F460065

General Info

Members Datasets Scaffolds Average Seq Length
531 299 526 268

Family's Representative Sequence

Representative Sequence 3300003791|Ga0055530_10000020|Ga0055530_1000002074
Length 303
Sequence MSVSQAAAISVALSGMPTAQTPPLGAEIMQMDEDFMPEPVNPQGGDIVRRHRLPTRLWHWTNALSVIVMLMSGLMIFNAHPRLYWGKYGANPDHSWLAITPGHLHVGSIVIATPGLLGVTPAGGREVAFPPLVTIPSHYDLAGAREWHLAFAWLLVVPGVLFWLWGFARRHFSRDLAPHRAELSPRHLWDDIKAHARLRFPKGPAAARYNILQKLAYCSVIFVLLPGIILTGLTMSPGMDAAWPWLPAVFAGRQSARSIHFLCAMGLAAFIVVHLIMVVLAGPINEIRSMVTGRYRLPEEKES

Samples

Sample ID Description Type Environment
1 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
2 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
3 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
4 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
5 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
6 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
45 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
94 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
95 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
96 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
138 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
199 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
200 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
201 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
202 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
205 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
206 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
214 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
215 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
216 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
219 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
220 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
221 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
222 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
225 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
247 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
248 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
249 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
250 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
251 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
252 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
253 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
267 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
268 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
269 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
272 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
273 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
274 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
275 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
276 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
277 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
278 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
281 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
282 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
283 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
284 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
285 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
286 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
287 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
294 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
295 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
296 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
297 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
298 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
299 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.68
Metatranscriptomes 0.38
Isolates 0.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.46
Nodule 0
Rhizoplane 4.14
Rhizosphere 84.75
Stem 0
Stem Tuber 0
Unclassified 5.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1014123 3300001904 Bacteria 1286
2 JGI24740J21852_10059448 3300001979 Bacteria 1059
3 JGI24739J22299_10004810 3300001989 Bacteria 5149
4 JGI24739J22299_10023874 3300001989 Bacteria 2158
5 JGI24739J22299_10065670 3300001989 Bacteria 1137
6 JGI24739J22299_10085331 3300001989 Bacteria 966
7 JGI24737J22298_10001866 3300001990 Bacteria 7531
8 JGI24737J22298_10019416 3300001990 Bacteria 2173
9 JGI24743J22301_10027664 3300001991 Bacteria 1107
10 JGI24735J21928_10001761 3300002067 Bacteria 7614
11 JGI24735J21928_10006888 3300002067 Bacteria 3721
12 JGI24735J21928_10033129 3300002067 Bacteria 1527
13 JGI24735J21928_10043054 3300002067 Bacteria 1314
14 JGI24738J21930_10001232 3300002075 Bacteria 7193
15 JGI24738J21930_10005382 3300002075 Bacteria 3070
16 JGI24738J21930_10005787 3300002075 Bacteria 2938
17 JGI24738J21930_10008922 3300002075 Bacteria 2271
18 JGI24751J29686_10003616 3300002459 Bacteria 3116
19 JGI25165J46597_1000120 3300003214 Bacteria 136275
20 rootH1_10024748 3300003316 Bacteria 7794
21 rootH2_10180706 3300003320 Bacteria 1791
22 rootH1_10022509 3300003323 Bacteria 3130
23 Ga0055542_1005275 3300003762 Bacteria 2949
24 Ga0055530_10000020 3300003791 Bacteria 139957
25 Ga0055531_10000184 3300003794 Bacteria 69676
26 Ga0070658_10000624 3300005327 Bacteria 30563
27 Ga0070658_10010382 3300005327 Bacteria 7468
28 Ga0070658_10014437 3300005327 Bacteria 6339
29 Ga0070658_10061105 3300005327 Bacteria 3069
30 Ga0070658_10137302 3300005327 Bacteria 2041
31 Ga0070658_10140243 3300005327 Bacteria 2019
32 Ga0070676_10005613 3300005328 Bacteria 6686
33 Ga0070676_10039924 3300005328 Bacteria 2716
34 Ga0070690_100001067 3300005330 Bacteria 14061
35 Ga0070670_100001783 3300005331 Bacteria 17520
36 Ga0068869_100000110 3300005334 Bacteria 39194
37 Ga0070666_10012602 3300005335 Bacteria 5340
38 Ga0070666_10020283 3300005335 Bacteria 4296
39 Ga0070680_100012070 3300005336 Bacteria 6707
40 Ga0068868_100000016 3300005338 Bacteria 102357
41 Ga0068868_100051291 3300005338 Bacteria 3244
42 Ga0070660_100000103 3300005339 Bacteria 52286
43 Ga0070660_100000383 3300005339 Bacteria 29464
44 Ga0070660_100018381 3300005339 Bacteria 5108
45 Ga0070660_100416669 3300005339 Bacteria 1112
46 Ga0070689_100014910 3300005340 Bacteria 5656
47 Ga0070689_100020680 3300005340 Bacteria 4886
48 Ga0070691_10002311 3300005341 Bacteria 8447
49 Ga0070687_100000686 3300005343 Bacteria 11295
50 Ga0070661_100024378 3300005344 Bacteria 4339
51 Ga0070692_10017503 3300005345 Bacteria 3427
52 Ga0070668_100009171 3300005347 Bacteria 7339
53 Ga0070669_100001148 3300005353 Bacteria 19338
54 Ga0070669_100554667 3300005353 Bacteria 958
55 Ga0070675_100001202 3300005354 Bacteria 18818
56 Ga0070675_100124054 3300005354 Bacteria 2196
57 Ga0070675_100266571 3300005354 Bacteria 1502
58 Ga0070671_100001262 3300005355 Bacteria 18969
59 Ga0070671_100003296 3300005355 Bacteria 12597
60 Ga0070671_100021924 3300005355 Bacteria 5218
61 Ga0070671_100450710 3300005355 Bacteria 1104
62 Ga0070674_100005431 3300005356 Bacteria 7363
63 Ga0070674_100216712 3300005356 Bacteria 1487
64 Ga0070673_100000017 3300005364 Bacteria 112829
65 Ga0070673_100000673 3300005364 Bacteria 18823
66 Ga0070673_100518509 3300005364 Bacteria 1080
67 Ga0070688_100005651 3300005365 Bacteria 6601
68 Ga0070659_100005781 3300005366 Bacteria 8905
69 Ga0070659_100355476 3300005366 Bacteria 1230
70 Ga0070659_100561206 3300005366 Bacteria 978
71 Ga0070667_100001801 3300005367 Bacteria 19071
72 Ga0070667_100177525 3300005367 Bacteria 1882
73 Ga0070703_10057015 3300005406 Bacteria 1267
74 Ga0070709_10000225 3300005434 Bacteria 36698
75 Ga0070714_100153766 3300005435 Bacteria 2075
76 Ga0070713_100180342 3300005436 Bacteria 1897
77 Ga0070710_10004828 3300005437 Bacteria 6375
78 Ga0070701_10000713 3300005438 Bacteria 11773
79 Ga0070701_10356714 3300005438 Bacteria 915
80 Ga0070711_100000237 3300005439 Bacteria 28263
81 Ga0070711_100020012 3300005439 Bacteria 4306
82 Ga0070705_100002200 3300005440 Bacteria 9894
83 Ga0070700_100009880 3300005441 Bacteria 5249
84 Ga0070694_100015896 3300005444 Bacteria 4736
85 Ga0070663_100000497 3300005455 Bacteria 20743
86 Ga0070663_100002166 3300005455 Bacteria 10982
87 Ga0070678_100003959 3300005456 Bacteria 8327
88 Ga0070678_100233334 3300005456 Bacteria 1535
89 Ga0070662_100004743 3300005457 Bacteria 8616
90 Ga0068867_100000013 3300005459 Bacteria 112835
91 Ga0068867_100022146 3300005459 Bacteria 4540
92 Ga0068867_100029825 3300005459 Bacteria 3932
93 Ga0070685_10163859 3300005466 Bacteria 1419
94 Ga0070707_100657140 3300005468 Bacteria 1011
95 Ga0070679_100437285 3300005530 Bacteria 1253
96 Ga0070684_100118086 3300005535 Bacteria 2384
97 Ga0070697_100004352 3300005536 Bacteria 10861
98 Ga0068853_100001129 3300005539 Bacteria 18917
99 Ga0068853_100008844 3300005539 Bacteria 8100
100 Ga0070672_100008366 3300005543 Bacteria 7072
101 Ga0070672_100082847 3300005543 Bacteria 2574
102 Ga0070686_100000710 3300005544 Bacteria 19361
103 Ga0070686_100042171 3300005544 Bacteria 2857
104 Ga0070695_100004563 3300005545 Bacteria 8129
105 Ga0070693_100006067 3300005547 Bacteria 5850
106 Ga0070665_100060047 3300005548 Bacteria 3811
107 Ga0070665_100076966 3300005548 Bacteria 3342
108 Ga0070665_100142799 3300005548 Bacteria 2397
109 Ga0070665_100537097 3300005548 Bacteria 1181
110 Ga0070704_100150630 3300005549 Bacteria 1828
111 Ga0068855_100000911 3300005563 Bacteria 36718
112 Ga0068855_100019337 3300005563 Bacteria 8184
113 Ga0068855_100826492 3300005563 Bacteria 983
114 Ga0070664_100005810 3300005564 Bacteria 9952
115 Ga0070664_100377769 3300005564 Bacteria 1293
116 Ga0068857_100002722 3300005577 Bacteria 14509
117 Ga0068857_100005194 3300005577 Bacteria 11079
118 Ga0068857_100018172 3300005577 Bacteria 6168
119 Ga0068854_100000389 3300005578 Bacteria 27589
120 Ga0068854_100000411 3300005578 Bacteria 26860
121 Ga0068854_100016181 3300005578 Bacteria 4965
122 Ga0068854_100040544 3300005578 Bacteria 3286
123 Ga0068854_100066331 3300005578 Bacteria 2627
124 Ga0068856_100004302 3300005614 Bacteria 14214
125 Ga0068856_100184065 3300005614 Bacteria 2102
126 Ga0070702_100000088 3300005615 Bacteria 27195
127 Ga0068852_100001585 3300005616 Bacteria 15462
128 Ga0068852_100006411 3300005616 Bacteria 8502
129 Ga0068859_100001433 3300005617 Bacteria 24186
130 Ga0068859_100002269 3300005617 Bacteria 19505
131 Ga0068864_100003629 3300005618 Bacteria 12763
132 Ga0068866_10003168 3300005718 Bacteria 6770
133 Ga0068866_10032063 3300005718 Bacteria 2537
134 Ga0068861_100000952 3300005719 Bacteria 17599
135 Ga0068851_10125032 3300005834 Bacteria 1386
136 Ga0068863_100005989 3300005841 Bacteria 11923
137 Ga0068858_100002072 3300005842 Bacteria 20404
138 Ga0068858_100156193 3300005842 Bacteria 2146
139 Ga0068860_100003105 3300005843 Bacteria 17168
140 Ga0068860_100003367 3300005843 Bacteria 16456
141 Ga0068862_100007091 3300005844 Bacteria 9308
142 Ga0081455_10002340 3300005937 Bacteria 22617
143 Ga0075363_100000317 3300006048 Bacteria 14291
144 Ga0075364_10258777 3300006051 Bacteria 1183
145 Ga0075432_10002338 3300006058 Bacteria 6316
146 Ga0070715_10000291 3300006163 Bacteria 12275
147 Ga0070716_100004593 3300006173 Bacteria 6620
148 Ga0070712_100017594 3300006175 Bacteria 4629
149 Ga0070712_100421939 3300006175 Bacteria 1106
150 Ga0075362_10000030 3300006177 Bacteria 56135
151 Ga0075367_10264361 3300006178 Bacteria 1080
152 Ga0075369_10016674 3300006186 Bacteria 2968
153 Ga0075366_10000025 3300006195 Bacteria 51813
154 Ga0075366_10086458 3300006195 Bacteria 1876
155 Ga0097621_100004755 3300006237 Bacteria 9496
156 Ga0097621_100075501 3300006237 Bacteria 2794
157 Ga0097621_100396944 3300006237 Bacteria 1234
158 Ga0075370_10000178 3300006353 Bacteria 22055
159 Ga0068871_100004770 3300006358 Bacteria 9480
160 Ga0068871_100261337 3300006358 Bacteria 1510
161 Ga0075428_100179302 3300006844 Bacteria 2293
162 Ga0075428_100280105 3300006844 Bacteria 1794
163 Ga0075431_100063494 3300006847 Bacteria 3811
164 Ga0075431_100083929 3300006847 Bacteria 3289
165 Ga0068865_100000007 3300006881 Bacteria 185316
166 Ga0068865_100000212 3300006881 Bacteria 32489
167 Ga0068865_100051030 3300006881 Bacteria 2861
168 Ga0097620_100001433 3300006931 Bacteria 24186
169 Ga0097620_100002269 3300006931 Bacteria 19505
170 Ga0075435_100066788 3300007076 Bacteria 2927
171 Ga0105250_10004734 3300009092 Bacteria 6211
172 Ga0105240_10032421 3300009093 Bacteria 6764
173 Ga0105240_10035796 3300009093 Bacteria 6393
174 Ga0105240_10325602 3300009093 Bacteria 1750
175 Ga0105245_10001075 3300009098 Bacteria 24755
176 Ga0105245_10005204 3300009098 Bacteria 11423
177 Ga0105247_10000179 3300009101 Bacteria 61933
178 Ga0105247_10000925 3300009101 Bacteria 22094
179 Ga0105247_10004422 3300009101 Bacteria 8970
180 Ga0105243_10000055 3300009148 Bacteria 136180
181 Ga0105243_10000118 3300009148 Bacteria 91438
182 Ga0105243_10000944 3300009148 Bacteria 27244
183 Ga0105243_10076635 3300009148 Bacteria 2718
184 Ga0105243_10310985 3300009148 Unclassified 1432
185 Ga0105243_10318505 3300009148 Bacteria 1416
186 Ga0105241_10002673 3300009174 Bacteria 13358
187 Ga0105242_10000221 3300009176 Bacteria 44918
188 Ga0105242_10010551 3300009176 Bacteria 7093
189 Ga0105242_10244331 3300009176 Bacteria 1615
190 Ga0105248_10014164 3300009177 Bacteria 8779
191 Ga0105248_10016652 3300009177 Bacteria 8092
192 Ga0105248_10061651 3300009177 Bacteria 4212
193 Ga0105237_10013453 3300009545 Bacteria 8580
194 Ga0105237_10018843 3300009545 Bacteria 7138
195 Ga0105237_10035271 3300009545 Bacteria 5062
196 Ga0105237_10527021 3300009545 Bacteria 1188
197 Ga0105238_10024390 3300009551 Bacteria 6165
198 Ga0105238_10276667 3300009551 Bacteria 1659
199 Ga0105238_10798593 3300009551 Bacteria 959
200 Ga0105249_10001629 3300009553 Bacteria 19666
201 Ga0105249_10012545 3300009553 Bacteria 7468
202 Ga0105249_10038859 3300009553 Bacteria 4319
203 Ga0105239_10000061 3300010375 Bacteria 154661
204 Ga0105239_10002915 3300010375 Bacteria 21370
205 Ga0105239_10014039 3300010375 Bacteria 8892
206 Ga0105239_10152467 3300010375 Bacteria 2579
207 Ga0105239_10595364 3300010375 Bacteria 1261
208 Ga0105246_10000135 3300011119 Bacteria 34300
209 Ga0157373_10005027 3300013100 Bacteria 9934
210 Ga0157373_10309433 3300013100 Bacteria 1122
211 Ga0157371_10003718 3300013102 Bacteria 13677
212 Ga0157371_10028109 3300013102 Bacteria 4074
213 Ga0157370_10000034 3300013104 Bacteria 137749
214 Ga0157370_10003964 3300013104 Bacteria 17217
215 Ga0157370_10089043 3300013104 Bacteria 2899
216 Ga0157370_10215493 3300013104 Bacteria 1779
217 Ga0157369_10011006 3300013105 Bacteria 10295
218 Ga0157369_10063218 3300013105 Bacteria 3988
219 Ga0157369_10196415 3300013105 Bacteria 2119
220 Ga0157369_10689282 3300013105 Bacteria 1052
221 Ga0157374_10000189 3300013296 Bacteria 57356
222 Ga0157378_10003688 3300013297 Bacteria 13578
223 Ga0157378_10020157 3300013297 Bacteria 5864
224 Ga0163162_10021988 3300013306 Bacteria 6284
225 Ga0163162_10083703 3300013306 Bacteria 3264
226 Ga0163162_10154764 3300013306 Bacteria 2412
227 Ga0157372_10010820 3300013307 Bacteria 9712
228 Ga0157372_10115937 3300013307 Bacteria 3071
229 Ga0157372_10124262 3300013307 Bacteria 2966
230 Ga0157372_10387544 3300013307 Bacteria 1628
231 Ga0157375_10000436 3300013308 Bacteria 37738
232 Ga0157375_10019727 3300013308 Bacteria 6141
233 Ga0157375_10047224 3300013308 Bacteria 4203
234 Ga0163163_10004874 3300014325 Bacteria 11536
235 Ga0163163_10009991 3300014325 Bacteria 8510
236 Ga0157380_10051629 3300014326 Bacteria 3253
237 Ga0157380_10622613 3300014326 Bacteria 1072
238 Ga0157379_10008925 3300014968 Bacteria 8742
239 Ga0157379_10019100 3300014968 Bacteria 6052
240 Ga0157376_10000081 3300014969 Bacteria 72584
241 Ga0157376_10001406 3300014969 Bacteria 15824
242 Ga0157376_10088766 3300014969 Bacteria 2672
243 Ga0157376_10314511 3300014969 Bacteria 1487
244 Ga0163161_10006732 3300017792 Bacteria 7945
245 Ga0206350_10761787 3300020080 Bacteria 1671
246 Ga0206353_11192685 3300020082 Bacteria 946
247 Ga0213876_10135459 3300021384 Bacteria 1310
248 Ga0207427_105219 3300025231 Bacteria 1893
249 Ga0209148_1000074 3300025254 Bacteria 314356
250 Ga0209148_1000870 3300025254 Bacteria 21040
251 Ga0209233_1000003 3300025261 Bacteria 1607366
252 Ga0209455_1000386 3300025272 Bacteria 39294
253 Ga0209050_1000186 3300025298 Bacteria 139998
254 Ga0209257_1000211 3300025304 Bacteria 139998
255 Ga0207692_10006907 3300025898 Bacteria 4626
256 Ga0207642_10088722 3300025899 Bacteria 1522
257 Ga0207710_10000331 3300025900 Bacteria 35720
258 Ga0207710_10006074 3300025900 Bacteria 5174
259 Ga0207688_10000228 3300025901 Bacteria 25406
260 Ga0207680_10026359 3300025903 Bacteria 3221
261 Ga0207647_10007853 3300025904 Bacteria 7675
262 Ga0207647_10008621 3300025904 Bacteria 7293
263 Ga0207647_10024669 3300025904 Bacteria 3963
264 Ga0207647_10104890 3300025904 Bacteria 1675
265 Ga0207699_10011962 3300025906 Bacteria 4400
266 Ga0207645_10002366 3300025907 Bacteria 14873
267 Ga0207645_10037958 3300025907 Bacteria 3091
268 Ga0207705_10000110 3300025909 Bacteria 92932
269 Ga0207705_10000651 3300025909 Bacteria 28902
270 Ga0207705_10002530 3300025909 Bacteria 14084
271 Ga0207705_10116461 3300025909 Bacteria 1979
272 Ga0207705_10198584 3300025909 Bacteria 1519
273 Ga0207654_10054904 3300025911 Bacteria 2304
274 Ga0207695_10028291 3300025913 Bacteria 6221
275 Ga0207671_10007239 3300025914 Bacteria 9663
276 Ga0207671_10009949 3300025914 Bacteria 7902
277 Ga0207671_10086897 3300025914 Bacteria 2351
278 Ga0207671_10418867 3300025914 Bacteria 1065
279 Ga0207693_10000892 3300025915 Bacteria 26789
280 Ga0207663_10031899 3300025916 Bacteria 3123
281 Ga0207663_10049466 3300025916 Bacteria 2608
282 Ga0207663_10467532 3300025916 Bacteria 975
283 Ga0207660_10065099 3300025917 Bacteria 2633
284 Ga0207662_10037004 3300025918 Bacteria 2855
285 Ga0207657_10000243 3300025919 Bacteria 57852
286 Ga0207657_10001089 3300025919 Bacteria 28773
287 Ga0207657_10001202 3300025919 Bacteria 27550
288 Ga0207657_10051274 3300025919 Bacteria 3587
289 Ga0207657_10125816 3300025919 Bacteria 2105
290 Ga0207649_10012336 3300025920 Bacteria 4739
291 Ga0207681_10009481 3300025923 Bacteria 5949
292 Ga0207681_10527730 3300025923 Bacteria 969
293 Ga0207694_10197102 3300025924 Bacteria 1637
294 Ga0207694_10221846 3300025924 Bacteria 1542
295 Ga0207650_10057422 3300025925 Bacteria 2894
296 Ga0207659_10041103 3300025926 Bacteria 3237
297 Ga0207659_10637045 3300025926 Bacteria 910
298 Ga0207687_10008499 3300025927 Bacteria 6713
299 Ga0207700_10353209 3300025928 Bacteria 1280
300 Ga0207644_10087576 3300025931 Bacteria 2314
301 Ga0207644_10277669 3300025931 Bacteria 1344
302 Ga0207690_10010127 3300025932 Bacteria 5599
303 Ga0207690_10245082 3300025932 Bacteria 1382
304 Ga0207690_10270614 3300025932 Bacteria 1320
305 Ga0207706_10001092 3300025933 Bacteria 27557
306 Ga0207706_10013905 3300025933 Bacteria 7299
307 Ga0207706_10048329 3300025933 Bacteria 3763
308 Ga0207706_10163349 3300025933 Bacteria 1957
309 Ga0207686_10000752 3300025934 Bacteria 19971
310 Ga0207686_10004463 3300025934 Bacteria 7499
311 Ga0207709_10000098 3300025935 Bacteria 136213
312 Ga0207709_10000306 3300025935 Bacteria 53253
313 Ga0207709_10058117 3300025935 Bacteria 2402
314 Ga0207709_10196513 3300025935 Unclassified 1437
315 Ga0207670_10023914 3300025936 Bacteria 3811
316 Ga0207669_10008343 3300025937 Bacteria 4857
317 Ga0207669_10184976 3300025937 Bacteria 1497
318 Ga0207669_10290350 3300025937 Bacteria 1238
319 Ga0207704_10000017 3300025938 Bacteria 154190
320 Ga0207704_10009531 3300025938 Bacteria 4689
321 Ga0207704_10034048 3300025938 Bacteria 2904
322 Ga0207704_10522903 3300025938 Bacteria 960
323 Ga0207665_10000425 3300025939 Bacteria 29075
324 Ga0207691_10004113 3300025940 Bacteria 14132
325 Ga0207691_10130816 3300025940 Bacteria 2217
326 Ga0207711_10036601 3300025941 Bacteria 4165
327 Ga0207711_10208831 3300025941 Bacteria 1783
328 Ga0207689_10001243 3300025942 Bacteria 24569
329 Ga0207689_10030460 3300025942 Bacteria 4496
330 Ga0207667_10000016 3300025949 Bacteria 391466
331 Ga0207667_10045930 3300025949 Bacteria 4624
332 Ga0207651_10000011 3300025960 Bacteria 191950
333 Ga0207651_10154178 3300025960 Bacteria 1792
334 Ga0207651_10595373 3300025960 Bacteria 966
335 Ga0207712_10045059 3300025961 Bacteria 3053
336 Ga0207712_10095203 3300025961 Bacteria 2201
337 Ga0207712_10235941 3300025961 Bacteria 1471
338 Ga0207640_10000131 3300025981 Bacteria 56277
339 Ga0207640_10005890 3300025981 Bacteria 6691
340 Ga0207640_10006505 3300025981 Bacteria 6416
341 Ga0207640_10057741 3300025981 Bacteria 2554
342 Ga0207640_10231806 3300025981 Bacteria 1421
343 Ga0207658_10020640 3300025986 Bacteria 4562
344 Ga0207658_10042530 3300025986 Bacteria 3296
345 Ga0207677_10000191 3300026023 Bacteria 49459
346 Ga0207677_10171348 3300026023 Bacteria 1697
347 Ga0207703_10077642 3300026035 Bacteria 2757
348 Ga0207703_10238087 3300026035 Bacteria 1635
349 Ga0207703_10475671 3300026035 Bacteria 1170
350 Ga0207639_10005848 3300026041 Bacteria 8330
351 Ga0207639_10101450 3300026041 Bacteria 2327
352 Ga0207678_10000884 3300026067 Bacteria 27549
353 Ga0207678_10006173 3300026067 Bacteria 10656
354 Ga0207678_10076919 3300026067 Bacteria 2858
355 Ga0207708_10000785 3300026075 Bacteria 23946
356 Ga0207702_10001090 3300026078 Bacteria 27792
357 Ga0207702_10012331 3300026078 Bacteria 7114
358 Ga0207702_10081619 3300026078 Bacteria 2808
359 Ga0207641_10028432 3300026088 Bacteria 4620
360 Ga0207641_10143832 3300026088 Bacteria 2154
361 Ga0207648_10000045 3300026089 Bacteria 111963
362 Ga0207648_10035757 3300026089 Bacteria 4377
363 Ga0207648_10042087 3300026089 Bacteria 4011
364 Ga0207676_10142969 3300026095 Bacteria 2050
365 Ga0207674_10008209 3300026116 Bacteria 12100
366 Ga0207674_10009324 3300026116 Bacteria 11236
367 Ga0207674_10035137 3300026116 Bacteria 5232
368 Ga0207675_100000933 3300026118 Bacteria 29221
369 Ga0207683_10000861 3300026121 Bacteria 27809
370 Ga0207683_10262629 3300026121 Bacteria 1577
371 Ga0207698_10000978 3300026142 Bacteria 16625
372 Ga0207698_10118754 3300026142 Bacteria 2234
373 Ga0207698_10222480 3300026142 Bacteria 1707
374 Ga0207428_10057278 3300027907 Bacteria 3094
375 Ga0268266_10048304 3300028379 Bacteria 3648
376 Ga0268266_10061755 3300028379 Bacteria 3232
377 Ga0268266_10466447 3300028379 Bacteria 1202
378 Ga0268264_10170230 3300028381 Bacteria 1969
379 Ga0268264_10293726 3300028381 Bacteria 1527
380 Ga0307517_10048134 3300028786 Bacteria 4398
381 Ga0307511_10000015 3300030521 Bacteria 126567
382 Ga0265331_10000011 3300031250 Bacteria 308171
383 Ga0265331_10000174 3300031250 Bacteria 79071
384 Ga0265327_10000033 3300031251 Bacteria 317182
385 Ga0307508_10034271 3300031616 Bacteria 4578
386 Ga0307412_10001357 3300031911 Bacteria 13610
387 Ga0373959_0013897 3300034820 Bacteria 1458
388 Ga0373932_0003154 3300035112 Bacteria 4013
389 Ga0373960_0048770 3300035121 Bacteria 1250
390 Ga0373931_0015060 3300035691 Bacteria 3789
391 Ga0395899_0003884 3300037312 Bacteria 11775
392 Ga0395899_0078527 3300037312 Bacteria 2406
393 Ga0395900_0071187 3300037418 Bacteria 3574
394 Ga0395900_0201524 3300037418 Bacteria 2013
395 Ga0395898_0020596 3300037466 Bacteria 6699
396 Ga0395905_0001310 3300037471 Bacteria 30585
397 Ga0395905_0004503 3300037471 Bacteria 14444
398 Ga0395905_0178392 3300037471 Bacteria 1994
399 Ga0395901_0034274 3300038443 Bacteria 5243
400 Ga0395901_0106017 3300038443 Bacteria 2950
401 Ga0395901_0493778 3300038443 Bacteria 1247
402 Ga0436360_1335011 3300039438 Bacteria 1526
403 Ga0439448_0000929 3300042005 Bacteria 7217
404 Ga0439448_0028997 3300042005 Bacteria 1750
405 Ga0439455_0000548 3300042012 Bacteria 5312
406 Ga0439458_0001087 3300042157 Bacteria 6930
407 Ga0439458_0003748 3300042157 Bacteria 3521
408 Ga0451577_0453938 3300042876 Bacteria 1164
409 Ga0466972_0003234 3300044658 Bacteria 8078
410 Ga0466961_0042870 3300044693 Bacteria 2899
411 Ga0466964_0001445 3300044706 Bacteria 8117
412 Ga0466968_0037600 3300044735 Bacteria 2031
413 Ga0466968_0087844 3300044735 Bacteria 1373
414 Ga0466970_0064229 3300044765 Bacteria 1968
415 Ga0466957_0046086 3300044842 Bacteria 2646
416 Ga0466960_0001751 3300044901 Bacteria 7965
417 Ga0466959_0098432 3300045049 Bacteria 2095
418 Ga0466958_0082289 3300045836 Bacteria 1982
419 Ga0466967_0339681 3300045976 Bacteria 1452
420 Ga0495669_0008727 3300046684 Bacteria 4269
421 Ga0495673_0028465 3300047469 Bacteria 2646
422 Ga0495686_0000103 3300047472 Bacteria 176842
423 Ga0496100_0000708 3300048903 Bacteria 15932
424 Ga0496100_0005222 3300048903 Bacteria 6973
425 Ga0496101_0003342 3300048904 Bacteria 9992
426 Ga0496101_0082735 3300048904 Bacteria 2375
427 Ga0496102_0295766 3300048905 Bacteria 1526
428 Ga0496103_0119116 3300048906 Bacteria 1681
429 Ga0496104_0037697 3300048907 Bacteria 4520
430 Ga0496104_0215447 3300048907 Bacteria 1832
431 Ga0496105_0010926 3300048908 Bacteria 7152
432 Ga0496105_0010968 3300048908 Bacteria 7140
433 Ga0496106_0021658 3300048909 Bacteria 4772
434 Ga0496106_0026392 3300048909 Bacteria 4326
435 Ga0496107_0002333 3300048910 Bacteria 12249
436 Ga0496107_0105412 3300048910 Bacteria 2069
437 Ga0496109_0351463 3300048912 Bacteria 1392
438 Ga0496110_0117055 3300048913 Bacteria 2399
439 Ga0496111_0244753 3300048914 Bacteria 1331
440 Ga0496112_0063069 3300048915 Bacteria 3656
441 Ga0496113_0056194 3300048916 Bacteria 2954
442 Ga0496114_0003732 3300048917 Bacteria 11733
443 Ga0496115_0008983 3300048918 Bacteria 7409
444 Ga0496117_0054615 3300048920 Bacteria 2797
445 Ga0496117_0068658 3300048920 Bacteria 2391
446 Ga0496117_0092267 3300048920 Bacteria 1946
447 Ga0496118_0034404 3300048921 Bacteria 4134
448 Ga0496118_0107638 3300048921 Bacteria 1861
449 Ga0496118_0145006 3300048921 Bacteria 1497
450 Ga0496119_0074377 3300048922 Bacteria 1979
451 Ga0496119_0193037 3300048922 Bacteria 1060
452 Ga0496120_0008788 3300048923 Bacteria 7259
453 Ga0496121_0000584 3300048924 Bacteria 68507
454 Ga0496121_0003062 3300048924 Bacteria 24239
455 Ga0496121_0006003 3300048924 Bacteria 15330
456 Ga0496122_0064878 3300048925 Bacteria 2653
457 Ga0496122_0193183 3300048925 Bacteria 1199
458 Ga0496123_0083226 3300048926 Bacteria 1936
459 Ga0496124_0000912 3300048927 Bacteria 47709
460 Ga0496125_0181318 3300048928 Bacteria 1402
461 Ga0496125_0263814 3300048928 Bacteria 1078
462 Ga0496126_0019393 3300048929 Bacteria 6698
463 Ga0496126_0019986 3300048929 Bacteria 6580
464 Ga0496126_0048441 3300048929 Bacteria 3883
465 Ga0501031_0081328 3300049568 Bacteria 2112
466 Ga0501031_0327436 3300049568 Bacteria 992
467 Ga0501032_0000566 3300049569 Bacteria 30018
468 Ga0501033_0062413 3300049570 Bacteria 2744
469 Ga0501033_0100749 3300049570 Bacteria 2108
470 Ga0501034_0094949 3300049571 Bacteria 2978
471 Ga0501034_0139299 3300049571 Bacteria 2406
472 Ga0501036_0064728 3300049572 Bacteria 3094
473 Ga0501037_0037108 3300049573 Bacteria 3592
474 Ga0501037_0116705 3300049573 Bacteria 1921
475 Ga0501038_0274974 3300049574 Bacteria 1327
476 Ga0501041_0057755 3300049577 Bacteria 2373
477 Ga0501042_0075597 3300049578 Bacteria 2410
478 Ga0501043_0034123 3300049579 Bacteria 4003
479 Ga0501043_0251945 3300049579 Bacteria 1360
480 Ga0501067_0000078 3300049583 Bacteria 56019
481 Ga0501067_0066717 3300049583 Bacteria 1992
482 Ga0501068_0010120 3300049584 Bacteria 5291
483 Ga0501071_0047305 3300049587 Bacteria 3090
484 Ga0501072_0018262 3300049588 Bacteria 5396
485 Ga0501072_0058233 3300049588 Bacteria 3045
486 Ga0501072_0189829 3300049588 Bacteria 1639
487 Ga0501073_0000032 3300049589 Bacteria 110926
488 Ga0501073_0216997 3300049589 Bacteria 1322
489 Ga0501074_0153565 3300049590 Bacteria 1645
490 Ga0501075_0256646 3300049591 Bacteria 1332
491 Ga0501077_0000001 3300049593 Bacteria 270489
492 Ga0501077_0094708 3300049593 Bacteria 1893
493 Ga0501079_0020026 3300049741 Bacteria 5111
494 Ga0501079_0089428 3300049741 Bacteria 2385
495 Ga0501079_0098353 3300049741 Bacteria 2268
496 Ga0501080_0000043 3300049742 Bacteria 80093
497 Ga0501080_0342734 3300049742 Bacteria 1350
498 Ga0501081_0039210 3300049743 Bacteria 3241
499 Ga0501081_0057692 3300049743 Bacteria 2685
500 Ga0501083_0153275 3300049744 Bacteria 1509
501 Ga0501035_0152905 3300049822 Bacteria 2002
502 Ga0501044_0016818 3300049823 Bacteria 7849
503 Ga0501044_0025749 3300049823 Bacteria 6236
504 Ga0501045_0022544 3300049824 Bacteria 4510
505 Ga0501045_0082910 3300049824 Bacteria 2365
506 nmdc:mga03683_23_c1 3300050489 Bacteria 80877
507 nmdc:mga03n38_935_c1 3300050490 Bacteria 7880
508 nmdc:mga00v17_236900_c1 3300050491 Bacteria 1183
509 nmdc:mga0k408_19_c1 3300050493 Bacteria 112120
510 nmdc:mga0k408_347917_c1 3300050493 Bacteria 884
511 nmdc:mga07m45_31_c1 3300050496 Bacteria 81959
512 nmdc:mga05p37_212082_c1 3300050507 Bacteria 2341
513 nmdc:mga09592_21340_c1 3300050508 Bacteria 5338
514 nmdc:mga06r32_5167_c1 3300050510 Bacteria 11729
515 nmdc:mga0n895_22696_c1 3300050512 Bacteria 5886
516 nmdc:mga0rr50_96200_c1 3300050513 Bacteria 2317
517 nmdc:mga08x19_28878_c1 3300050514 Bacteria 3477
518 nmdc:mga0a205_188743_c1 3300050515 Bacteria 1954
519 nmdc:mga0sz30_883_c2 3300050516 Bacteria 9567
520 Ga0500641_0024683 3300053096 Bacteria 2320
521 Ga0500559_0106830 3300053136 Bacteria 1294
522 Ga0500637_0110548 3300053178 Bacteria 1593
523 Ga0501084_0145879 3300054114 Bacteria 1993
524 Ga0501082_0102006 3300060353 Bacteria 2482
525 Ga0530510_0005091 3300061734 Bacteria 9070
526 Ga0530510_0024622 3300061734 Bacteria 4297

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049584 Ga0501068_0010120 Ga0501068_0010120_4619_5257 206
2 3300048922 Ga0496119_0193037 Ga0496119_0193037_12_671 218
3 3300049573 Ga0501037_0037108 Ga0501037_0037108_2887_3573 222
4 3300049571 Ga0501034_0094949 Ga0501034_0094949_1428_2159 229
5 3300049571 Ga0501034_0139299 Ga0501034_0139299_1196_1927 229
6 3300049579 Ga0501043_0251945 Ga0501043_0251945_416_1162 229
7 3300049588 Ga0501072_0189829 Ga0501072_0189829_489_1220 229
8 3300049569 Ga0501032_0000566 Ga0501032_0000566_16511_17245 230
9 3300049583 Ga0501067_0000078 Ga0501067_0000078_32038_32772 230
10 3300049589 Ga0501073_0000032 Ga0501073_0000032_67878_68612 230
11 3300049593 Ga0501077_0000001 Ga0501077_0000001_92676_93410 230
12 3300049742 Ga0501080_0000043 Ga0501080_0000043_12159_12893 230
13 3300049823 Ga0501044_0025749 Ga0501044_0025749_546_1280 230
14 iso_pu_bacteria 2599185359 2600226914 230
15 iso_pu_bacteria 2879163058 2879163139 230
16 iso_pu_bacteria 2928526807 2928529655 230
17 3300005353 Ga0070669_100554667 Ga0070669_1005546671 232
18 3300005577 Ga0068857_100018172 Ga0068857_1000181721 232
19 3300005578 Ga0068854_100016181 Ga0068854_1000161815 232
20 3300025923 Ga0207681_10527730 Ga0207681_105277301 232
21 3300025981 Ga0207640_10006505 Ga0207640_100065054 232
22 3300026116 Ga0207674_10035137 Ga0207674_100351374 232
23 3300048925 Ga0496122_0193183 Ga0496122_0193183_91_801 232
24 3300048928 Ga0496125_0263814 Ga0496125_0263814_89_799 232
25 iso_pu_bacteria 2818991466 2819715635 234
26 iso_pu_bacteria 2928968154 2928970857 234
27 3300010375 Ga0105239_10595364 Ga0105239_105953642 236
28 3300025914 Ga0207671_10007239 Ga0207671_100072398 236
29 3300030521 Ga0307511_10000015 Ga0307511_1000001550 236
30 3300031911 Ga0307412_10001357 Ga0307412_100013574 236
31 3300048927 Ga0496124_0000912 Ga0496124_0000912_27304_28026 236
32 3300048929 Ga0496126_0048441 Ga0496126_0048441_1018_1740 236
33 3300053178 Ga0500637_0110548 Ga0500637_0110548_68_781 236
34 3300003320 rootH2_10180706 rootH2_101807062 237
35 3300006048 Ga0075363_100000317 Ga0075363_10000031716 238
36 3300006051 Ga0075364_10258777 Ga0075364_102587772 238
37 3300006177 Ga0075362_10000030 Ga0075362_1000003043 238
38 3300006178 Ga0075367_10264361 Ga0075367_102643612 238
39 3300006186 Ga0075369_10016674 Ga0075369_100166742 238
40 3300006195 Ga0075366_10000025 Ga0075366_100000259 238
41 3300006195 Ga0075366_10086458 Ga0075366_100864582 238
42 3300006353 Ga0075370_10000178 Ga0075370_100001789 238
43 3300050489 nmdc:mga03683_23_c1 nmdc:mga03683_23_c1_10199_10948 238
44 3300050490 nmdc:mga03n38_935_c1 nmdc:mga03n38_935_c1_817_1566 238
45 3300050491 nmdc:mga00v17_236900_c1 nmdc:mga00v17_236900_c1_346_1095 238
46 3300050493 nmdc:mga0k408_19_c1 nmdc:mga0k408_19_c1_101183_101932 238
47 3300050493 nmdc:mga0k408_347917_c1 nmdc:mga0k408_347917_c1_97_846 238
48 3300050496 nmdc:mga07m45_31_c1 nmdc:mga07m45_31_c1_70914_71663 238
49 3300050516 nmdc:mga0sz30_883_c2 nmdc:mga0sz30_883_c2_6992_7741 238
50 3300025909 Ga0207705_10198584 Ga0207705_101985842 239
51 3300031616 Ga0307508_10034271 Ga0307508_100342712 240
52 3300005335 Ga0070666_10020283 Ga0070666_100202833 241
53 3300005355 Ga0070671_100003296 Ga0070671_1000032965 241
54 3300005367 Ga0070667_100177525 Ga0070667_1001775252 241
55 3300005548 Ga0070665_100076966 Ga0070665_1000769664 241
56 3300005617 Ga0068859_100001433 Ga0068859_10000143316 241
57 3300005843 Ga0068860_100003105 Ga0068860_1000031052 241
58 3300006931 Ga0097620_100001433 Ga0097620_10000143316 241
59 3300009092 Ga0105250_10004734 Ga0105250_100047342 241
60 3300009101 Ga0105247_10000179 Ga0105247_1000017926 241
61 3300009177 Ga0105248_10016652 Ga0105248_100166526 241
62 3300009553 Ga0105249_10012545 Ga0105249_100125452 241
63 3300013306 Ga0163162_10154764 Ga0163162_101547643 241
64 3300014325 Ga0163163_10009991 Ga0163163_100099917 241
65 3300014968 Ga0157379_10019100 Ga0157379_100191006 241
66 3300025900 Ga0207710_10000331 Ga0207710_1000033122 241
67 3300025903 Ga0207680_10026359 Ga0207680_100263594 241
68 3300025941 Ga0207711_10208831 Ga0207711_102088312 241
69 3300025961 Ga0207712_10235941 Ga0207712_102359412 241
70 3300025986 Ga0207658_10020640 Ga0207658_100206402 241
71 3300026035 Ga0207703_10077642 Ga0207703_100776422 241
72 3300026088 Ga0207641_10143832 Ga0207641_101438322 241
73 3300028381 Ga0268264_10293726 Ga0268264_102937262 241
74 3300048909 Ga0496106_0026392 Ga0496106_0026392_3377_4108 241
75 3300048915 Ga0496112_0063069 Ga0496112_0063069_1348_2079 241
76 3300048921 Ga0496118_0145006 Ga0496118_0145006_134_865 241
77 3300048924 Ga0496121_0003062 Ga0496121_0003062_6095_6826 241
78 3300048928 Ga0496125_0181318 Ga0496125_0181318_543_1274 241
79 3300042876 Ga0451577_0453938 Ga0451577_0453938_20_826 243
80 3300044735 Ga0466968_0087844 Ga0466968_0087844_605_1354 248
81 3300048905 Ga0496102_0295766 Ga0496102_0295766_517_1341 249
82 3300048906 Ga0496103_0119116 Ga0496103_0119116_348_1172 249
83 3300053096 Ga0500641_0024683 Ga0500641_0024683_1433_2293 249
84 3300009093 Ga0105240_10032421 Ga0105240_100324214 250
85 3300009545 Ga0105237_10013453 Ga0105237_100134534 250
86 3300010375 Ga0105239_10000061 Ga0105239_1000006162 250
87 3300025913 Ga0207695_10028291 Ga0207695_100282917 250
88 3300025914 Ga0207671_10009949 Ga0207671_100099493 250
89 3300048924 Ga0496121_0000584 Ga0496121_0000584_54803_55609 250
90 3300048929 Ga0496126_0019986 Ga0496126_0019986_3862_4668 250
91 3300005578 Ga0068854_100040544 Ga0068854_1000405442 252
92 3300025981 Ga0207640_10057741 Ga0207640_100577412 252
93 3300048921 Ga0496118_0107638 Ga0496118_0107638_520_1281 253
94 3300048924 Ga0496121_0006003 Ga0496121_0006003_1881_2687 253
95 3300009093 Ga0105240_10035796 Ga0105240_100357963 254
96 3300048920 Ga0496117_0068658 Ga0496117_0068658_58_876 254
97 3300048921 Ga0496118_0034404 Ga0496118_0034404_1338_2156 254
98 3300038443 Ga0395901_0493778 Ga0395901_0493778_47_901 255
99 3300038443 Ga0395901_0034274 Ga0395901_0034274_1774_2586 256
100 3300048907 Ga0496104_0215447 Ga0496104_0215447_721_1545 257
101 3300026078 Ga0207702_10012331 Ga0207702_100123314 258
102 3300031250 Ga0265331_10000011 Ga0265331_10000011253 258
103 3300031250 Ga0265331_10000174 Ga0265331_1000017465 258
104 3300031251 Ga0265327_10000033 Ga0265327_10000033168 258
105 3300053136 Ga0500559_0106830 Ga0500559_0106830_192_1046 258
106 3300001989 JGI24739J22299_10085331 JGI24739J22299_100853311 259
107 3300002075 JGI24738J21930_10005382 JGI24738J21930_100053823 259
108 3300002075 JGI24738J21930_10005787 JGI24738J21930_100057873 259
109 3300002459 JGI24751J29686_10003616 JGI24751J29686_100036164 259
110 3300005327 Ga0070658_10014437 Ga0070658_100144374 259
111 3300005328 Ga0070676_10039924 Ga0070676_100399241 259
112 3300005330 Ga0070690_100001067 Ga0070690_10000106714 259
113 3300005331 Ga0070670_100001783 Ga0070670_1000017832 259
114 3300005335 Ga0070666_10012602 Ga0070666_100126026 259
115 3300005336 Ga0070680_100012070 Ga0070680_1000120703 259
116 3300005338 Ga0068868_100051291 Ga0068868_1000512913 259
117 3300005339 Ga0070660_100018381 Ga0070660_1000183812 259
118 3300005340 Ga0070689_100014910 Ga0070689_1000149104 259
119 3300005340 Ga0070689_100020680 Ga0070689_1000206803 259
120 3300005341 Ga0070691_10002311 Ga0070691_100023116 259
121 3300005343 Ga0070687_100000686 Ga0070687_1000006869 259
122 3300005344 Ga0070661_100024378 Ga0070661_1000243782 259
123 3300005345 Ga0070692_10017503 Ga0070692_100175033 259
124 3300005347 Ga0070668_100009171 Ga0070668_1000091712 259
125 3300005353 Ga0070669_100001148 Ga0070669_1000011487 259
126 3300005354 Ga0070675_100001202 Ga0070675_10000120214 259
127 3300005355 Ga0070671_100001262 Ga0070671_10000126216 259
128 3300005355 Ga0070671_100450710 Ga0070671_1004507102 259
129 3300005356 Ga0070674_100005431 Ga0070674_1000054313 259
130 3300005364 Ga0070673_100000673 Ga0070673_10000067320 259
131 3300005365 Ga0070688_100005651 Ga0070688_1000056517 259
132 3300005366 Ga0070659_100005781 Ga0070659_1000057818 259
133 3300005367 Ga0070667_100001801 Ga0070667_10000180120 259
134 3300005406 Ga0070703_10057015 Ga0070703_100570151 259
135 3300005434 Ga0070709_10000225 Ga0070709_1000022545 259
136 3300005435 Ga0070714_100153766 Ga0070714_1001537662 259
137 3300005436 Ga0070713_100180342 Ga0070713_1001803422 259
138 3300005437 Ga0070710_10004828 Ga0070710_100048282 259
139 3300005438 Ga0070701_10000713 Ga0070701_100007138 259
140 3300005438 Ga0070701_10356714 Ga0070701_103567141 259
141 3300005439 Ga0070711_100000237 Ga0070711_1000002373 259
142 3300005439 Ga0070711_100020012 Ga0070711_1000200123 259
143 3300005440 Ga0070705_100002200 Ga0070705_1000022007 259
144 3300005441 Ga0070700_100009880 Ga0070700_1000098802 259
145 3300005444 Ga0070694_100015896 Ga0070694_1000158964 259
146 3300005455 Ga0070663_100000497 Ga0070663_1000004977 259
147 3300005456 Ga0070678_100003959 Ga0070678_1000039597 259
148 3300005456 Ga0070678_100233334 Ga0070678_1002333341 259
149 3300005457 Ga0070662_100004743 Ga0070662_1000047432 259
150 3300005459 Ga0068867_100022146 Ga0068867_1000221462 259
151 3300005459 Ga0068867_100029825 Ga0068867_1000298253 259
152 3300005466 Ga0070685_10163859 Ga0070685_101638592 259
153 3300005468 Ga0070707_100657140 Ga0070707_1006571402 259
154 3300005530 Ga0070679_100437285 Ga0070679_1004372852 259
155 3300005535 Ga0070684_100118086 Ga0070684_1001180863 259
156 3300005536 Ga0070697_100004352 Ga0070697_10000435210 259
157 3300005539 Ga0068853_100001129 Ga0068853_10000112920 259
158 3300005543 Ga0070672_100008366 Ga0070672_1000083662 259
159 3300005544 Ga0070686_100000710 Ga0070686_1000007107 259
160 3300005544 Ga0070686_100042171 Ga0070686_1000421712 259
161 3300005545 Ga0070695_100004563 Ga0070695_1000045639 259
162 3300005547 Ga0070693_100006067 Ga0070693_1000060674 259
163 3300005548 Ga0070665_100060047 Ga0070665_1000600473 259
164 3300005548 Ga0070665_100142799 Ga0070665_1001427993 259
165 3300005549 Ga0070704_100150630 Ga0070704_1001506302 259
166 3300005563 Ga0068855_100019337 Ga0068855_1000193375 259
167 3300005564 Ga0070664_100005810 Ga0070664_1000058102 259
168 3300005577 Ga0068857_100002722 Ga0068857_1000027223 259
169 3300005578 Ga0068854_100000389 Ga0068854_1000003892 259
170 3300005614 Ga0068856_100184065 Ga0068856_1001840652 259
171 3300005615 Ga0070702_100000088 Ga0070702_10000008827 259
172 3300005616 Ga0068852_100006411 Ga0068852_1000064116 259
173 3300005617 Ga0068859_100002269 Ga0068859_1000022695 259
174 3300005618 Ga0068864_100003629 Ga0068864_1000036296 259
175 3300005718 Ga0068866_10003168 Ga0068866_100031684 259
176 3300005718 Ga0068866_10032063 Ga0068866_100320633 259
177 3300005719 Ga0068861_100000952 Ga0068861_10000095214 259
178 3300005841 Ga0068863_100005989 Ga0068863_10000598911 259
179 3300005842 Ga0068858_100002072 Ga0068858_10000207222 259
180 3300005842 Ga0068858_100156193 Ga0068858_1001561932 259
181 3300005843 Ga0068860_100003367 Ga0068860_1000033672 259
182 3300005844 Ga0068862_100007091 Ga0068862_1000070913 259
183 3300005937 Ga0081455_10002340 Ga0081455_1000234011 259
184 3300006058 Ga0075432_10002338 Ga0075432_100023384 259
185 3300006163 Ga0070715_10000291 Ga0070715_100002912 259
186 3300006173 Ga0070716_100004593 Ga0070716_1000045935 259
187 3300006175 Ga0070712_100017594 Ga0070712_1000175944 259
188 3300006175 Ga0070712_100421939 Ga0070712_1004219391 259
189 3300006237 Ga0097621_100075501 Ga0097621_1000755013 259
190 3300006237 Ga0097621_100396944 Ga0097621_1003969442 259
191 3300006358 Ga0068871_100261337 Ga0068871_1002613372 259
192 3300006844 Ga0075428_100179302 Ga0075428_1001793022 259
193 3300006844 Ga0075428_100280105 Ga0075428_1002801052 259
194 3300006847 Ga0075431_100063494 Ga0075431_1000634942 259
195 3300006847 Ga0075431_100083929 Ga0075431_1000839296 259
196 3300006881 Ga0068865_100000212 Ga0068865_1000002128 259
197 3300006881 Ga0068865_100051030 Ga0068865_1000510303 259
198 3300006931 Ga0097620_100002269 Ga0097620_1000022695 259
199 3300007076 Ga0075435_100066788 Ga0075435_1000667882 259
200 3300009093 Ga0105240_10325602 Ga0105240_103256022 259
201 3300009098 Ga0105245_10005204 Ga0105245_100052045 259
202 3300009101 Ga0105247_10000925 Ga0105247_1000092523 259
203 3300009101 Ga0105247_10004422 Ga0105247_100044225 259
204 3300009148 Ga0105243_10000944 Ga0105243_100009442 259
205 3300009148 Ga0105243_10076635 Ga0105243_100766354 259
206 3300009174 Ga0105241_10002673 Ga0105241_1000267313 259
207 3300009176 Ga0105242_10010551 Ga0105242_100105514 259
208 3300009176 Ga0105242_10244331 Ga0105242_102443312 259
209 3300009177 Ga0105248_10014164 Ga0105248_100141649 259
210 3300009545 Ga0105237_10018843 Ga0105237_100188432 259
211 3300009551 Ga0105238_10024390 Ga0105238_100243902 259
212 3300009551 Ga0105238_10798593 Ga0105238_107985931 259
213 3300009553 Ga0105249_10001629 Ga0105249_1000162921 259
214 3300010375 Ga0105239_10002915 Ga0105239_1000291522 259
215 3300013102 Ga0157371_10003718 Ga0157371_1000371810 259
216 3300013104 Ga0157370_10089043 Ga0157370_100890432 259
217 3300013105 Ga0157369_10011006 Ga0157369_100110065 259
218 3300013297 Ga0157378_10020157 Ga0157378_100201572 259
219 3300013306 Ga0163162_10021988 Ga0163162_100219883 259
220 3300013307 Ga0157372_10387544 Ga0157372_103875442 259
221 3300013308 Ga0157375_10019727 Ga0157375_100197274 259
222 3300013308 Ga0157375_10047224 Ga0157375_100472243 259
223 3300014325 Ga0163163_10004874 Ga0163163_100048742 259
224 3300014326 Ga0157380_10051629 Ga0157380_100516294 259
225 3300014326 Ga0157380_10622613 Ga0157380_106226131 259
226 3300014968 Ga0157379_10008925 Ga0157379_100089252 259
227 3300014969 Ga0157376_10001406 Ga0157376_1000140615 259
228 3300014969 Ga0157376_10088766 Ga0157376_100887664 259
229 3300014969 Ga0157376_10314511 Ga0157376_103145112 259
230 3300017792 Ga0163161_10006732 Ga0163161_100067327 259
231 3300020080 Ga0206350_10761787 Ga0206350_107617871 259
232 3300020082 Ga0206353_11192685 Ga0206353_111926852 259
233 3300025898 Ga0207692_10006907 Ga0207692_100069072 259
234 3300025899 Ga0207642_10088722 Ga0207642_100887222 259
235 3300025900 Ga0207710_10006074 Ga0207710_100060745 259
236 3300025901 Ga0207688_10000228 Ga0207688_100002288 259
237 3300025904 Ga0207647_10024669 Ga0207647_100246692 259
238 3300025906 Ga0207699_10011962 Ga0207699_100119622 259
239 3300025907 Ga0207645_10037958 Ga0207645_100379582 259
240 3300025909 Ga0207705_10116461 Ga0207705_101164613 259
241 3300025911 Ga0207654_10054904 Ga0207654_100549042 259
242 3300025914 Ga0207671_10086897 Ga0207671_100868972 259
243 3300025915 Ga0207693_10000892 Ga0207693_100008922 259
244 3300025916 Ga0207663_10031899 Ga0207663_100318993 259
245 3300025916 Ga0207663_10049466 Ga0207663_100494663 259
246 3300025916 Ga0207663_10467532 Ga0207663_104675322 259
247 3300025917 Ga0207660_10065099 Ga0207660_100650992 259
248 3300025918 Ga0207662_10037004 Ga0207662_100370043 259
249 3300025919 Ga0207657_10001202 Ga0207657_1000120233 259
250 3300025920 Ga0207649_10012336 Ga0207649_100123364 259
251 3300025923 Ga0207681_10009481 Ga0207681_100094817 259
252 3300025924 Ga0207694_10221846 Ga0207694_102218462 259
253 3300025925 Ga0207650_10057422 Ga0207650_100574222 259
254 3300025926 Ga0207659_10041103 Ga0207659_100411034 259
255 3300025928 Ga0207700_10353209 Ga0207700_103532092 259
256 3300025931 Ga0207644_10087576 Ga0207644_100875762 259
257 3300025931 Ga0207644_10277669 Ga0207644_102776692 259
258 3300025932 Ga0207690_10010127 Ga0207690_100101274 259
259 3300025933 Ga0207706_10001092 Ga0207706_100010922 259
260 3300025934 Ga0207686_10004463 Ga0207686_100044633 259
261 3300025935 Ga0207709_10058117 Ga0207709_100581173 259
262 3300025936 Ga0207670_10023914 Ga0207670_100239144 259
263 3300025937 Ga0207669_10008343 Ga0207669_100083434 259
264 3300025937 Ga0207669_10290350 Ga0207669_102903502 259
265 3300025938 Ga0207704_10009531 Ga0207704_100095313 259
266 3300025938 Ga0207704_10034048 Ga0207704_100340482 259
267 3300025939 Ga0207665_10000425 Ga0207665_100004255 259
268 3300025940 Ga0207691_10004113 Ga0207691_100041132 259
269 3300025942 Ga0207689_10030460 Ga0207689_100304602 259
270 3300025949 Ga0207667_10045930 Ga0207667_100459302 259
271 3300025960 Ga0207651_10154178 Ga0207651_101541782 259
272 3300025960 Ga0207651_10595373 Ga0207651_105953731 259
273 3300025961 Ga0207712_10045059 Ga0207712_100450593 259
274 3300025986 Ga0207658_10042530 Ga0207658_100425304 259
275 3300026023 Ga0207677_10171348 Ga0207677_101713482 259
276 3300026035 Ga0207703_10238087 Ga0207703_102380872 259
277 3300026035 Ga0207703_10475671 Ga0207703_104756712 259
278 3300026041 Ga0207639_10101450 Ga0207639_101014502 259
279 3300026067 Ga0207678_10000884 Ga0207678_1000088433 259
280 3300026075 Ga0207708_10000785 Ga0207708_1000078527 259
281 3300026078 Ga0207702_10081619 Ga0207702_100816193 259
282 3300026088 Ga0207641_10028432 Ga0207641_100284324 259
283 3300026089 Ga0207648_10035757 Ga0207648_100357574 259
284 3300026089 Ga0207648_10042087 Ga0207648_100420874 259
285 3300026095 Ga0207676_10142969 Ga0207676_101429691 259
286 3300026116 Ga0207674_10008209 Ga0207674_1000820912 259
287 3300026118 Ga0207675_100000933 Ga0207675_1000009338 259
288 3300026121 Ga0207683_10000861 Ga0207683_1000086133 259
289 3300026121 Ga0207683_10262629 Ga0207683_102626291 259
290 3300026142 Ga0207698_10118754 Ga0207698_101187543 259
291 3300027907 Ga0207428_10057278 Ga0207428_100572783 259
292 3300028379 Ga0268266_10048304 Ga0268266_100483043 259
293 3300028379 Ga0268266_10061755 Ga0268266_100617552 259
294 3300028381 Ga0268264_10170230 Ga0268264_101702302 259
295 3300034820 Ga0373959_0013897 Ga0373959_0013897_156_971 259
296 3300035112 Ga0373932_0003154 Ga0373932_0003154_897_1712 259
297 3300035121 Ga0373960_0048770 Ga0373960_0048770_380_1195 259
298 3300035691 Ga0373931_0015060 Ga0373931_0015060_2108_2923 259
299 3300037312 Ga0395899_0078527 Ga0395899_0078527_459_1274 259
300 3300037418 Ga0395900_0071187 Ga0395900_0071187_187_1002 259
301 3300037466 Ga0395898_0020596 Ga0395898_0020596_23_838 259
302 3300037471 Ga0395905_0001310 Ga0395905_0001310_3040_3855 259
303 3300048903 Ga0496100_0000708 Ga0496100_0000708_2478_3293 259
304 3300048903 Ga0496100_0005222 Ga0496100_0005222_554_1369 259
305 3300048904 Ga0496101_0003342 Ga0496101_0003342_735_1550 259
306 3300048904 Ga0496101_0082735 Ga0496101_0082735_754_1569 259
307 3300048907 Ga0496104_0037697 Ga0496104_0037697_2894_3709 259
308 3300048908 Ga0496105_0010926 Ga0496105_0010926_4935_5750 259
309 3300048908 Ga0496105_0010968 Ga0496105_0010968_5306_6121 259
310 3300048909 Ga0496106_0021658 Ga0496106_0021658_1269_2084 259
311 3300048910 Ga0496107_0002333 Ga0496107_0002333_10548_11363 259
312 3300048910 Ga0496107_0105412 Ga0496107_0105412_1158_1973 259
313 3300048912 Ga0496109_0351463 Ga0496109_0351463_24_839 259
314 3300048913 Ga0496110_0117055 Ga0496110_0117055_807_1622 259
315 3300048914 Ga0496111_0244753 Ga0496111_0244753_253_1068 259
316 3300048916 Ga0496113_0056194 Ga0496113_0056194_998_1813 259
317 3300048917 Ga0496114_0003732 Ga0496114_0003732_7163_7978 259
318 3300048918 Ga0496115_0008983 Ga0496115_0008983_3087_3902 259
319 3300048922 Ga0496119_0074377 Ga0496119_0074377_722_1549 259
320 3300049568 Ga0501031_0081328 Ga0501031_0081328_211_1026 259
321 3300049568 Ga0501031_0327436 Ga0501031_0327436_152_982 259
322 3300049570 Ga0501033_0100749 Ga0501033_0100749_959_1774 259
323 3300049572 Ga0501036_0064728 Ga0501036_0064728_605_1420 259
324 3300049573 Ga0501037_0116705 Ga0501037_0116705_768_1583 259
325 3300049574 Ga0501038_0274974 Ga0501038_0274974_435_1265 259
326 3300049577 Ga0501041_0057755 Ga0501041_0057755_475_1290 259
327 3300049578 Ga0501042_0075597 Ga0501042_0075597_510_1325 259
328 3300049583 Ga0501067_0066717 Ga0501067_0066717_352_1167 259
329 3300049587 Ga0501071_0047305 Ga0501071_0047305_1747_2562 259
330 3300049588 Ga0501072_0018262 Ga0501072_0018262_4200_5015 259
331 3300049588 Ga0501072_0058233 Ga0501072_0058233_2056_2886 259
332 3300049589 Ga0501073_0216997 Ga0501073_0216997_461_1276 259
333 3300049590 Ga0501074_0153565 Ga0501074_0153565_44_859 259
334 3300049591 Ga0501075_0256646 Ga0501075_0256646_38_868 259
335 3300049593 Ga0501077_0094708 Ga0501077_0094708_408_1238 259
336 3300049741 Ga0501079_0020026 Ga0501079_0020026_798_1613 259
337 3300049741 Ga0501079_0089428 Ga0501079_0089428_1312_2127 259
338 3300049741 Ga0501079_0098353 Ga0501079_0098353_340_1170 259
339 3300049742 Ga0501080_0342734 Ga0501080_0342734_408_1223 259
340 3300049743 Ga0501081_0039210 Ga0501081_0039210_1023_1838 259
341 3300049743 Ga0501081_0057692 Ga0501081_0057692_375_1205 259
342 3300049744 Ga0501083_0153275 Ga0501083_0153275_294_1124 259
343 3300049824 Ga0501045_0022544 Ga0501045_0022544_3277_4092 259
344 3300049824 Ga0501045_0082910 Ga0501045_0082910_1114_1929 259
345 3300050507 nmdc:mga05p37_212082_c1 nmdc:mga05p37_212082_c1_292_1107 259
346 3300050508 nmdc:mga09592_21340_c1 nmdc:mga09592_21340_c1_1232_2047 259
347 3300050510 nmdc:mga06r32_5167_c1 nmdc:mga06r32_5167_c1_712_1527 259
348 3300050512 nmdc:mga0n895_22696_c1 nmdc:mga0n895_22696_c1_2331_3146 259
349 3300050513 nmdc:mga0rr50_96200_c1 nmdc:mga0rr50_96200_c1_377_1192 259
350 3300050514 nmdc:mga08x19_28878_c1 nmdc:mga08x19_28878_c1_685_1500 259
351 3300050515 nmdc:mga0a205_188743_c1 nmdc:mga0a205_188743_c1_976_1791 259
352 3300054114 Ga0501084_0145879 Ga0501084_0145879_330_1145 259
353 3300060353 Ga0501082_0102006 Ga0501082_0102006_1157_1987 259
354 3300061734 Ga0530510_0005091 Ga0530510_0005091_3610_4425 259
355 3300061734 Ga0530510_0024622 Ga0530510_0024622_2851_3681 259
356 3300009148 Ga0105243_10310985 Ga0105243_103109852 260
357 3300009177 Ga0105248_10061651 Ga0105248_100616512 260
358 3300025935 Ga0207709_10000098 Ga0207709_1000009832 260
359 3300025941 Ga0207711_10036601 Ga0207711_100366012 260
360 3300025981 Ga0207640_10005890 Ga0207640_100058904 260
361 3300028786 Ga0307517_10048134 Ga0307517_100481343 260
362 3300039438 Ga0436360_1335011 Ga0436360_1335011_375_1259 260
363 3300046684 Ga0495669_0008727 Ga0495669_0008727_987_1805 260
364 3300003791 Ga0055530_10000020 Ga0055530_1000002074 261
365 3300003794 Ga0055531_10000184 Ga0055531_100001849 261
366 3300009148 Ga0105243_10000055 Ga0105243_1000005513 261
367 3300013104 Ga0157370_10000034 Ga0157370_10000034120 261
368 3300025298 Ga0209050_1000186 Ga0209050_100018694 261
369 3300025304 Ga0209257_1000211 Ga0209257_100021181 261
370 3300048929 Ga0496126_0019393 Ga0496126_0019393_23_850 261
371 3300047469 Ga0495673_0028465 Ga0495673_0028465_412_1263 263
372 3300047472 Ga0495686_0000103 Ga0495686_0000103_162007_162858 263
373 3300048926 Ga0496123_0083226 Ga0496123_0083226_726_1577 263
374 3300025935 Ga0207709_10196513 Ga0207709_101965132 264
375 3300049570 Ga0501033_0062413 Ga0501033_0062413_1456_2298 264
376 3300049579 Ga0501043_0034123 Ga0501043_0034123_237_1079 264
377 3300049822 Ga0501035_0152905 Ga0501035_0152905_102_944 264
378 3300049823 Ga0501044_0016818 Ga0501044_0016818_6466_7308 264
379 3300005327 Ga0070658_10140243 Ga0070658_101402432 266
380 3300009551 Ga0105238_10276667 Ga0105238_102766672 266
381 3300021384 Ga0213876_10135459 Ga0213876_101354591 266
382 3300001991 JGI24743J22301_10027664 JGI24743J22301_100276641 270
383 3300002067 JGI24735J21928_10001761 JGI24735J21928_100017617 270
384 3300003214 JGI25165J46597_1000120 JGI25165J46597_100012020 270
385 3300005327 Ga0070658_10010382 Ga0070658_100103823 270
386 3300005328 Ga0070676_10005613 Ga0070676_100056139 270
387 3300005334 Ga0068869_100000110 Ga0068869_10000011029 270
388 3300005338 Ga0068868_100000016 Ga0068868_100000016101 270
389 3300005364 Ga0070673_100000017 Ga0070673_10000001755 270
390 3300005366 Ga0070659_100561206 Ga0070659_1005612061 270
391 3300005459 Ga0068867_100000013 Ga0068867_10000001355 270
392 3300005543 Ga0070672_100082847 Ga0070672_1000828473 270
393 3300005614 Ga0068856_100004302 Ga0068856_10000430212 270
394 3300006881 Ga0068865_100000007 Ga0068865_100000007166 270
395 3300013104 Ga0157370_10003964 Ga0157370_100039647 270
396 3300013105 Ga0157369_10196415 Ga0157369_101964152 270
397 3300025231 Ga0207427_105219 Ga0207427_1052192 270
398 3300025254 Ga0209148_1000870 Ga0209148_100087010 270
399 3300025261 Ga0209233_1000003 Ga0209233_10000031462 270
400 3300025272 Ga0209455_1000386 Ga0209455_100038614 270
401 3300025904 Ga0207647_10104890 Ga0207647_101048902 270
402 3300025907 Ga0207645_10002366 Ga0207645_1000236610 270
403 3300025909 Ga0207705_10002530 Ga0207705_100025309 270
404 3300025919 Ga0207657_10125816 Ga0207657_101258163 270
405 3300025927 Ga0207687_10008499 Ga0207687_100084999 270
406 3300025934 Ga0207686_10000752 Ga0207686_1000075215 270
407 3300025935 Ga0207709_10000306 Ga0207709_100003067 270
408 3300025938 Ga0207704_10000017 Ga0207704_1000001724 270
409 3300025940 Ga0207691_10130816 Ga0207691_101308163 270
410 3300025942 Ga0207689_10001243 Ga0207689_1000124315 270
411 3300025960 Ga0207651_10000011 Ga0207651_1000001126 270
412 3300025961 Ga0207712_10095203 Ga0207712_100952032 270
413 3300026023 Ga0207677_10000191 Ga0207677_100001919 270
414 3300026078 Ga0207702_10001090 Ga0207702_1000109020 270
415 3300026089 Ga0207648_10000045 Ga0207648_1000004568 270
416 3300037312 Ga0395899_0003884 Ga0395899_0003884_7201_8013 270
417 3300037418 Ga0395900_0201524 Ga0395900_0201524_411_1223 270
418 3300005563 Ga0068855_100826492 Ga0068855_1008264922 272
419 3300009098 Ga0105245_10001075 Ga0105245_1000107514 272
420 3300009148 Ga0105243_10000118 Ga0105243_1000011850 272
421 3300009176 Ga0105242_10000221 Ga0105242_1000022110 272
422 3300009553 Ga0105249_10038859 Ga0105249_100388594 272
423 3300011119 Ga0105246_10000135 Ga0105246_1000013519 272
424 3300013296 Ga0157374_10000189 Ga0157374_1000018915 272
425 3300013297 Ga0157378_10003688 Ga0157378_1000368816 272
426 3300013307 Ga0157372_10115937 Ga0157372_101159374 272
427 3300013308 Ga0157375_10000436 Ga0157375_1000043650 272
428 3300014969 Ga0157376_10000081 Ga0157376_1000008168 272
429 3300026142 Ga0207698_10222480 Ga0207698_102224802 272
430 3300002067 JGI24735J21928_10033129 JGI24735J21928_100331292 273
431 3300005339 Ga0070660_100000103 Ga0070660_1000001039 273
432 3300005548 Ga0070665_100537097 Ga0070665_1005370972 273
433 3300025919 Ga0207657_10000243 Ga0207657_1000024314 273
434 3300028379 Ga0268266_10466447 Ga0268266_104664472 273
435 3300048920 Ga0496117_0054615 Ga0496117_0054615_1409_2236 273
436 3300048925 Ga0496122_0064878 Ga0496122_0064878_559_1380 273
437 3300013100 Ga0157373_10309433 Ga0157373_103094332 274
438 3300048920 Ga0496117_0092267 Ga0496117_0092267_391_1215 274
439 3300048923 Ga0496120_0008788 Ga0496120_0008788_1387_2211 274
440 3300001904 JGI24736J21556_1014123 JGI24736J21556_10141232 275
441 3300001979 JGI24740J21852_10059448 JGI24740J21852_100594481 275
442 3300001989 JGI24739J22299_10004810 JGI24739J22299_100048102 275
443 3300001989 JGI24739J22299_10023874 JGI24739J22299_100238742 275
444 3300001989 JGI24739J22299_10065670 JGI24739J22299_100656702 275
445 3300001990 JGI24737J22298_10001866 JGI24737J22298_100018664 275
446 3300001990 JGI24737J22298_10019416 JGI24737J22298_100194163 275
447 3300002067 JGI24735J21928_10006888 JGI24735J21928_100068883 275
448 3300002067 JGI24735J21928_10043054 JGI24735J21928_100430542 275
449 3300002075 JGI24738J21930_10001232 JGI24738J21930_100012323 275
450 3300002075 JGI24738J21930_10008922 JGI24738J21930_100089223 275
451 3300003316 rootH1_10024748 rootH1_100247483 275
452 3300003323 rootH1_10022509 rootH1_100225092 275
453 3300003762 Ga0055542_1005275 Ga0055542_10052754 275
454 3300005327 Ga0070658_10000624 Ga0070658_1000062417 275
455 3300005327 Ga0070658_10061105 Ga0070658_100611053 275
456 3300005327 Ga0070658_10137302 Ga0070658_101373022 275
457 3300005339 Ga0070660_100000383 Ga0070660_10000038322 275
458 3300005339 Ga0070660_100416669 Ga0070660_1004166692 275
459 3300005354 Ga0070675_100124054 Ga0070675_1001240542 275
460 3300005354 Ga0070675_100266571 Ga0070675_1002665712 275
461 3300005355 Ga0070671_100021924 Ga0070671_1000219244 275
462 3300005356 Ga0070674_100216712 Ga0070674_1002167122 275
463 3300005364 Ga0070673_100518509 Ga0070673_1005185091 275
464 3300005366 Ga0070659_100355476 Ga0070659_1003554762 275
465 3300005455 Ga0070663_100002166 Ga0070663_1000021665 275
466 3300005539 Ga0068853_100008844 Ga0068853_1000088445 275
467 3300005563 Ga0068855_100000911 Ga0068855_1000009114 275
468 3300005564 Ga0070664_100377769 Ga0070664_1003777691 275
469 3300005577 Ga0068857_100005194 Ga0068857_1000051944 275
470 3300005578 Ga0068854_100000411 Ga0068854_1000004118 275
471 3300005578 Ga0068854_100066331 Ga0068854_1000663313 275
472 3300005616 Ga0068852_100001585 Ga0068852_10000158513 275
473 3300005834 Ga0068851_10125032 Ga0068851_101250321 275
474 3300006237 Ga0097621_100004755 Ga0097621_1000047554 275
475 3300006358 Ga0068871_100004770 Ga0068871_1000047707 275
476 3300009148 Ga0105243_10318505 Ga0105243_103185052 275
477 3300009545 Ga0105237_10035271 Ga0105237_100352714 275
478 3300009545 Ga0105237_10527021 Ga0105237_105270212 275
479 3300010375 Ga0105239_10014039 Ga0105239_100140395 275
480 3300010375 Ga0105239_10152467 Ga0105239_101524672 275
481 3300013100 Ga0157373_10005027 Ga0157373_100050277 275
482 3300013102 Ga0157371_10028109 Ga0157371_100281091 275
483 3300013104 Ga0157370_10215493 Ga0157370_102154931 275
484 3300013105 Ga0157369_10063218 Ga0157369_100632183 275
485 3300013105 Ga0157369_10689282 Ga0157369_106892822 275
486 3300013306 Ga0163162_10083703 Ga0163162_100837033 275
487 3300013307 Ga0157372_10010820 Ga0157372_100108205 275
488 3300013307 Ga0157372_10124262 Ga0157372_101242624 275
489 3300025254 Ga0209148_1000074 Ga0209148_1000074151 275
490 3300025904 Ga0207647_10007853 Ga0207647_100078536 275
491 3300025904 Ga0207647_10008621 Ga0207647_100086212 275
492 3300025909 Ga0207705_10000110 Ga0207705_1000011052 275
493 3300025909 Ga0207705_10000651 Ga0207705_100006511 275
494 3300025914 Ga0207671_10418867 Ga0207671_104188671 275
495 3300025919 Ga0207657_10001089 Ga0207657_100010892 275
496 3300025919 Ga0207657_10051274 Ga0207657_100512744 275
497 3300025924 Ga0207694_10197102 Ga0207694_101971022 275
498 3300025926 Ga0207659_10637045 Ga0207659_106370452 275
499 3300025932 Ga0207690_10245082 Ga0207690_102450822 275
500 3300025932 Ga0207690_10270614 Ga0207690_102706142 275
501 3300025933 Ga0207706_10013905 Ga0207706_100139055 275
502 3300025933 Ga0207706_10048329 Ga0207706_100483293 275
503 3300025933 Ga0207706_10163349 Ga0207706_101633492 275
504 3300025937 Ga0207669_10184976 Ga0207669_101849762 275
505 3300025938 Ga0207704_10522903 Ga0207704_105229031 275
506 3300025949 Ga0207667_10000016 Ga0207667_10000016376 275
507 3300025981 Ga0207640_10000131 Ga0207640_1000013142 275
508 3300025981 Ga0207640_10231806 Ga0207640_102318062 275
509 3300026041 Ga0207639_10005848 Ga0207639_100058487 275
510 3300026067 Ga0207678_10006173 Ga0207678_100061736 275
511 3300026067 Ga0207678_10076919 Ga0207678_100769193 275
512 3300026116 Ga0207674_10009324 Ga0207674_100093244 275
513 3300026142 Ga0207698_10000978 Ga0207698_100009789 275
514 3300037471 Ga0395905_0004503 Ga0395905_0004503_13021_13848 275
515 3300037471 Ga0395905_0178392 Ga0395905_0178392_261_1088 275
516 3300038443 Ga0395901_0106017 Ga0395901_0106017_902_1729 275
517 3300042005 Ga0439448_0000929 Ga0439448_0000929_143_970 275
518 3300042005 Ga0439448_0028997 Ga0439448_0028997_308_1135 275
519 3300042012 Ga0439455_0000548 Ga0439455_0000548_4112_4939 275
520 3300042157 Ga0439458_0001087 Ga0439458_0001087_3760_4587 275
521 3300042157 Ga0439458_0003748 Ga0439458_0003748_2458_3285 275
522 3300044658 Ga0466972_0003234 Ga0466972_0003234_5672_6499 275
523 3300044693 Ga0466961_0042870 Ga0466961_0042870_1943_2770 275
524 3300044706 Ga0466964_0001445 Ga0466964_0001445_4079_4906 275
525 3300044735 Ga0466968_0037600 Ga0466968_0037600_559_1386 275
526 3300044765 Ga0466970_0064229 Ga0466970_0064229_813_1640 275
527 3300044842 Ga0466957_0046086 Ga0466957_0046086_1057_1884 275
528 3300044901 Ga0466960_0001751 Ga0466960_0001751_5243_6070 275
529 3300045049 Ga0466959_0098432 Ga0466959_0098432_445_1272 275
530 3300045836 Ga0466958_0082289 Ga0466958_0082289_235_1062 275
531 3300045976 Ga0466967_0339681 Ga0466967_0339681_99_926 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01292

Ni_hydr_CYTB

Prokaryotic cytochrome b561

50

293

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gd3-assembly1.cif.gz_A structure of e. coli hydrogenase-1 in complex with cytochrome b 0.6318 10 247
1b77-assembly1.cif.gz_B building a replisome structure from interacting pieces: a sliding clamp complexed with an interaction peptide from dna polymerase 0.5961 59 100
4gd3-assembly1.cif.gz_A structure of e. coli hydrogenase-1 in complex with cytochrome b 0.59 10 247
4zce-assembly1.cif.gz_B crystal structure of the dust mite allergen der p 23 from dermatophagoides pteronyssinus 0.5432 56 95
5hbf-assembly3.cif.gz_B crystal structure of human full-length chitotriosidase (chit1) 0.5381 59 95
ID Description Score Start End Superfamily
af_P0AEL0_1_211_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.7605 5 265 1.20.950.20
af_P77409_60_261_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.7567 5 266 1.20.950.20
af_P77409_60_261_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.7466 5 266 1.20.950.20
af_P0AEL0_1_211_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.6755 5 265 1.20.950.20
4gd3B00 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.6294 10 247 1.20.950.20
ID Description Score Start End GO Terms
AF-A0A7W7B335-F1-model_v4 Thiosulfate reductase cytochrome b subunit 0.9526 8 271 GO:0005886
GO:0009055
GO:0020037
GO:0022904
AF-A0A7W7B335-F1-model_v4 Thiosulfate reductase cytochrome b subunit 0.9456 8 271 GO:0005886
GO:0009055
GO:0020037
GO:0022904
AF-M2U702-F1-model_v4 Thiosulfate reductase cytochrome B subunit (Membrane anchoring protein) 0.9446 10 271 GO:0005886
GO:0009055
GO:0020037
GO:0022904
AF-A0A0Q4HT26-F1-model_v4 HupC 0.9445 8 269 GO:0005506
GO:0005886
GO:0009055
GO:0020037
GO:0022904
AF-A0A1W9HAX4-F1-model_v4 Cytochrome b561 bacterial/Ni-hydrogenase domain-containing protein 0.9407 15 270 GO:0005886
GO:0009055
GO:0020037
GO:0022904

Feature Viewer

pLDDT pTM Quality
86.84 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map