga0075367_10264361 | 3300006178 | Bacteria | 1080 |
| 152 | Ga0075369_10016674 | 3300006186 | Bacteria | 2968 |
| 153 | Ga0075366_10000025 | 3300006195 | Bacteria | 51813 |
| 154 | Ga0075366_10086458 | 3300006195 | Bacteria | 1876 |
| 155 | Ga0097621_100004755 | 3300006237 | Bacteria | 9496 |
| 156 | Ga0097621_100075501 | 3300006237 | Bacteria | 2794 |
| 157 | Ga0097621_100396944 | 3300006237 | Bacteria | 1234 |
| 158 | Ga0075370_10000178 | 3300006353 | Bacteria | 22055 |
| 159 | Ga0068871_100004770 | 3300006358 | Bacteria | 9480 |
| 160 | Ga0068871_100261337 | 3300006358 | Bacteria | 1510 |
| 161 | Ga0075428_100179302 | 3300006844 | Bacteria | 2293 |
| 162 | Ga0075428_100280105 | 3300006844 | Bacteria | 1794 |
| 163 | Ga0075431_100063494 | 3300006847 | Bacteria | 3811 |
| 164 | Ga0075431_100083929 | 3300006847 | Bacteria | 3289 |
| 165 | Ga0068865_100000007 | 3300006881 | Bacteria | 185316 |
| 166 | Ga0068865_100000212 | 3300006881 | Bacteria | 32489 |
| 167 | Ga0068865_100051030 | 3300006881 | Bacteria | 2861 |
| 168 | Ga0097620_100001433 | 3300006931 | Bacteria | 24186 |
| 169 | Ga0097620_100002269 | 3300006931 | Bacteria | 19505 |
| 170 | Ga0075435_100066788 | 3300007076 | Bacteria | 2927 |
| 171 | Ga0105250_10004734 | 3300009092 | Bacteria | 6211 |
| 172 | Ga0105240_10032421 | 3300009093 | Bacteria | 6764 |
| 173 | Ga0105240_10035796 | 3300009093 | Bacteria | 6393 |
| 174 | Ga0105240_10325602 | 3300009093 | Bacteria | 1750 |
| 175 | Ga0105245_10001075 | 3300009098 | Bacteria | 24755 |
| 176 | Ga0105245_10005204 | 3300009098 | Bacteria | 11423 |
| 177 | Ga0105247_10000179 | 3300009101 | Bacteria | 61933 |
| 178 | Ga0105247_10000925 | 3300009101 | Bacteria | 22094 |
| 179 | Ga0105247_10004422 | 3300009101 | Bacteria | 8970 |
| 180 | Ga0105243_10000055 | 3300009148 | Bacteria | 136180 |
| 181 | Ga0105243_10000118 | 3300009148 | Bacteria | 91438 |
| 182 | Ga0105243_10000944 | 3300009148 | Bacteria | 27244 |
| 183 | Ga0105243_10076635 | 3300009148 | Bacteria | 2718 |
| 184 | Ga0105243_10310985 | 3300009148 | Unclassified | 1432 |
| 185 | Ga0105243_10318505 | 3300009148 | Bacteria | 1416 |
| 186 | Ga0105241_10002673 | 3300009174 | Bacteria | 13358 |
| 187 | Ga0105242_10000221 | 3300009176 | Bacteria | 44918 |
| 188 | Ga0105242_10010551 | 3300009176 | Bacteria | 7093 |
| 189 | Ga0105242_10244331 | 3300009176 | Bacteria | 1615 |
| 190 | Ga0105248_10014164 | 3300009177 | Bacteria | 8779 |
| 191 | Ga0105248_10016652 | 3300009177 | Bacteria | 8092 |
| 192 | Ga0105248_10061651 | 3300009177 | Bacteria | 4212 |
| 193 | Ga0105237_10013453 | 3300009545 | Bacteria | 8580 |
| 194 | Ga0105237_10018843 | 3300009545 | Bacteria | 7138 |
| 195 | Ga0105237_10035271 | 3300009545 | Bacteria | 5062 |
| 196 | Ga0105237_10527021 | 3300009545 | Bacteria | 1188 |
| 197 | Ga0105238_10024390 | 3300009551 | Bacteria | 6165 |
| 198 | Ga0105238_10276667 | 3300009551 | Bacteria | 1659 |
| 199 | Ga0105238_10798593 | 3300009551 | Bacteria | 959 |
| 200 | Ga0105249_10001629 | 3300009553 | Bacteria | 19666 |
| 201 | Ga0105249_10012545 | 3300009553 | Bacteria | 7468 |
| 202 | Ga0105249_10038859 | 3300009553 | Bacteria | 4319 |
| 203 | Ga0105239_10000061 | 3300010375 | Bacteria | 154661 |
| 204 | Ga0105239_10002915 | 3300010375 | Bacteria | 21370 |
| 205 | Ga0105239_10014039 | 3300010375 | Bacteria | 8892 |
| 206 | Ga0105239_10152467 | 3300010375 | Bacteria | 2579 |
| 207 | Ga0105239_10595364 | 3300010375 | Bacteria | 1261 |
| 208 | Ga0105246_10000135 | 3300011119 | Bacteria | 34300 |
| 209 | Ga0157373_10005027 | 3300013100 | Bacteria | 9934 |
| 210 | Ga0157373_10309433 | 3300013100 | Bacteria | 1122 |
| 211 | Ga0157371_10003718 | 3300013102 | Bacteria | 13677 |
| 212 | Ga0157371_10028109 | 3300013102 | Bacteria | 4074 |
| 213 | Ga0157370_10000034 | 3300013104 | Bacteria | 137749 |
| 214 | Ga0157370_10003964 | 3300013104 | Bacteria | 17217 |
| 215 | Ga0157370_10089043 | 3300013104 | Bacteria | 2899 |
| 216 | Ga0157370_10215493 | 3300013104 | Bacteria | 1779 |
| 217 | Ga0157369_10011006 | 3300013105 | Bacteria | 10295 |
| 218 | Ga0157369_10063218 | 3300013105 | Bacteria | 3988 |
| 219 | Ga0157369_10196415 | 3300013105 | Bacteria | 2119 |
| 220 | Ga0157369_10689282 | 3300013105 | Bacteria | 1052 |
| 221 | Ga0157374_10000189 | 3300013296 | Bacteria | 57356 |
| 222 | Ga0157378_10003688 | 3300013297 | Bacteria | 13578 |
| 223 | Ga0157378_10020157 | 3300013297 | Bacteria | 5864 |
| 224 | Ga0163162_10021988 | 3300013306 | Bacteria | 6284 |
| 225 | Ga0163162_10083703 | 3300013306 | Bacteria | 3264 |
| 226 | Ga0163162_10154764 | 3300013306 | Bacteria | 2412 |
| 227 | Ga0157372_10010820 | 3300013307 | Bacteria | 9712 |
| 228 | Ga0157372_10115937 | 3300013307 | Bacteria | 3071 |
| 229 | Ga0157372_10124262 | 3300013307 | Bacteria | 2966 |
| 230 | Ga0157372_10387544 | 3300013307 | Bacteria | 1628 |
| 231 | Ga0157375_10000436 | 3300013308 | Bacteria | 37738 |
| 232 | Ga0157375_10019727 | 3300013308 | Bacteria | 6141 |
| 233 | Ga0157375_10047224 | 3300013308 | Bacteria | 4203 |
| 234 | Ga0163163_10004874 | 3300014325 | Bacteria | 11536 |
| 235 | Ga0163163_10009991 | 3300014325 | Bacteria | 8510 |
| 236 | Ga0157380_10051629 | 3300014326 | Bacteria | 3253 |
| 237 | Ga0157380_10622613 | 3300014326 | Bacteria | 1072 |
| 238 | Ga0157379_10008925 | 3300014968 | Bacteria | 8742 |
| 239 | Ga0157379_10019100 | 3300014968 | Bacteria | 6052 |
| 240 | Ga0157376_10000081 | 3300014969 | Bacteria | 72584 |
| 241 | Ga0157376_10001406 | 3300014969 | Bacteria | 15824 |
| 242 | Ga0157376_10088766 | 3300014969 | Bacteria | 2672 |
| 243 | Ga0157376_10314511 | 3300014969 | Bacteria | 1487 |
| 244 | Ga0163161_10006732 | 3300017792 | Bacteria | 7945 |
| 245 | Ga0206350_10761787 | 3300020080 | Bacteria | 1671 |
| 246 | Ga0206353_11192685 | 3300020082 | Bacteria | 946 |
| 247 | Ga0213876_10135459 | 3300021384 | Bacteria | 1310 |
| 248 | Ga0207427_105219 | 3300025231 | Bacteria | 1893 |
| 249 | Ga0209148_1000074 | 3300025254 | Bacteria | 314356 |
| 250 | Ga0209148_1000870 | 3300025254 | Bacteria | 21040 |
| 251 | Ga0209233_1000003 | 3300025261 | Bacteria | 1607366 |
| 252 | Ga0209455_1000386 | 3300025272 | Bacteria | 39294 |
| 253 | Ga0209050_1000186 | 3300025298 | Bacteria | 139998 |
| 254 | Ga0209257_1000211 | 3300025304 | Bacteria | 139998 |
| 255 | Ga0207692_10006907 | 3300025898 | Bacteria | 4626 |
| 256 | Ga0207642_10088722 | 3300025899 | Bacteria | 1522 |
| 257 | Ga0207710_10000331 | 3300025900 | Bacteria | 35720 |
| 258 | Ga0207710_10006074 | 3300025900 | Bacteria | 5174 |
| 259 | Ga0207688_10000228 | 3300025901 | Bacteria | 25406 |
| 260 | Ga0207680_10026359 | 3300025903 | Bacteria | 3221 |
| 261 | Ga0207647_10007853 | 3300025904 | Bacteria | 7675 |
| 262 | Ga0207647_10008621 | 3300025904 | Bacteria | 7293 |
| 263 | Ga0207647_10024669 | 3300025904 | Bacteria | 3963 |
| 264 | Ga0207647_10104890 | 3300025904 | Bacteria | 1675 |
| 265 | Ga0207699_10011962 | 3300025906 | Bacteria | 4400 |
| 266 | Ga0207645_10002366 | 3300025907 | Bacteria | 14873 |
| 267 | Ga0207645_10037958 | 3300025907 | Bacteria | 3091 |
| 268 | Ga0207705_10000110 | 3300025909 | Bacteria | 92932 |
| 269 | Ga0207705_10000651 | 3300025909 | Bacteria | 28902 |
| 270 | Ga0207705_10002530 | 3300025909 | Bacteria | 14084 |
| 271 | Ga0207705_10116461 | 3300025909 | Bacteria | 1979 |
| 272 | Ga0207705_10198584 | 3300025909 | Bacteria | 1519 |
| 273 | Ga0207654_10054904 | 3300025911 | Bacteria | 2304 |
| 274 | Ga0207695_10028291 | 3300025913 | Bacteria | 6221 |
| 275 | Ga0207671_10007239 | 3300025914 | Bacteria | 9663 |
| 276 | Ga0207671_10009949 | 3300025914 | Bacteria | 7902 |
| 277 | Ga0207671_10086897 | 3300025914 | Bacteria | 2351 |
| 278 | Ga0207671_10418867 | 3300025914 | Bacteria | 1065 |
| 279 | Ga0207693_10000892 | 3300025915 | Bacteria | 26789 |
| 280 | Ga0207663_10031899 | 3300025916 | Bacteria | 3123 |
| 281 | Ga0207663_10049466 | 3300025916 | Bacteria | 2608 |
| 282 | Ga0207663_10467532 | 3300025916 | Bacteria | 975 |
| 283 | Ga0207660_10065099 | 3300025917 | Bacteria | 2633 |
| 284 | Ga0207662_10037004 | 3300025918 | Bacteria | 2855 |
| 285 | Ga0207657_10000243 | 3300025919 | Bacteria | 57852 |
| 286 | Ga0207657_10001089 | 3300025919 | Bacteria | 28773 |
| 287 | Ga0207657_10001202 | 3300025919 | Bacteria | 27550 |
| 288 | Ga0207657_10051274 | 3300025919 | Bacteria | 3587 |
| 289 | Ga0207657_10125816 | 3300025919 | Bacteria | 2105 |
| 290 | Ga0207649_10012336 | 3300025920 | Bacteria | 4739 |
| 291 | Ga0207681_10009481 | 3300025923 | Bacteria | 5949 |
| 292 | Ga0207681_10527730 | 3300025923 | Bacteria | 969 |
| 293 | Ga0207694_10197102 | 3300025924 | Bacteria | 1637 |
| 294 | Ga0207694_10221846 | 3300025924 | Bacteria | 1542 |
| 295 | Ga0207650_10057422 | 3300025925 | Bacteria | 2894 |
| 296 | Ga0207659_10041103 | 3300025926 | Bacteria | 3237 |
| 297 | Ga0207659_10637045 | 3300025926 | Bacteria | 910 |
| 298 | Ga0207687_10008499 | 3300025927 | Bacteria | 6713 |
| 299 | Ga0207700_10353209 | 3300025928 | Bacteria | 1280 |
| 300 | Ga0207644_10087576 | 3300025931 | Bacteria | 2314 |
| 301 | Ga0207644_10277669 | 3300025931 | Bacteria | 1344 |
| 302 | Ga0207690_10010127 | 3300025932 | Bacteria | 5599 |
| 303 | Ga0207690_10245082 | 3300025932 | Bacteria | 1382 |
| 304 | Ga0207690_10270614 | 3300025932 | Bacteria | 1320 |
| 305 | Ga0207706_10001092 | 3300025933 | Bacteria | 27557 |
| 306 | Ga0207706_10013905 | 3300025933 | Bacteria | 7299 |
| 307 | Ga0207706_10048329 | 3300025933 | Bacteria | 3763 |
| 308 | Ga0207706_10163349 | 3300025933 | Bacteria | 1957 |
| 309 | Ga0207686_10000752 | 3300025934 | Bacteria | 19971 |
| 310 | Ga0207686_10004463 | 3300025934 | Bacteria | 7499 |
| 311 | Ga0207709_10000098 | 3300025935 | Bacteria | 136213 |
| 312 | Ga0207709_10000306 | 3300025935 | Bacteria | 53253 |
| 313 | Ga0207709_10058117 | 3300025935 | Bacteria | 2402 |
| 314 | Ga0207709_10196513 | 3300025935 | Unclassified | 1437 |
| 315 | Ga0207670_10023914 | 3300025936 | Bacteria | 3811 |
| 316 | Ga0207669_10008343 | 3300025937 | Bacteria | 4857 |
| 317 | Ga0207669_10184976 | 3300025937 | Bacteria | 1497 |
| 318 | Ga0207669_10290350 | 3300025937 | Bacteria | 1238 |
| 319 | Ga0207704_10000017 | 3300025938 | Bacteria | 154190 |
| 320 | Ga0207704_10009531 | 3300025938 | Bacteria | 4689 |
| 321 | Ga0207704_10034048 | 3300025938 | Bacteria | 2904 |
| 322 | Ga0207704_10522903 | 3300025938 | Bacteria | 960 |
| 323 | Ga0207665_10000425 | 3300025939 | Bacteria | 29075 |
| 324 | Ga0207691_10004113 | 3300025940 | Bacteria | 14132 |
| 325 | Ga0207691_10130816 | 3300025940 | Bacteria | 2217 |
| 326 | Ga0207711_10036601 | 3300025941 | Bacteria | 4165 |
| 327 | Ga0207711_10208831 | 3300025941 | Bacteria | 1783 |
| 328 | Ga0207689_10001243 | 3300025942 | Bacteria | 24569 |
| 329 | Ga0207689_10030460 | 3300025942 | Bacteria | 4496 |
| 330 | Ga0207667_10000016 | 3300025949 | Bacteria | 391466 |
| 331 | Ga0207667_10045930 | 3300025949 | Bacteria | 4624 |
| 332 | Ga0207651_10000011 | 3300025960 | Bacteria | 191950 |
| 333 | Ga0207651_10154178 | 3300025960 | Bacteria | 1792 |
| 334 | Ga0207651_10595373 | 3300025960 | Bacteria | 966 |
| 335 | Ga0207712_10045059 | 3300025961 | Bacteria | 3053 |
| 336 | Ga0207712_10095203 | 3300025961 | Bacteria | 2201 |
| 337 | Ga0207712_10235941 | 3300025961 | Bacteria | 1471 |
| 338 | Ga0207640_10000131 | 3300025981 | Bacteria | 56277 |
| 339 | Ga0207640_10005890 | 3300025981 | Bacteria | 6691 |
| 340 | Ga0207640_10006505 | 3300025981 | Bacteria | 6416 |
| 341 | Ga0207640_10057741 | 3300025981 | Bacteria | 2554 |
| 342 | Ga0207640_10231806 | 3300025981 | Bacteria | 1421 |
| 343 | Ga0207658_10020640 | 3300025986 | Bacteria | 4562 |
| 344 | Ga0207658_10042530 | 3300025986 | Bacteria | 3296 |
| 345 | Ga0207677_10000191 | 3300026023 | Bacteria | 49459 |
| 346 | Ga0207677_10171348 | 3300026023 | Bacteria | 1697 |
| 347 | Ga0207703_10077642 | 3300026035 | Bacteria | 2757 |
| 348 | Ga0207703_10238087 | 3300026035 | Bacteria | 1635 |
| 349 | Ga0207703_10475671 | 3300026035 | Bacteria | 1170 |
| 350 | Ga0207639_10005848 | 3300026041 | Bacteria | 8330 |
| 351 | Ga0207639_10101450 | 3300026041 | Bacteria | 2327 |
| 352 | Ga0207678_10000884 | 3300026067 | Bacteria | 27549 |
| 353 | Ga0207678_10006173 | 3300026067 | Bacteria | 10656 |
| 354 | Ga0207678_10076919 | 3300026067 | Bacteria | 2858 |
| 355 | Ga0207708_10000785 | 3300026075 | Bacteria | 23946 |
| 356 | Ga0207702_10001090 | 3300026078 | Bacteria | 27792 |
| 357 | Ga0207702_10012331 | 3300026078 | Bacteria | 7114 |
| 358 | Ga0207702_10081619 | 3300026078 | Bacteria | 2808 |
| 359 | Ga0207641_10028432 | 3300026088 | Bacteria | 4620 |
| 360 | Ga0207641_10143832 | 3300026088 | Bacteria | 2154 |
| 361 | Ga0207648_10000045 | 3300026089 | Bacteria | 111963 |
| 362 | Ga0207648_10035757 | 3300026089 | Bacteria | 4377 |
| 363 | Ga0207648_10042087 | 3300026089 | Bacteria | 4011 |
| 364 | Ga0207676_10142969 | 3300026095 | Bacteria | 2050 |
| 365 | Ga0207674_10008209 | 3300026116 | Bacteria | 12100 |
| 366 | Ga0207674_10009324 | 3300026116 | Bacteria | 11236 |
| 367 | Ga0207674_10035137 | 3300026116 | Bacteria | 5232 |
| 368 | Ga0207675_100000933 | 3300026118 | Bacteria | 29221 |
| 369 | Ga0207683_10000861 | 3300026121 | Bacteria | 27809 |
| 370 | Ga0207683_10262629 | 3300026121 | Bacteria | 1577 |
| 371 | Ga0207698_10000978 | 3300026142 | Bacteria | 16625 |
| 372 | Ga0207698_10118754 | 3300026142 | Bacteria | 2234 |
| 373 | Ga0207698_10222480 | 3300026142 | Bacteria | 1707 |
| 374 | Ga0207428_10057278 | 3300027907 | Bacteria | 3094 |
| 375 | Ga0268266_10048304 | 3300028379 | Bacteria | 3648 |
| 376 | Ga0268266_10061755 | 3300028379 | Bacteria | 3232 |
| 377 | Ga0268266_10466447 | 3300028379 | Bacteria | 1202 |
| 378 | Ga0268264_10170230 | 3300028381 | Bacteria | 1969 |
| 379 | Ga0268264_10293726 | 3300028381 | Bacteria | 1527 |
| 380 | Ga0307517_10048134 | 3300028786 | Bacteria | 4398 |
| 381 | Ga0307511_10000015 | 3300030521 | Bacteria | 126567 |
| 382 | Ga0265331_10000011 | 3300031250 | Bacteria | 308171 |
| 383 | Ga0265331_10000174 | 3300031250 | Bacteria | 79071 |
| 384 | Ga0265327_10000033 | 3300031251 | Bacteria | 317182 |
| 385 | Ga0307508_10034271 | 3300031616 | Bacteria | 4578 |
| 386 | Ga0307412_10001357 | 3300031911 | Bacteria | 13610 |
| 387 | Ga0373959_0013897 | 3300034820 | Bacteria | 1458 |
| 388 | Ga0373932_0003154 | 3300035112 | Bacteria | 4013 |
| 389 | Ga0373960_0048770 | 3300035121 | Bacteria | 1250 |
| 390 | Ga0373931_0015060 | 3300035691 | Bacteria | 3789 |
| 391 | Ga0395899_0003884 | 3300037312 | Bacteria | 11775 |
| 392 | Ga0395899_0078527 | 3300037312 | Bacteria | 2406 |
| 393 | Ga0395900_0071187 | 3300037418 | Bacteria | 3574 |
| 394 | Ga0395900_0201524 | 3300037418 | Bacteria | 2013 |
| 395 | Ga0395898_0020596 | 3300037466 | Bacteria | 6699 |
| 396 | Ga0395905_0001310 | 3300037471 | Bacteria | 30585 |
| 397 | Ga0395905_0004503 | 3300037471 | Bacteria | 14444 |
| 398 | Ga0395905_0178392 | 3300037471 | Bacteria | 1994 |
| 399 | Ga0395901_0034274 | 3300038443 | Bacteria | 5243 |
| 400 | Ga0395901_0106017 | 3300038443 | Bacteria | 2950 |
| 401 | Ga0395901_0493778 | 3300038443 | Bacteria | 1247 |
| 402 | Ga0436360_1335011 | 3300039438 | Bacteria | 1526 |
| 403 | Ga0439448_0000929 | 3300042005 | Bacteria | 7217 |
| 404 | Ga0439448_0028997 | 3300042005 | Bacteria | 1750 |
| 405 | Ga0439455_0000548 | 3300042012 | Bacteria | 5312 |
| 406 | Ga0439458_0001087 | 3300042157 | Bacteria | 6930 |
| 407 | Ga0439458_0003748 | 3300042157 | Bacteria | 3521 |
| 408 | Ga0451577_0453938 | 3300042876 | Bacteria | 1164 |
| 409 | Ga0466972_0003234 | 3300044658 | Bacteria | 8078 |
| 410 | Ga0466961_0042870 | 3300044693 | Bacteria | 2899 |
| 411 | Ga0466964_0001445 | 3300044706 | Bacteria | 8117 |
| 412 | Ga0466968_0037600 | 3300044735 | Bacteria | 2031 |
| 413 | Ga0466968_0087844 | 3300044735 | Bacteria | 1373 |
| 414 | Ga0466970_0064229 | 3300044765 | Bacteria | 1968 |
| 415 | Ga0466957_0046086 | 3300044842 | Bacteria | 2646 |
| 416 | Ga0466960_0001751 | 3300044901 | Bacteria | 7965 |
| 417 | Ga0466959_0098432 | 3300045049 | Bacteria | 2095 |
| 418 | Ga0466958_0082289 | 3300045836 | Bacteria | 1982 |
| 419 | Ga0466967_0339681 | 3300045976 | Bacteria | 1452 |
| 420 | Ga0495669_0008727 | 3300046684 | Bacteria | 4269 |
| 421 | Ga0495673_0028465 | 3300047469 | Bacteria | 2646 |
| 422 | Ga0495686_0000103 | 3300047472 | Bacteria | 176842 |
| 423 | Ga0496100_0000708 | 3300048903 | Bacteria | 15932 |
| 424 | Ga0496100_0005222 | 3300048903 | Bacteria | 6973 |
| 425 | Ga0496101_0003342 | 3300048904 | Bacteria | 9992 |
| 426 | Ga0496101_0082735 | 3300048904 | Bacteria | 2375 |
| 427 | Ga0496102_0295766 | 3300048905 | Bacteria | 1526 |
| 428 | Ga0496103_0119116 | 3300048906 | Bacteria | 1681 |
| 429 | Ga0496104_0037697 | 3300048907 | Bacteria | 4520 |
| 430 | Ga0496104_0215447 | 3300048907 | Bacteria | 1832 |
| 431 | Ga0496105_0010926 | 3300048908 | Bacteria | 7152 |
| 432 | Ga0496105_0010968 | 3300048908 | Bacteria | 7140 |
| 433 | Ga0496106_0021658 | 3300048909 | Bacteria | 4772 |
| 434 | Ga0496106_0026392 | 3300048909 | Bacteria | 4326 |
| 435 | Ga0496107_0002333 | 3300048910 | Bacteria | 12249 |
| 436 | Ga0496107_0105412 | 3300048910 | Bacteria | 2069 |
| 437 | Ga0496109_0351463 | 3300048912 | Bacteria | 1392 |
| 438 | Ga0496110_0117055 | 3300048913 | Bacteria | 2399 |
| 439 | Ga0496111_0244753 | 3300048914 | Bacteria | 1331 |
| 440 | Ga0496112_0063069 | 3300048915 | Bacteria | 3656 |
| 441 | Ga0496113_0056194 | 3300048916 | Bacteria | 2954 |
| 442 | Ga0496114_0003732 | 3300048917 | Bacteria | 11733 |
| 443 | Ga0496115_0008983 | 3300048918 | Bacteria | 7409 |
| 444 | Ga0496117_0054615 | 3300048920 | Bacteria | 2797 |
| 445 | Ga0496117_0068658 | 3300048920 | Bacteria | 2391 |
| 446 | Ga0496117_0092267 | 3300048920 | Bacteria | 1946 |
| 447 | Ga0496118_0034404 | 3300048921 | Bacteria | 4134 |
| 448 | Ga0496118_0107638 | 3300048921 | Bacteria | 1861 |
| 449 | Ga0496118_0145006 | 3300048921 | Bacteria | 1497 |
| 450 | Ga0496119_0074377 | 3300048922 | Bacteria | 1979 |
| 451 | Ga0496119_0193037 | 3300048922 | Bacteria | 1060 |
| 452 | Ga0496120_0008788 | 3300048923 | Bacteria | 7259 |
| 453 | Ga0496121_0000584 | 3300048924 | Bacteria | 68507 |
| 454 | Ga0496121_0003062 | 3300048924 | Bacteria | 24239 |
| 455 | Ga0496121_0006003 | 3300048924 | Bacteria | 15330 |
| 456 | Ga0496122_0064878 | 3300048925 | Bacteria | 2653 |
| 457 | Ga0496122_0193183 | 3300048925 | Bacteria | 1199 |
| 458 | Ga0496123_0083226 | 3300048926 | Bacteria | 1936 |
| 459 | Ga0496124_0000912 | 3300048927 | Bacteria | 47709 |
| 460 | Ga0496125_0181318 | 3300048928 | Bacteria | 1402 |
| 461 | Ga0496125_0263814 | 3300048928 | Bacteria | 1078 |
| 462 | Ga0496126_0019393 | 3300048929 | Bacteria | 6698 |
| 463 | Ga0496126_0019986 | 3300048929 | Bacteria | 6580 |
| 464 | Ga0496126_0048441 | 3300048929 | Bacteria | 3883 |
| 465 | Ga0501031_0081328 | 3300049568 | Bacteria | 2112 |
| 466 | Ga0501031_0327436 | 3300049568 | Bacteria | 992 |
| 467 | Ga0501032_0000566 | 3300049569 | Bacteria | 30018 |
| 468 | Ga0501033_0062413 | 3300049570 | Bacteria | 2744 |
| 469 | Ga0501033_0100749 | 3300049570 | Bacteria | 2108 |
| 470 | Ga0501034_0094949 | 3300049571 | Bacteria | 2978 |
| 471 | Ga0501034_0139299 | 3300049571 | Bacteria | 2406 |
| 472 | Ga0501036_0064728 | 3300049572 | Bacteria | 3094 |
| 473 | Ga0501037_0037108 | 3300049573 | Bacteria | 3592 |
| 474 | Ga0501037_0116705 | 3300049573 | Bacteria | 1921 |
| 475 | Ga0501038_0274974 | 3300049574 | Bacteria | 1327 |
| 476 | Ga0501041_0057755 | 3300049577 | Bacteria | 2373 |
| 477 | Ga0501042_0075597 | 3300049578 | Bacteria | 2410 |
| 478 | Ga0501043_0034123 | 3300049579 | Bacteria | 4003 |
| 479 | Ga0501043_0251945 | 3300049579 | Bacteria | 1360 |
| 480 | Ga0501067_0000078 | 3300049583 | Bacteria | 56019 |
| 481 | Ga0501067_0066717 | 3300049583 | Bacteria | 1992 |
| 482 | Ga0501068_0010120 | 3300049584 | Bacteria | 5291 |
| 483 | Ga0501071_0047305 | 3300049587 | Bacteria | 3090 |
| 484 | Ga0501072_0018262 | 3300049588 | Bacteria | 5396 |
| 485 | Ga0501072_0058233 | 3300049588 | Bacteria | 3045 |
| 486 | Ga0501072_0189829 | 3300049588 | Bacteria | 1639 |
| 487 | Ga0501073_0000032 | 3300049589 | Bacteria | 110926 |
| 488 | Ga0501073_0216997 | 3300049589 | Bacteria | 1322 |
| 489 | Ga0501074_0153565 | 3300049590 | Bacteria | 1645 |
| 490 | Ga0501075_0256646 | 3300049591 | Bacteria | 1332 |
| 491 | Ga0501077_0000001 | 3300049593 | Bacteria | 270489 |
| 492 | Ga0501077_0094708 | 3300049593 | Bacteria | 1893 |
| 493 | Ga0501079_0020026 | 3300049741 | Bacteria | 5111 |
| 494 | Ga0501079_0089428 | 3300049741 | Bacteria | 2385 |
| 495 | Ga0501079_0098353 | 3300049741 | Bacteria | 2268 |
| 496 | Ga0501080_0000043 | 3300049742 | Bacteria | 80093 |
| 497 | Ga0501080_0342734 | 3300049742 | Bacteria | 1350 |
| 498 | Ga0501081_0039210 | 3300049743 | Bacteria | 3241 |
| 499 | Ga0501081_0057692 | 3300049743 | Bacteria | 2685 |
| 500 | Ga0501083_0153275 | 3300049744 | Bacteria | 1509 |
| 501 | Ga0501035_0152905 | 3300049822 | Bacteria | 2002 |
| 502 | Ga0501044_0016818 | 3300049823 | Bacteria | 7849 |
| 503 | Ga0501044_0025749 | 3300049823 | Bacteria | 6236 |
| 504 | Ga0501045_0022544 | 3300049824 | Bacteria | 4510 |
| 505 | Ga0501045_0082910 | 3300049824 | Bacteria | 2365 |
| 506 | nmdc:mga03683_23_c1 | 3300050489 | Bacteria | 80877 |
| 507 | nmdc:mga03n38_935_c1 | 3300050490 | Bacteria | 7880 |
| 508 | nmdc:mga00v17_236900_c1 | 3300050491 | Bacteria | 1183 |
| 509 | nmdc:mga0k408_19_c1 | 3300050493 | Bacteria | 112120 |
| 510 | nmdc:mga0k408_347917_c1 | 3300050493 | Bacteria | 884 |
| 511 | nmdc:mga07m45_31_c1 | 3300050496 | Bacteria | 81959 |
| 512 | nmdc:mga05p37_212082_c1 | 3300050507 | Bacteria | 2341 |
| 513 | nmdc:mga09592_21340_c1 | 3300050508 | Bacteria | 5338 |
| 514 | nmdc:mga06r32_5167_c1 | 3300050510 | Bacteria | 11729 |
| 515 | nmdc:mga0n895_22696_c1 | 3300050512 | Bacteria | 5886 |
| 516 | nmdc:mga0rr50_96200_c1 | 3300050513 | Bacteria | 2317 |
| 517 | nmdc:mga08x19_28878_c1 | 3300050514 | Bacteria | 3477 |
| 518 | nmdc:mga0a205_188743_c1 | 3300050515 | Bacteria | 1954 |
| 519 | nmdc:mga0sz30_883_c2 | 3300050516 | Bacteria | 9567 |
| 520 | Ga0500641_0024683 | 3300053096 | Bacteria | 2320 |
| 521 | Ga0500559_0106830 | 3300053136 | Bacteria | 1294 |
| 522 | Ga0500637_0110548 | 3300053178 | Bacteria | 1593 |
| 523 | Ga0501084_0145879 | 3300054114 | Bacteria | 1993 |
| 524 | Ga0501082_0102006 | 3300060353 | Bacteria | 2482 |
| 525 | Ga0530510_0005091 | 3300061734 | Bacteria | 9070 |
| 526 | Ga0530510_0024622 | 3300061734 | Bacteria | 4297 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049584 | Ga0501068_0010120 | Ga0501068_0010120_4619_5257 | 206 |
| 2 | 3300048922 | Ga0496119_0193037 | Ga0496119_0193037_12_671 | 218 |
| 3 | 3300049573 | Ga0501037_0037108 | Ga0501037_0037108_2887_3573 | 222 |
| 4 | 3300049571 | Ga0501034_0094949 | Ga0501034_0094949_1428_2159 | 229 |
| 5 | 3300049571 | Ga0501034_0139299 | Ga0501034_0139299_1196_1927 | 229 |
| 6 | 3300049579 | Ga0501043_0251945 | Ga0501043_0251945_416_1162 | 229 |
| 7 | 3300049588 | Ga0501072_0189829 | Ga0501072_0189829_489_1220 | 229 |
| 8 | 3300049569 | Ga0501032_0000566 | Ga0501032_0000566_16511_17245 | 230 |
| 9 | 3300049583 | Ga0501067_0000078 | Ga0501067_0000078_32038_32772 | 230 |
| 10 | 3300049589 | Ga0501073_0000032 | Ga0501073_0000032_67878_68612 | 230 |
| 11 | 3300049593 | Ga0501077_0000001 | Ga0501077_0000001_92676_93410 | 230 |
| 12 | 3300049742 | Ga0501080_0000043 | Ga0501080_0000043_12159_12893 | 230 |
| 13 | 3300049823 | Ga0501044_0025749 | Ga0501044_0025749_546_1280 | 230 |
| 14 | iso_pu_bacteria | 2599185359 | 2600226914 | 230 |
| 15 | iso_pu_bacteria | 2879163058 | 2879163139 | 230 |
| 16 | iso_pu_bacteria | 2928526807 | 2928529655 | 230 |
| 17 | 3300005353 | Ga0070669_100554667 | Ga0070669_1005546671 | 232 |
| 18 | 3300005577 | Ga0068857_100018172 | Ga0068857_1000181721 | 232 |
| 19 | 3300005578 | Ga0068854_100016181 | Ga0068854_1000161815 | 232 |
| 20 | 3300025923 | Ga0207681_10527730 | Ga0207681_105277301 | 232 |
| 21 | 3300025981 | Ga0207640_10006505 | Ga0207640_100065054 | 232 |
| 22 | 3300026116 | Ga0207674_10035137 | Ga0207674_100351374 | 232 |
| 23 | 3300048925 | Ga0496122_0193183 | Ga0496122_0193183_91_801 | 232 |
| 24 | 3300048928 | Ga0496125_0263814 | Ga0496125_0263814_89_799 | 232 |
| 25 | iso_pu_bacteria | 2818991466 | 2819715635 | 234 |
| 26 | iso_pu_bacteria | 2928968154 | 2928970857 | 234 |
| 27 | 3300010375 | Ga0105239_10595364 | Ga0105239_105953642 | 236 |
| 28 | 3300025914 | Ga0207671_10007239 | Ga0207671_100072398 | 236 |
| 29 | 3300030521 | Ga0307511_10000015 | Ga0307511_1000001550 | 236 |
| 30 | 3300031911 | Ga0307412_10001357 | Ga0307412_100013574 | 236 |
| 31 | 3300048927 | Ga0496124_0000912 | Ga0496124_0000912_27304_28026 | 236 |
| 32 | 3300048929 | Ga0496126_0048441 | Ga0496126_0048441_1018_1740 | 236 |
| 33 | 3300053178 | Ga0500637_0110548 | Ga0500637_0110548_68_781 | 236 |
| 34 | 3300003320 | rootH2_10180706 | rootH2_101807062 | 237 |
| 35 | 3300006048 | Ga0075363_100000317 | Ga0075363_10000031716 | 238 |
| 36 | 3300006051 | Ga0075364_10258777 | Ga0075364_102587772 | 238 |
| 37 | 3300006177 | Ga0075362_10000030 | Ga0075362_1000003043 | 238 |
| 38 | 3300006178 | Ga0075367_10264361 | Ga0075367_102643612 | 238 |
| 39 | 3300006186 | Ga0075369_10016674 | Ga0075369_100166742 | 238 |
| 40 | 3300006195 | Ga0075366_10000025 | Ga0075366_100000259 | 238 |
| 41 | 3300006195 | Ga0075366_10086458 | Ga0075366_100864582 | 238 |
| 42 | 3300006353 | Ga0075370_10000178 | Ga0075370_100001789 | 238 |
| 43 | 3300050489 | nmdc:mga03683_23_c1 | nmdc:mga03683_23_c1_10199_10948 | 238 |
| 44 | 3300050490 | nmdc:mga03n38_935_c1 | nmdc:mga03n38_935_c1_817_1566 | 238 |
| 45 | 3300050491 | nmdc:mga00v17_236900_c1 | nmdc:mga00v17_236900_c1_346_1095 | 238 |
| 46 | 3300050493 | nmdc:mga0k408_19_c1 | nmdc:mga0k408_19_c1_101183_101932 | 238 |
| 47 | 3300050493 | nmdc:mga0k408_347917_c1 | nmdc:mga0k408_347917_c1_97_846 | 238 |
| 48 | 3300050496 | nmdc:mga07m45_31_c1 | nmdc:mga07m45_31_c1_70914_71663 | 238 |
| 49 | 3300050516 | nmdc:mga0sz30_883_c2 | nmdc:mga0sz30_883_c2_6992_7741 | 238 |
| 50 | 3300025909 | Ga0207705_10198584 | Ga0207705_101985842 | 239 |
| 51 | 3300031616 | Ga0307508_10034271 | Ga0307508_100342712 | 240 |
| 52 | 3300005335 | Ga0070666_10020283 | Ga0070666_100202833 | 241 |
| 53 | 3300005355 | Ga0070671_100003296 | Ga0070671_1000032965 | 241 |
| 54 | 3300005367 | Ga0070667_100177525 | Ga0070667_1001775252 | 241 |
| 55 | 3300005548 | Ga0070665_100076966 | Ga0070665_1000769664 | 241 |
| 56 | 3300005617 | Ga0068859_100001433 | Ga0068859_10000143316 | 241 |
| 57 | 3300005843 | Ga0068860_100003105 | Ga0068860_1000031052 | 241 |
| 58 | 3300006931 | Ga0097620_100001433 | Ga0097620_10000143316 | 241 |
| 59 | 3300009092 | Ga0105250_10004734 | Ga0105250_100047342 | 241 |
| 60 | 3300009101 | Ga0105247_10000179 | Ga0105247_1000017926 | 241 |
| 61 | 3300009177 | Ga0105248_10016652 | Ga0105248_100166526 | 241 |
| 62 | 3300009553 | Ga0105249_10012545 | Ga0105249_100125452 | 241 |
| 63 | 3300013306 | Ga0163162_10154764 | Ga0163162_101547643 | 241 |
| 64 | 3300014325 | Ga0163163_10009991 | Ga0163163_100099917 | 241 |
| 65 | 3300014968 | Ga0157379_10019100 | Ga0157379_100191006 | 241 |
| 66 | 3300025900 | Ga0207710_10000331 | Ga0207710_1000033122 | 241 |
| 67 | 3300025903 | Ga0207680_10026359 | Ga0207680_100263594 | 241 |
| 68 | 3300025941 | Ga0207711_10208831 | Ga0207711_102088312 | 241 |
| 69 | 3300025961 | Ga0207712_10235941 | Ga0207712_102359412 | 241 |
| 70 | 3300025986 | Ga0207658_10020640 | Ga0207658_100206402 | 241 |
| 71 | 3300026035 | Ga0207703_10077642 | Ga0207703_100776422 | 241 |
| 72 | 3300026088 | Ga0207641_10143832 | Ga0207641_101438322 | 241 |
| 73 | 3300028381 | Ga0268264_10293726 | Ga0268264_102937262 | 241 |
| 74 | 3300048909 | Ga0496106_0026392 | Ga0496106_0026392_3377_4108 | 241 |
| 75 | 3300048915 | Ga0496112_0063069 | Ga0496112_0063069_1348_2079 | 241 |
| 76 | 3300048921 | Ga0496118_0145006 | Ga0496118_0145006_134_865 | 241 |
| 77 | 3300048924 | Ga0496121_0003062 | Ga0496121_0003062_6095_6826 | 241 |
| 78 | 3300048928 | Ga0496125_0181318 | Ga0496125_0181318_543_1274 | 241 |
| 79 | 3300042876 | Ga0451577_0453938 | Ga0451577_0453938_20_826 | 243 |
| 80 | 3300044735 | Ga0466968_0087844 | Ga0466968_0087844_605_1354 | 248 |
| 81 | 3300048905 | Ga0496102_0295766 | Ga0496102_0295766_517_1341 | 249 |
| 82 | 3300048906 | Ga0496103_0119116 | Ga0496103_0119116_348_1172 | 249 |
| 83 | 3300053096 | Ga0500641_0024683 | Ga0500641_0024683_1433_2293 | 249 |
| 84 | 3300009093 | Ga0105240_10032421 | Ga0105240_100324214 | 250 |
| 85 | 3300009545 | Ga0105237_10013453 | Ga0105237_100134534 | 250 |
| 86 | 3300010375 | Ga0105239_10000061 | Ga0105239_1000006162 | 250 |
| 87 | 3300025913 | Ga0207695_10028291 | Ga0207695_100282917 | 250 |
| 88 | 3300025914 | Ga0207671_10009949 | Ga0207671_100099493 | 250 |
| 89 | 3300048924 | Ga0496121_0000584 | Ga0496121_0000584_54803_55609 | 250 |
| 90 | 3300048929 | Ga0496126_0019986 | Ga0496126_0019986_3862_4668 | 250 |
| 91 | 3300005578 | Ga0068854_100040544 | Ga0068854_1000405442 | 252 |
| 92 | 3300025981 | Ga0207640_10057741 | Ga0207640_100577412 | 252 |
| 93 | 3300048921 | Ga0496118_0107638 | Ga0496118_0107638_520_1281 | 253 |
| 94 | 3300048924 | Ga0496121_0006003 | Ga0496121_0006003_1881_2687 | 253 |
| 95 | 3300009093 | Ga0105240_10035796 | Ga0105240_100357963 | 254 |
| 96 | 3300048920 | Ga0496117_0068658 | Ga0496117_0068658_58_876 | 254 |
| 97 | 3300048921 | Ga0496118_0034404 | Ga0496118_0034404_1338_2156 | 254 |
| 98 | 3300038443 | Ga0395901_0493778 | Ga0395901_0493778_47_901 | 255 |
| 99 | 3300038443 | Ga0395901_0034274 | Ga0395901_0034274_1774_2586 | 256 |
| 100 | 3300048907 | Ga0496104_0215447 | Ga0496104_0215447_721_1545 | 257 |
| 101 | 3300026078 | Ga0207702_10012331 | Ga0207702_100123314 | 258 |
| 102 | 3300031250 | Ga0265331_10000011 | Ga0265331_10000011253 | 258 |
| 103 | 3300031250 | Ga0265331_10000174 | Ga0265331_1000017465 | 258 |
| 104 | 3300031251 | Ga0265327_10000033 | Ga0265327_10000033168 | 258 |
| 105 | 3300053136 | Ga0500559_0106830 | Ga0500559_0106830_192_1046 | 258 |
| 106 | 3300001989 | JGI24739J22299_10085331 | JGI24739J22299_100853311 | 259 |
| 107 | 3300002075 | JGI24738J21930_10005382 | JGI24738J21930_100053823 | 259 |
| 108 | 3300002075 | JGI24738J21930_10005787 | JGI24738J21930_100057873 | 259 |
| 109 | 3300002459 | JGI24751J29686_10003616 | JGI24751J29686_100036164 | 259 |
| 110 | 3300005327 | Ga0070658_10014437 | Ga0070658_100144374 | 259 |
| 111 | 3300005328 | Ga0070676_10039924 | Ga0070676_100399241 | 259 |
| 112 | 3300005330 | Ga0070690_100001067 | Ga0070690_10000106714 | 259 |
| 113 | 3300005331 | Ga0070670_100001783 | Ga0070670_1000017832 | 259 |
| 114 | 3300005335 | Ga0070666_10012602 | Ga0070666_100126026 | 259 |
| 115 | 3300005336 | Ga0070680_100012070 | Ga0070680_1000120703 | 259 |
| 116 | 3300005338 | Ga0068868_100051291 | Ga0068868_1000512913 | 259 |
| 117 | 3300005339 | Ga0070660_100018381 | Ga0070660_1000183812 | 259 |
| 118 | 3300005340 | Ga0070689_100014910 | Ga0070689_1000149104 | 259 |
| 119 | 3300005340 | Ga0070689_100020680 | Ga0070689_1000206803 | 259 |
| 120 | 3300005341 | Ga0070691_10002311 | Ga0070691_100023116 | 259 |
| 121 | 3300005343 | Ga0070687_100000686 | Ga0070687_1000006869 | 259 |
| 122 | 3300005344 | Ga0070661_100024378 | Ga0070661_1000243782 | 259 |
| 123 | 3300005345 | Ga0070692_10017503 | Ga0070692_100175033 | 259 |
| 124 | 3300005347 | Ga0070668_100009171 | Ga0070668_1000091712 | 259 |
| 125 | 3300005353 | Ga0070669_100001148 | Ga0070669_1000011487 | 259 |
| 126 | 3300005354 | Ga0070675_100001202 | Ga0070675_10000120214 | 259 |
| 127 | 3300005355 | Ga0070671_100001262 | Ga0070671_10000126216 | 259 |
| 128 | 3300005355 | Ga0070671_100450710 | Ga0070671_1004507102 | 259 |
| 129 | 3300005356 | Ga0070674_100005431 | Ga0070674_1000054313 | 259 |
| 130 | 3300005364 | Ga0070673_100000673 | Ga0070673_10000067320 | 259 |
| 131 | 3300005365 | Ga0070688_100005651 | Ga0070688_1000056517 | 259 |
| 132 | 3300005366 | Ga0070659_100005781 | Ga0070659_1000057818 | 259 |
| 133 | 3300005367 | Ga0070667_100001801 | Ga0070667_10000180120 | 259 |
| 134 | 3300005406 | Ga0070703_10057015 | Ga0070703_100570151 | 259 |
| 135 | 3300005434 | Ga0070709_10000225 | Ga0070709_1000022545 | 259 |
| 136 | 3300005435 | Ga0070714_100153766 | Ga0070714_1001537662 | 259 |
| 137 | 3300005436 | Ga0070713_100180342 | Ga0070713_1001803422 | 259 |
| 138 | 3300005437 | Ga0070710_10004828 | Ga0070710_100048282 | 259 |
| 139 | 3300005438 | Ga0070701_10000713 | Ga0070701_100007138 | 259 |
| 140 | 3300005438 | Ga0070701_10356714 | Ga0070701_103567141 | 259 |
| 141 | 3300005439 | Ga0070711_100000237 | Ga0070711_1000002373 | 259 |
| 142 | 3300005439 | Ga0070711_100020012 | Ga0070711_1000200123 | 259 |
| 143 | 3300005440 | Ga0070705_100002200 | Ga0070705_1000022007 | 259 |
| 144 | 3300005441 | Ga0070700_100009880 | Ga0070700_1000098802 | 259 |
| 145 | 3300005444 | Ga0070694_100015896 | Ga0070694_1000158964 | 259 |
| 146 | 3300005455 | Ga0070663_100000497 | Ga0070663_1000004977 | 259 |
| 147 | 3300005456 | Ga0070678_100003959 | Ga0070678_1000039597 | 259 |
| 148 | 3300005456 | Ga0070678_100233334 | Ga0070678_1002333341 | 259 |
| 149 | 3300005457 | Ga0070662_100004743 | Ga0070662_1000047432 | 259 |
| 150 | 3300005459 | Ga0068867_100022146 | Ga0068867_1000221462 | 259 |
| 151 | 3300005459 | Ga0068867_100029825 | Ga0068867_1000298253 | 259 |
| 152 | 3300005466 | Ga0070685_10163859 | Ga0070685_101638592 | 259 |
| 153 | 3300005468 | Ga0070707_100657140 | Ga0070707_1006571402 | 259 |
| 154 | 3300005530 | Ga0070679_100437285 | Ga0070679_1004372852 | 259 |
| 155 | 3300005535 | Ga0070684_100118086 | Ga0070684_1001180863 | 259 |
| 156 | 3300005536 | Ga0070697_100004352 | Ga0070697_10000435210 | 259 |
| 157 | 3300005539 | Ga0068853_100001129 | Ga0068853_10000112920 | 259 |
| 158 | 3300005543 | Ga0070672_100008366 | Ga0070672_1000083662 | 259 |
| 159 | 3300005544 | Ga0070686_100000710 | Ga0070686_1000007107 | 259 |
| 160 | 3300005544 | Ga0070686_100042171 | Ga0070686_1000421712 | 259 |
| 161 | 3300005545 | Ga0070695_100004563 | Ga0070695_1000045639 | 259 |
| 162 | 3300005547 | Ga0070693_100006067 | Ga0070693_1000060674 | 259 |
| 163 | 3300005548 | Ga0070665_100060047 | Ga0070665_1000600473 | 259 |
| 164 | 3300005548 | Ga0070665_100142799 | Ga0070665_1001427993 | 259 |
| 165 | 3300005549 | Ga0070704_100150630 | Ga0070704_1001506302 | 259 |
| 166 | 3300005563 | Ga0068855_100019337 | Ga0068855_1000193375 | 259 |
| 167 | 3300005564 | Ga0070664_100005810 | Ga0070664_1000058102 | 259 |
| 168 | 3300005577 | Ga0068857_100002722 | Ga0068857_1000027223 | 259 |
| 169 | 3300005578 | Ga0068854_100000389 | Ga0068854_1000003892 | 259 |
| 170 | 3300005614 | Ga0068856_100184065 | Ga0068856_1001840652 | 259 |
| 171 | 3300005615 | Ga0070702_100000088 | Ga0070702_10000008827 | 259 |
| 172 | 3300005616 | Ga0068852_100006411 | Ga0068852_1000064116 | 259 |
| 173 | 3300005617 | Ga0068859_100002269 | Ga0068859_1000022695 | 259 |
| 174 | 3300005618 | Ga0068864_100003629 | Ga0068864_1000036296 | 259 |
| 175 | 3300005718 | Ga0068866_10003168 | Ga0068866_100031684 | 259 |
| 176 | 3300005718 | Ga0068866_10032063 | Ga0068866_100320633 | 259 |
| 177 | 3300005719 | Ga0068861_100000952 | Ga0068861_10000095214 | 259 |
| 178 | 3300005841 | Ga0068863_100005989 | Ga0068863_10000598911 | 259 |
| 179 | 3300005842 | Ga0068858_100002072 | Ga0068858_10000207222 | 259 |
| 180 | 3300005842 | Ga0068858_100156193 | Ga0068858_1001561932 | 259 |
| 181 | 3300005843 | Ga0068860_100003367 | Ga0068860_1000033672 | 259 |
| 182 | 3300005844 | Ga0068862_100007091 | Ga0068862_1000070913 | 259 |
| 183 | 3300005937 | Ga0081455_10002340 | Ga0081455_1000234011 | 259 |
| 184 | 3300006058 | Ga0075432_10002338 | Ga0075432_100023384 | 259 |
| 185 | 3300006163 | Ga0070715_10000291 | Ga0070715_100002912 | 259 |
| 186 | 3300006173 | Ga0070716_100004593 | Ga0070716_1000045935 | 259 |
| 187 | 3300006175 | Ga0070712_100017594 | Ga0070712_1000175944 | 259 |
| 188 | 3300006175 | Ga0070712_100421939 | Ga0070712_1004219391 | 259 |
| 189 | 3300006237 | Ga0097621_100075501 | Ga0097621_1000755013 | 259 |
| 190 | 3300006237 | Ga0097621_100396944 | Ga0097621_1003969442 | 259 |
| 191 | 3300006358 | Ga0068871_100261337 | Ga0068871_1002613372 | 259 |
| 192 | 3300006844 | Ga0075428_100179302 | Ga0075428_1001793022 | 259 |
| 193 | 3300006844 | Ga0075428_100280105 | Ga0075428_1002801052 | 259 |
| 194 | 3300006847 | Ga0075431_100063494 | Ga0075431_1000634942 | 259 |
| 195 | 3300006847 | Ga0075431_100083929 | Ga0075431_1000839296 | 259 |
| 196 | 3300006881 | Ga0068865_100000212 | Ga0068865_1000002128 | 259 |
| 197 | 3300006881 | Ga0068865_100051030 | Ga0068865_1000510303 | 259 |
| 198 | 3300006931 | Ga0097620_100002269 | Ga0097620_1000022695 | 259 |
| 199 | 3300007076 | Ga0075435_100066788 | Ga0075435_1000667882 | 259 |
| 200 | 3300009093 | Ga0105240_10325602 | Ga0105240_103256022 | 259 |
| 201 | 3300009098 | Ga0105245_10005204 | Ga0105245_100052045 | 259 |
| 202 | 3300009101 | Ga0105247_10000925 | Ga0105247_1000092523 | 259 |
| 203 | 3300009101 | Ga0105247_10004422 | Ga0105247_100044225 | 259 |
| 204 | 3300009148 | Ga0105243_10000944 | Ga0105243_100009442 | 259 |
| 205 | 3300009148 | Ga0105243_10076635 | Ga0105243_100766354 | 259 |
| 206 | 3300009174 | Ga0105241_10002673 | Ga0105241_1000267313 | 259 |
| 207 | 3300009176 | Ga0105242_10010551 | Ga0105242_100105514 | 259 |
| 208 | 3300009176 | Ga0105242_10244331 | Ga0105242_102443312 | 259 |
| 209 | 3300009177 | Ga0105248_10014164 | Ga0105248_100141649 | 259 |
| 210 | 3300009545 | Ga0105237_10018843 | Ga0105237_100188432 | 259 |
| 211 | 3300009551 | Ga0105238_10024390 | Ga0105238_100243902 | 259 |
| 212 | 3300009551 | Ga0105238_10798593 | Ga0105238_107985931 | 259 |
| 213 | 3300009553 | Ga0105249_10001629 | Ga0105249_1000162921 | 259 |
| 214 | 3300010375 | Ga0105239_10002915 | Ga0105239_1000291522 | 259 |
| 215 | 3300013102 | Ga0157371_10003718 | Ga0157371_1000371810 | 259 |
| 216 | 3300013104 | Ga0157370_10089043 | Ga0157370_100890432 | 259 |
| 217 | 3300013105 | Ga0157369_10011006 | Ga0157369_100110065 | 259 |
| 218 | 3300013297 | Ga0157378_10020157 | Ga0157378_100201572 | 259 |
| 219 | 3300013306 | Ga0163162_10021988 | Ga0163162_100219883 | 259 |
| 220 | 3300013307 | Ga0157372_10387544 | Ga0157372_103875442 | 259 |
| 221 | 3300013308 | Ga0157375_10019727 | Ga0157375_100197274 | 259 |
| 222 | 3300013308 | Ga0157375_10047224 | Ga0157375_100472243 | 259 |
| 223 | 3300014325 | Ga0163163_10004874 | Ga0163163_100048742 | 259 |
| 224 | 3300014326 | Ga0157380_10051629 | Ga0157380_100516294 | 259 |
| 225 | 3300014326 | Ga0157380_10622613 | Ga0157380_106226131 | 259 |
| 226 | 3300014968 | Ga0157379_10008925 | Ga0157379_100089252 | 259 |
| 227 | 3300014969 | Ga0157376_10001406 | Ga0157376_1000140615 | 259 |
| 228 | 3300014969 | Ga0157376_10088766 | Ga0157376_100887664 | 259 |
| 229 | 3300014969 | Ga0157376_10314511 | Ga0157376_103145112 | 259 |
| 230 | 3300017792 | Ga0163161_10006732 | Ga0163161_100067327 | 259 |
| 231 | 3300020080 | Ga0206350_10761787 | Ga0206350_107617871 | 259 |
| 232 | 3300020082 | Ga0206353_11192685 | Ga0206353_111926852 | 259 |
| 233 | 3300025898 | Ga0207692_10006907 | Ga0207692_100069072 | 259 |
| 234 | 3300025899 | Ga0207642_10088722 | Ga0207642_100887222 | 259 |
| 235 | 3300025900 | Ga0207710_10006074 | Ga0207710_100060745 | 259 |
| 236 | 3300025901 | Ga0207688_10000228 | Ga0207688_100002288 | 259 |
| 237 | 3300025904 | Ga0207647_10024669 | Ga0207647_100246692 | 259 |
| 238 | 3300025906 | Ga0207699_10011962 | Ga0207699_100119622 | 259 |
| 239 | 3300025907 | Ga0207645_10037958 | Ga0207645_100379582 | 259 |
| 240 | 3300025909 | Ga0207705_10116461 | Ga0207705_101164613 | 259 |
| 241 | 3300025911 | Ga0207654_10054904 | Ga0207654_100549042 | 259 |
| 242 | 3300025914 | Ga0207671_10086897 | Ga0207671_100868972 | 259 |
| 243 | 3300025915 | Ga0207693_10000892 | Ga0207693_100008922 | 259 |
| 244 | 3300025916 | Ga0207663_10031899 | Ga0207663_100318993 | 259 |
| 245 | 3300025916 | Ga0207663_10049466 | Ga0207663_100494663 | 259 |
| 246 | 3300025916 | Ga0207663_10467532 | Ga0207663_104675322 | 259 |
| 247 | 3300025917 | Ga0207660_10065099 | Ga0207660_100650992 | 259 |
| 248 | 3300025918 | Ga0207662_10037004 | Ga0207662_100370043 | 259 |
| 249 | 3300025919 | Ga0207657_10001202 | Ga0207657_1000120233 | 259 |
| 250 | 3300025920 | Ga0207649_10012336 | Ga0207649_100123364 | 259 |
| 251 | 3300025923 | Ga0207681_10009481 | Ga0207681_100094817 | 259 |
| 252 | 3300025924 | Ga0207694_10221846 | Ga0207694_102218462 | 259 |
| 253 | 3300025925 | Ga0207650_10057422 | Ga0207650_100574222 | 259 |
| 254 | 3300025926 | Ga0207659_10041103 | Ga0207659_100411034 | 259 |
| 255 | 3300025928 | Ga0207700_10353209 | Ga0207700_103532092 | 259 |
| 256 | 3300025931 | Ga0207644_10087576 | Ga0207644_100875762 | 259 |
| 257 | 3300025931 | Ga0207644_10277669 | Ga0207644_102776692 | 259 |
| 258 | 3300025932 | Ga0207690_10010127 | Ga0207690_100101274 | 259 |
| 259 | 3300025933 | Ga0207706_10001092 | Ga0207706_100010922 | 259 |
| 260 | 3300025934 | Ga0207686_10004463 | Ga0207686_100044633 | 259 |
| 261 | 3300025935 | Ga0207709_10058117 | Ga0207709_100581173 | 259 |
| 262 | 3300025936 | Ga0207670_10023914 | Ga0207670_100239144 | 259 |
| 263 | 3300025937 | Ga0207669_10008343 | Ga0207669_100083434 | 259 |
| 264 | 3300025937 | Ga0207669_10290350 | Ga0207669_102903502 | 259 |
| 265 | 3300025938 | Ga0207704_10009531 | Ga0207704_100095313 | 259 |
| 266 | 3300025938 | Ga0207704_10034048 | Ga0207704_100340482 | 259 |
| 267 | 3300025939 | Ga0207665_10000425 | Ga0207665_100004255 | 259 |
| 268 | 3300025940 | Ga0207691_10004113 | Ga0207691_100041132 | 259 |
| 269 | 3300025942 | Ga0207689_10030460 | Ga0207689_100304602 | 259 |
| 270 | 3300025949 | Ga0207667_10045930 | Ga0207667_100459302 | 259 |
| 271 | 3300025960 | Ga0207651_10154178 | Ga0207651_101541782 | 259 |
| 272 | 3300025960 | Ga0207651_10595373 | Ga0207651_105953731 | 259 |
| 273 | 3300025961 | Ga0207712_10045059 | Ga0207712_100450593 | 259 |
| 274 | 3300025986 | Ga0207658_10042530 | Ga0207658_100425304 | 259 |
| 275 | 3300026023 | Ga0207677_10171348 | Ga0207677_101713482 | 259 |
| 276 | 3300026035 | Ga0207703_10238087 | Ga0207703_102380872 | 259 |
| 277 | 3300026035 | Ga0207703_10475671 | Ga0207703_104756712 | 259 |
| 278 | 3300026041 | Ga0207639_10101450 | Ga0207639_101014502 | 259 |
| 279 | 3300026067 | Ga0207678_10000884 | Ga0207678_1000088433 | 259 |
| 280 | 3300026075 | Ga0207708_10000785 | Ga0207708_1000078527 | 259 |
| 281 | 3300026078 | Ga0207702_10081619 | Ga0207702_100816193 | 259 |
| 282 | 3300026088 | Ga0207641_10028432 | Ga0207641_100284324 | 259 |
| 283 | 3300026089 | Ga0207648_10035757 | Ga0207648_100357574 | 259 |
| 284 | 3300026089 | Ga0207648_10042087 | Ga0207648_100420874 | 259 |
| 285 | 3300026095 | Ga0207676_10142969 | Ga0207676_101429691 | 259 |
| 286 | 3300026116 | Ga0207674_10008209 | Ga0207674_1000820912 | 259 |
| 287 | 3300026118 | Ga0207675_100000933 | Ga0207675_1000009338 | 259 |
| 288 | 3300026121 | Ga0207683_10000861 | Ga0207683_1000086133 | 259 |
| 289 | 3300026121 | Ga0207683_10262629 | Ga0207683_102626291 | 259 |
| 290 | 3300026142 | Ga0207698_10118754 | Ga0207698_101187543 | 259 |
| 291 | 3300027907 | Ga0207428_10057278 | Ga0207428_100572783 | 259 |
| 292 | 3300028379 | Ga0268266_10048304 | Ga0268266_100483043 | 259 |
| 293 | 3300028379 | Ga0268266_10061755 | Ga0268266_100617552 | 259 |
| 294 | 3300028381 | Ga0268264_10170230 | Ga0268264_101702302 | 259 |
| 295 | 3300034820 | Ga0373959_0013897 | Ga0373959_0013897_156_971 | 259 |
| 296 | 3300035112 | Ga0373932_0003154 | Ga0373932_0003154_897_1712 | 259 |
| 297 | 3300035121 | Ga0373960_0048770 | Ga0373960_0048770_380_1195 | 259 |
| 298 | 3300035691 | Ga0373931_0015060 | Ga0373931_0015060_2108_2923 | 259 |
| 299 | 3300037312 | Ga0395899_0078527 | Ga0395899_0078527_459_1274 | 259 |
| 300 | 3300037418 | Ga0395900_0071187 | Ga0395900_0071187_187_1002 | 259 |
| 301 | 3300037466 | Ga0395898_0020596 | Ga0395898_0020596_23_838 | 259 |
| 302 | 3300037471 | Ga0395905_0001310 | Ga0395905_0001310_3040_3855 | 259 |
| 303 | 3300048903 | Ga0496100_0000708 | Ga0496100_0000708_2478_3293 | 259 |
| 304 | 3300048903 | Ga0496100_0005222 | Ga0496100_0005222_554_1369 | 259 |
| 305 | 3300048904 | Ga0496101_0003342 | Ga0496101_0003342_735_1550 | 259 |
| 306 | 3300048904 | Ga0496101_0082735 | Ga0496101_0082735_754_1569 | 259 |
| 307 | 3300048907 | Ga0496104_0037697 | Ga0496104_0037697_2894_3709 | 259 |
| 308 | 3300048908 | Ga0496105_0010926 | Ga0496105_0010926_4935_5750 | 259 |
| 309 | 3300048908 | Ga0496105_0010968 | Ga0496105_0010968_5306_6121 | 259 |
| 310 | 3300048909 | Ga0496106_0021658 | Ga0496106_0021658_1269_2084 | 259 |
| 311 | 3300048910 | Ga0496107_0002333 | Ga0496107_0002333_10548_11363 | 259 |
| 312 | 3300048910 | Ga0496107_0105412 | Ga0496107_0105412_1158_1973 | 259 |
| 313 | 3300048912 | Ga0496109_0351463 | Ga0496109_0351463_24_839 | 259 |
| 314 | 3300048913 | Ga0496110_0117055 | Ga0496110_0117055_807_1622 | 259 |
| 315 | 3300048914 | Ga0496111_0244753 | Ga0496111_0244753_253_1068 | 259 |
| 316 | 3300048916 | Ga0496113_0056194 | Ga0496113_0056194_998_1813 | 259 |
| 317 | 3300048917 | Ga0496114_0003732 | Ga0496114_0003732_7163_7978 | 259 |
| 318 | 3300048918 | Ga0496115_0008983 | Ga0496115_0008983_3087_3902 | 259 |
| 319 | 3300048922 | Ga0496119_0074377 | Ga0496119_0074377_722_1549 | 259 |
| 320 | 3300049568 | Ga0501031_0081328 | Ga0501031_0081328_211_1026 | 259 |
| 321 | 3300049568 | Ga0501031_0327436 | Ga0501031_0327436_152_982 | 259 |
| 322 | 3300049570 | Ga0501033_0100749 | Ga0501033_0100749_959_1774 | 259 |
| 323 | 3300049572 | Ga0501036_0064728 | Ga0501036_0064728_605_1420 | 259 |
| 324 | 3300049573 | Ga0501037_0116705 | Ga0501037_0116705_768_1583 | 259 |
| 325 | 3300049574 | Ga0501038_0274974 | Ga0501038_0274974_435_1265 | 259 |
| 326 | 3300049577 | Ga0501041_0057755 | Ga0501041_0057755_475_1290 | 259 |
| 327 | 3300049578 | Ga0501042_0075597 | Ga0501042_0075597_510_1325 | 259 |
| 328 | 3300049583 | Ga0501067_0066717 | Ga0501067_0066717_352_1167 | 259 |
| 329 | 3300049587 | Ga0501071_0047305 | Ga0501071_0047305_1747_2562 | 259 |
| 330 | 3300049588 | Ga0501072_0018262 | Ga0501072_0018262_4200_5015 | 259 |
| 331 | 3300049588 | Ga0501072_0058233 | Ga0501072_0058233_2056_2886 | 259 |
| 332 | 3300049589 | Ga0501073_0216997 | Ga0501073_0216997_461_1276 | 259 |
| 333 | 3300049590 | Ga0501074_0153565 | Ga0501074_0153565_44_859 | 259 |
| 334 | 3300049591 | Ga0501075_0256646 | Ga0501075_0256646_38_868 | 259 |
| 335 | 3300049593 | Ga0501077_0094708 | Ga0501077_0094708_408_1238 | 259 |
| 336 | 3300049741 | Ga0501079_0020026 | Ga0501079_0020026_798_1613 | 259 |
| 337 | 3300049741 | Ga0501079_0089428 | Ga0501079_0089428_1312_2127 | 259 |
| 338 | 3300049741 | Ga0501079_0098353 | Ga0501079_0098353_340_1170 | 259 |
| 339 | 3300049742 | Ga0501080_0342734 | Ga0501080_0342734_408_1223 | 259 |
| 340 | 3300049743 | Ga0501081_0039210 | Ga0501081_0039210_1023_1838 | 259 |
| 341 | 3300049743 | Ga0501081_0057692 | Ga0501081_0057692_375_1205 | 259 |
| 342 | 3300049744 | Ga0501083_0153275 | Ga0501083_0153275_294_1124 | 259 |
| 343 | 3300049824 | Ga0501045_0022544 | Ga0501045_0022544_3277_4092 | 259 |
| 344 | 3300049824 | Ga0501045_0082910 | Ga0501045_0082910_1114_1929 | 259 |
| 345 | 3300050507 | nmdc:mga05p37_212082_c1 | nmdc:mga05p37_212082_c1_292_1107 | 259 |
| 346 | 3300050508 | nmdc:mga09592_21340_c1 | nmdc:mga09592_21340_c1_1232_2047 | 259 |
| 347 | 3300050510 | nmdc:mga06r32_5167_c1 | nmdc:mga06r32_5167_c1_712_1527 | 259 |
| 348 | 3300050512 | nmdc:mga0n895_22696_c1 | nmdc:mga0n895_22696_c1_2331_3146 | 259 |
| 349 | 3300050513 | nmdc:mga0rr50_96200_c1 | nmdc:mga0rr50_96200_c1_377_1192 | 259 |
| 350 | 3300050514 | nmdc:mga08x19_28878_c1 | nmdc:mga08x19_28878_c1_685_1500 | 259 |
| 351 | 3300050515 | nmdc:mga0a205_188743_c1 | nmdc:mga0a205_188743_c1_976_1791 | 259 |
| 352 | 3300054114 | Ga0501084_0145879 | Ga0501084_0145879_330_1145 | 259 |
| 353 | 3300060353 | Ga0501082_0102006 | Ga0501082_0102006_1157_1987 | 259 |
| 354 | 3300061734 | Ga0530510_0005091 | Ga0530510_0005091_3610_4425 | 259 |
| 355 | 3300061734 | Ga0530510_0024622 | Ga0530510_0024622_2851_3681 | 259 |
| 356 | 3300009148 | Ga0105243_10310985 | Ga0105243_103109852 | 260 |
| 357 | 3300009177 | Ga0105248_10061651 | Ga0105248_100616512 | 260 |
| 358 | 3300025935 | Ga0207709_10000098 | Ga0207709_1000009832 | 260 |
| 359 | 3300025941 | Ga0207711_10036601 | Ga0207711_100366012 | 260 |
| 360 | 3300025981 | Ga0207640_10005890 | Ga0207640_100058904 | 260 |
| 361 | 3300028786 | Ga0307517_10048134 | Ga0307517_100481343 | 260 |
| 362 | 3300039438 | Ga0436360_1335011 | Ga0436360_1335011_375_1259 | 260 |
| 363 | 3300046684 | Ga0495669_0008727 | Ga0495669_0008727_987_1805 | 260 |
| 364 | 3300003791 | Ga0055530_10000020 | Ga0055530_1000002074 | 261 |
| 365 | 3300003794 | Ga0055531_10000184 | Ga0055531_100001849 | 261 |
| 366 | 3300009148 | Ga0105243_10000055 | Ga0105243_1000005513 | 261 |
| 367 | 3300013104 | Ga0157370_10000034 | Ga0157370_10000034120 | 261 |
| 368 | 3300025298 | Ga0209050_1000186 | Ga0209050_100018694 | 261 |
| 369 | 3300025304 | Ga0209257_1000211 | Ga0209257_100021181 | 261 |
| 370 | 3300048929 | Ga0496126_0019393 | Ga0496126_0019393_23_850 | 261 |
| 371 | 3300047469 | Ga0495673_0028465 | Ga0495673_0028465_412_1263 | 263 |
| 372 | 3300047472 | Ga0495686_0000103 | Ga0495686_0000103_162007_162858 | 263 |
| 373 | 3300048926 | Ga0496123_0083226 | Ga0496123_0083226_726_1577 | 263 |
| 374 | 3300025935 | Ga0207709_10196513 | Ga0207709_101965132 | 264 |
| 375 | 3300049570 | Ga0501033_0062413 | Ga0501033_0062413_1456_2298 | 264 |
| 376 | 3300049579 | Ga0501043_0034123 | Ga0501043_0034123_237_1079 | 264 |
| 377 | 3300049822 | Ga0501035_0152905 | Ga0501035_0152905_102_944 | 264 |
| 378 | 3300049823 | Ga0501044_0016818 | Ga0501044_0016818_6466_7308 | 264 |
| 379 | 3300005327 | Ga0070658_10140243 | Ga0070658_101402432 | 266 |
| 380 | 3300009551 | Ga0105238_10276667 | Ga0105238_102766672 | 266 |
| 381 | 3300021384 | Ga0213876_10135459 | Ga0213876_101354591 | 266 |
| 382 | 3300001991 | JGI24743J22301_10027664 | JGI24743J22301_100276641 | 270 |
| 383 | 3300002067 | JGI24735J21928_10001761 | JGI24735J21928_100017617 | 270 |
| 384 | 3300003214 | JGI25165J46597_1000120 | JGI25165J46597_100012020 | 270 |
| 385 | 3300005327 | Ga0070658_10010382 | Ga0070658_100103823 | 270 |
| 386 | 3300005328 | Ga0070676_10005613 | Ga0070676_100056139 | 270 |
| 387 | 3300005334 | Ga0068869_100000110 | Ga0068869_10000011029 | 270 |
| 388 | 3300005338 | Ga0068868_100000016 | Ga0068868_100000016101 | 270 |
| 389 | 3300005364 | Ga0070673_100000017 | Ga0070673_10000001755 | 270 |
| 390 | 3300005366 | Ga0070659_100561206 | Ga0070659_1005612061 | 270 |
| 391 | 3300005459 | Ga0068867_100000013 | Ga0068867_10000001355 | 270 |
| 392 | 3300005543 | Ga0070672_100082847 | Ga0070672_1000828473 | 270 |
| 393 | 3300005614 | Ga0068856_100004302 | Ga0068856_10000430212 | 270 |
| 394 | 3300006881 | Ga0068865_100000007 | Ga0068865_100000007166 | 270 |
| 395 | 3300013104 | Ga0157370_10003964 | Ga0157370_100039647 | 270 |
| 396 | 3300013105 | Ga0157369_10196415 | Ga0157369_101964152 | 270 |
| 397 | 3300025231 | Ga0207427_105219 | Ga0207427_1052192 | 270 |
| 398 | 3300025254 | Ga0209148_1000870 | Ga0209148_100087010 | 270 |
| 399 | 3300025261 | Ga0209233_1000003 | Ga0209233_10000031462 | 270 |
| 400 | 3300025272 | Ga0209455_1000386 | Ga0209455_100038614 | 270 |
| 401 | 3300025904 | Ga0207647_10104890 | Ga0207647_101048902 | 270 |
| 402 | 3300025907 | Ga0207645_10002366 | Ga0207645_1000236610 | 270 |
| 403 | 3300025909 | Ga0207705_10002530 | Ga0207705_100025309 | 270 |
| 404 | 3300025919 | Ga0207657_10125816 | Ga0207657_101258163 | 270 |
| 405 | 3300025927 | Ga0207687_10008499 | Ga0207687_100084999 | 270 |
| 406 | 3300025934 | Ga0207686_10000752 | Ga0207686_1000075215 | 270 |
| 407 | 3300025935 | Ga0207709_10000306 | Ga0207709_100003067 | 270 |
| 408 | 3300025938 | Ga0207704_10000017 | Ga0207704_1000001724 | 270 |
| 409 | 3300025940 | Ga0207691_10130816 | Ga0207691_101308163 | 270 |
| 410 | 3300025942 | Ga0207689_10001243 | Ga0207689_1000124315 | 270 |
| 411 | 3300025960 | Ga0207651_10000011 | Ga0207651_1000001126 | 270 |
| 412 | 3300025961 | Ga0207712_10095203 | Ga0207712_100952032 | 270 |
| 413 | 3300026023 | Ga0207677_10000191 | Ga0207677_100001919 | 270 |
| 414 | 3300026078 | Ga0207702_10001090 | Ga0207702_1000109020 | 270 |
| 415 | 3300026089 | Ga0207648_10000045 | Ga0207648_1000004568 | 270 |
| 416 | 3300037312 | Ga0395899_0003884 | Ga0395899_0003884_7201_8013 | 270 |
| 417 | 3300037418 | Ga0395900_0201524 | Ga0395900_0201524_411_1223 | 270 |
| 418 | 3300005563 | Ga0068855_100826492 | Ga0068855_1008264922 | 272 |
| 419 | 3300009098 | Ga0105245_10001075 | Ga0105245_1000107514 | 272 |
| 420 | 3300009148 | Ga0105243_10000118 | Ga0105243_1000011850 | 272 |
| 421 | 3300009176 | Ga0105242_10000221 | Ga0105242_1000022110 | 272 |
| 422 | 3300009553 | Ga0105249_10038859 | Ga0105249_100388594 | 272 |
| 423 | 3300011119 | Ga0105246_10000135 | Ga0105246_1000013519 | 272 |
| 424 | 3300013296 | Ga0157374_10000189 | Ga0157374_1000018915 | 272 |
| 425 | 3300013297 | Ga0157378_10003688 | Ga0157378_1000368816 | 272 |
| 426 | 3300013307 | Ga0157372_10115937 | Ga0157372_101159374 | 272 |
| 427 | 3300013308 | Ga0157375_10000436 | Ga0157375_1000043650 | 272 |
| 428 | 3300014969 | Ga0157376_10000081 | Ga0157376_1000008168 | 272 |
| 429 | 3300026142 | Ga0207698_10222480 | Ga0207698_102224802 | 272 |
| 430 | 3300002067 | JGI24735J21928_10033129 | JGI24735J21928_100331292 | 273 |
| 431 | 3300005339 | Ga0070660_100000103 | Ga0070660_1000001039 | 273 |
| 432 | 3300005548 | Ga0070665_100537097 | Ga0070665_1005370972 | 273 |
| 433 | 3300025919 | Ga0207657_10000243 | Ga0207657_1000024314 | 273 |
| 434 | 3300028379 | Ga0268266_10466447 | Ga0268266_104664472 | 273 |
| 435 | 3300048920 | Ga0496117_0054615 | Ga0496117_0054615_1409_2236 | 273 |
| 436 | 3300048925 | Ga0496122_0064878 | Ga0496122_0064878_559_1380 | 273 |
| 437 | 3300013100 | Ga0157373_10309433 | Ga0157373_103094332 | 274 |
| 438 | 3300048920 | Ga0496117_0092267 | Ga0496117_0092267_391_1215 | 274 |
| 439 | 3300048923 | Ga0496120_0008788 | Ga0496120_0008788_1387_2211 | 274 |
| 440 | 3300001904 | JGI24736J21556_1014123 | JGI24736J21556_10141232 | 275 |
| 441 | 3300001979 | JGI24740J21852_10059448 | JGI24740J21852_100594481 | 275 |
| 442 | 3300001989 | JGI24739J22299_10004810 | JGI24739J22299_100048102 | 275 |
| 443 | 3300001989 | JGI24739J22299_10023874 | JGI24739J22299_100238742 | 275 |
| 444 | 3300001989 | JGI24739J22299_10065670 | JGI24739J22299_100656702 | 275 |
| 445 | 3300001990 | JGI24737J22298_10001866 | JGI24737J22298_100018664 | 275 |
| 446 | 3300001990 | JGI24737J22298_10019416 | JGI24737J22298_100194163 | 275 |
| 447 | 3300002067 | JGI24735J21928_10006888 | JGI24735J21928_100068883 | 275 |
| 448 | 3300002067 | JGI24735J21928_10043054 | JGI24735J21928_100430542 | 275 |
| 449 | 3300002075 | JGI24738J21930_10001232 | JGI24738J21930_100012323 | 275 |
| 450 | 3300002075 | JGI24738J21930_10008922 | JGI24738J21930_100089223 | 275 |
| 451 | 3300003316 | rootH1_10024748 | rootH1_100247483 | 275 |
| 452 | 3300003323 | rootH1_10022509 | rootH1_100225092 | 275 |
| 453 | 3300003762 | Ga0055542_1005275 | Ga0055542_10052754 | 275 |
| 454 | 3300005327 | Ga0070658_10000624 | Ga0070658_1000062417 | 275 |
| 455 | 3300005327 | Ga0070658_10061105 | Ga0070658_100611053 | 275 |
| 456 | 3300005327 | Ga0070658_10137302 | Ga0070658_101373022 | 275 |
| 457 | 3300005339 | Ga0070660_100000383 | Ga0070660_10000038322 | 275 |
| 458 | 3300005339 | Ga0070660_100416669 | Ga0070660_1004166692 | 275 |
| 459 | 3300005354 | Ga0070675_100124054 | Ga0070675_1001240542 | 275 |
| 460 | 3300005354 | Ga0070675_100266571 | Ga0070675_1002665712 | 275 |
| 461 | 3300005355 | Ga0070671_100021924 | Ga0070671_1000219244 | 275 |
| 462 | 3300005356 | Ga0070674_100216712 | Ga0070674_1002167122 | 275 |
| 463 | 3300005364 | Ga0070673_100518509 | Ga0070673_1005185091 | 275 |
| 464 | 3300005366 | Ga0070659_100355476 | Ga0070659_1003554762 | 275 |
| 465 | 3300005455 | Ga0070663_100002166 | Ga0070663_1000021665 | 275 |
| 466 | 3300005539 | Ga0068853_100008844 | Ga0068853_1000088445 | 275 |
| 467 | 3300005563 | Ga0068855_100000911 | Ga0068855_1000009114 | 275 |
| 468 | 3300005564 | Ga0070664_100377769 | Ga0070664_1003777691 | 275 |
| 469 | 3300005577 | Ga0068857_100005194 | Ga0068857_1000051944 | 275 |
| 470 | 3300005578 | Ga0068854_100000411 | Ga0068854_1000004118 | 275 |
| 471 | 3300005578 | Ga0068854_100066331 | Ga0068854_1000663313 | 275 |
| 472 | 3300005616 | Ga0068852_100001585 | Ga0068852_10000158513 | 275 |
| 473 | 3300005834 | Ga0068851_10125032 | Ga0068851_101250321 | 275 |
| 474 | 3300006237 | Ga0097621_100004755 | Ga0097621_1000047554 | 275 |
| 475 | 3300006358 | Ga0068871_100004770 | Ga0068871_1000047707 | 275 |
| 476 | 3300009148 | Ga0105243_10318505 | Ga0105243_103185052 | 275 |
| 477 | 3300009545 | Ga0105237_10035271 | Ga0105237_100352714 | 275 |
| 478 | 3300009545 | Ga0105237_10527021 | Ga0105237_105270212 | 275 |
| 479 | 3300010375 | Ga0105239_10014039 | Ga0105239_100140395 | 275 |
| 480 | 3300010375 | Ga0105239_10152467 | Ga0105239_101524672 | 275 |
| 481 | 3300013100 | Ga0157373_10005027 | Ga0157373_100050277 | 275 |
| 482 | 3300013102 | Ga0157371_10028109 | Ga0157371_100281091 | 275 |
| 483 | 3300013104 | Ga0157370_10215493 | Ga0157370_102154931 | 275 |
| 484 | 3300013105 | Ga0157369_10063218 | Ga0157369_100632183 | 275 |
| 485 | 3300013105 | Ga0157369_10689282 | Ga0157369_106892822 | 275 |
| 486 | 3300013306 | Ga0163162_10083703 | Ga0163162_100837033 | 275 |
| 487 | 3300013307 | Ga0157372_10010820 | Ga0157372_100108205 | 275 |
| 488 | 3300013307 | Ga0157372_10124262 | Ga0157372_101242624 | 275 |
| 489 | 3300025254 | Ga0209148_1000074 | Ga0209148_1000074151 | 275 |
| 490 | 3300025904 | Ga0207647_10007853 | Ga0207647_100078536 | 275 |
| 491 | 3300025904 | Ga0207647_10008621 | Ga0207647_100086212 | 275 |
| 492 | 3300025909 | Ga0207705_10000110 | Ga0207705_1000011052 | 275 |
| 493 | 3300025909 | Ga0207705_10000651 | Ga0207705_100006511 | 275 |
| 494 | 3300025914 | Ga0207671_10418867 | Ga0207671_104188671 | 275 |
| 495 | 3300025919 | Ga0207657_10001089 | Ga0207657_100010892 | 275 |
| 496 | 3300025919 | Ga0207657_10051274 | Ga0207657_100512744 | 275 |
| 497 | 3300025924 | Ga0207694_10197102 | Ga0207694_101971022 | 275 |
| 498 | 3300025926 | Ga0207659_10637045 | Ga0207659_106370452 | 275 |
| 499 | 3300025932 | Ga0207690_10245082 | Ga0207690_102450822 | 275 |
| 500 | 3300025932 | Ga0207690_10270614 | Ga0207690_102706142 | 275 |
| 501 | 3300025933 | Ga0207706_10013905 | Ga0207706_100139055 | 275 |
| 502 | 3300025933 | Ga0207706_10048329 | Ga0207706_100483293 | 275 |
| 503 | 3300025933 | Ga0207706_10163349 | Ga0207706_101633492 | 275 |
| 504 | 3300025937 | Ga0207669_10184976 | Ga0207669_101849762 | 275 |
| 505 | 3300025938 | Ga0207704_10522903 | Ga0207704_105229031 | 275 |
| 506 | 3300025949 | Ga0207667_10000016 | Ga0207667_10000016376 | 275 |
| 507 | 3300025981 | Ga0207640_10000131 | Ga0207640_1000013142 | 275 |
| 508 | 3300025981 | Ga0207640_10231806 | Ga0207640_102318062 | 275 |
| 509 | 3300026041 | Ga0207639_10005848 | Ga0207639_100058487 | 275 |
| 510 | 3300026067 | Ga0207678_10006173 | Ga0207678_100061736 | 275 |
| 511 | 3300026067 | Ga0207678_10076919 | Ga0207678_100769193 | 275 |
| 512 | 3300026116 | Ga0207674_10009324 | Ga0207674_100093244 | 275 |
| 513 | 3300026142 | Ga0207698_10000978 | Ga0207698_100009789 | 275 |
| 514 | 3300037471 | Ga0395905_0004503 | Ga0395905_0004503_13021_13848 | 275 |
| 515 | 3300037471 | Ga0395905_0178392 | Ga0395905_0178392_261_1088 | 275 |
| 516 | 3300038443 | Ga0395901_0106017 | Ga0395901_0106017_902_1729 | 275 |
| 517 | 3300042005 | Ga0439448_0000929 | Ga0439448_0000929_143_970 | 275 |
| 518 | 3300042005 | Ga0439448_0028997 | Ga0439448_0028997_308_1135 | 275 |
| 519 | 3300042012 | Ga0439455_0000548 | Ga0439455_0000548_4112_4939 | 275 |
| 520 | 3300042157 | Ga0439458_0001087 | Ga0439458_0001087_3760_4587 | 275 |
| 521 | 3300042157 | Ga0439458_0003748 | Ga0439458_0003748_2458_3285 | 275 |
| 522 | 3300044658 | Ga0466972_0003234 | Ga0466972_0003234_5672_6499 | 275 |
| 523 | 3300044693 | Ga0466961_0042870 | Ga0466961_0042870_1943_2770 | 275 |
| 524 | 3300044706 | Ga0466964_0001445 | Ga0466964_0001445_4079_4906 | 275 |
| 525 | 3300044735 | Ga0466968_0037600 | Ga0466968_0037600_559_1386 | 275 |
| 526 | 3300044765 | Ga0466970_0064229 | Ga0466970_0064229_813_1640 | 275 |
| 527 | 3300044842 | Ga0466957_0046086 | Ga0466957_0046086_1057_1884 | 275 |
| 528 | 3300044901 | Ga0466960_0001751 | Ga0466960_0001751_5243_6070 | 275 |
| 529 | 3300045049 | Ga0466959_0098432 | Ga0466959_0098432_445_1272 | 275 |
| 530 | 3300045836 | Ga0466958_0082289 | Ga0466958_0082289_235_1062 | 275 |
| 531 | 3300045976 | Ga0466967_0339681 | Ga0466967_0339681_99_926 | 275 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4gd3-assembly1.cif.gz_A | structure of e. coli hydrogenase-1 in complex with cytochrome b | 0.6318 | 10 | 247 |
| 1b77-assembly1.cif.gz_B | building a replisome structure from interacting pieces: a sliding clamp complexed with an interaction peptide from dna polymerase | 0.5961 | 59 | 100 |
| 4gd3-assembly1.cif.gz_A | structure of e. coli hydrogenase-1 in complex with cytochrome b | 0.59 | 10 | 247 |
| 4zce-assembly1.cif.gz_B | crystal structure of the dust mite allergen der p 23 from dermatophagoides pteronyssinus | 0.5432 | 56 | 95 |
| 5hbf-assembly3.cif.gz_B | crystal structure of human full-length chitotriosidase (chit1) | 0.5381 | 59 | 95 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AEL0_1_211_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.7605 | 5 | 265 | 1.20.950.20 |
| af_P77409_60_261_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.7567 | 5 | 266 | 1.20.950.20 |
| af_P77409_60_261_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.7466 | 5 | 266 | 1.20.950.20 |
| af_P0AEL0_1_211_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.6755 | 5 | 265 | 1.20.950.20 |
| 4gd3B00 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.6294 | 10 | 247 | 1.20.950.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W7B335-F1-model_v4 | Thiosulfate reductase cytochrome b subunit | 0.9526 | 8 | 271 |
GO:0005886
GO:0009055 GO:0020037 GO:0022904 |
| AF-A0A7W7B335-F1-model_v4 | Thiosulfate reductase cytochrome b subunit | 0.9456 | 8 | 271 |
GO:0005886
GO:0009055 GO:0020037 GO:0022904 |
| AF-M2U702-F1-model_v4 | Thiosulfate reductase cytochrome B subunit (Membrane anchoring protein) | 0.9446 | 10 | 271 |
GO:0005886
GO:0009055 GO:0020037 GO:0022904 |
| AF-A0A0Q4HT26-F1-model_v4 | HupC | 0.9445 | 8 | 269 |
GO:0005506
GO:0005886 GO:0009055 GO:0020037 GO:0022904 |
| AF-A0A1W9HAX4-F1-model_v4 | Cytochrome b561 bacterial/Ni-hydrogenase domain-containing protein | 0.9407 | 15 | 270 |
GO:0005886
GO:0009055 GO:0020037 GO:0022904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar