F460012

General Info

Members Datasets Scaffolds Average Seq Length
530 256 1060 235

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_0395677|Ga0496111_0395677_29_865
Length 278
Sequence MAPRPASVVASARPMPREAPVISARVPGVSCMGAEPITMILMTTDQATVAEEEYLQTLFWLQEAGLPMTGANVARAMQLSPPTVHEMIGRLERDGYITRAGDKTISFTGTGAEHAEGVVRRHRLIERFLTDVLGIPWDEVHEEAERLEHAMSPVLEERMLAAIGDAKTCPHGHPIVAGTRIEGVPLADVAEGATVKVLRLENEAEDLLHYLKDAGLDPGLEATVRGDEGDEVVLQAGGREVRVLRTVAETVSVVADPSPPPRVALPEQLVLARDRYGR

Samples

Sample ID Description Type Environment
1 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
96 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
148 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
169 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
170 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
195 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
225 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
239 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
249 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
250 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
253 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.02
Nodule 0
Rhizoplane 13.77
Rhizosphere 76.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496111_0395677 3300048914 Bacteria 1021
2 JGI24737J22298_10053049 3300001990 Bacteria 1228
3 JGI24743J22301_10030084 3300001991 Bacteria 1067
4 Ga0070658_10057391 3300005327 Bacteria 3167
5 Ga0070683_100031485 3300005329 Bacteria 4823
6 Ga0070690_100252218 3300005330 Bacteria 1248
7 Ga0070670_100218241 3300005331 Bacteria 1659
8 Ga0070670_100373694 3300005331 Bacteria 1255
9 Ga0068869_100007594 3300005334 Bacteria 6938
10 Ga0068869_100144175 3300005334 Bacteria 1842
11 Ga0068869_100211138 3300005334 Bacteria 1534
12 Ga0068869_100523599 3300005334 Bacteria 993
13 Ga0070680_100134667 3300005336 Bacteria 2069
14 Ga0070682_100004120 3300005337 Bacteria 8064
15 Ga0070682_100068720 3300005337 Bacteria 2261
16 Ga0070682_100518496 3300005337 Bacteria 927
17 Ga0068868_100027653 3300005338 Bacteria 4327
18 Ga0068868_100069475 3300005338 Bacteria 2807
19 Ga0068868_100103784 3300005338 Bacteria 2303
20 Ga0068868_100363461 3300005338 Bacteria 1242
21 Ga0070660_100004708 3300005339 Bacteria 9447
22 Ga0070660_100009841 3300005339 Bacteria 6742
23 Ga0070689_100135012 3300005340 Bacteria 1981
24 Ga0070689_100347380 3300005340 Bacteria 1243
25 Ga0070691_10029887 3300005341 Bacteria 2551
26 Ga0070687_100209711 3300005343 Bacteria 1186
27 Ga0070661_100082927 3300005344 Bacteria 2368
28 Ga0070692_10020284 3300005345 Bacteria 3222
29 Ga0070668_100023054 3300005347 Bacteria 4706
30 Ga0070668_100435354 3300005347 Bacteria 1125
31 Ga0070669_100143533 3300005353 Bacteria 1842
32 Ga0070669_100505484 3300005353 Bacteria 1003
33 Ga0070675_100039435 3300005354 Bacteria 3854
34 Ga0070674_100335396 3300005356 Bacteria 1216
35 Ga0070673_100100154 3300005364 Bacteria 2385
36 Ga0070673_100533913 3300005364 Bacteria 1064
37 Ga0070659_100003019 3300005366 Bacteria 11976
38 Ga0070709_10023066 3300005434 Bacteria 3649
39 Ga0070709_10188854 3300005434 Bacteria 1452
40 Ga0070714_100039700 3300005435 Bacteria 3963
41 Ga0070713_100031055 3300005436 Bacteria 4250
42 Ga0070713_100276084 3300005436 Bacteria 1540
43 Ga0070701_10028541 3300005438 Bacteria 2743
44 Ga0070701_10152756 3300005438 Bacteria 1331
45 Ga0070701_10219933 3300005438 Bacteria 1132
46 Ga0070711_100069206 3300005439 Bacteria 2482
47 Ga0070711_100200156 3300005439 Bacteria 1541
48 Ga0070705_100148694 3300005440 Bacteria 1551
49 Ga0070700_100002205 3300005441 Bacteria 9900
50 Ga0070700_100031082 3300005441 Bacteria 3196
51 Ga0070700_100042244 3300005441 Bacteria 2798
52 Ga0070663_100023670 3300005455 Bacteria 4120
53 Ga0070663_100091537 3300005455 Bacteria 2254
54 Ga0070678_100177915 3300005456 Bacteria 1739
55 Ga0070678_100193029 3300005456 Bacteria 1675
56 Ga0070662_100008035 3300005457 Bacteria 6865
57 Ga0068867_100036585 3300005459 Bacteria 3565
58 Ga0068867_100153995 3300005459 Bacteria 1808
59 Ga0070685_10062810 3300005466 Bacteria 2179
60 Ga0070685_10087989 3300005466 Bacteria 1875
61 Ga0070685_10102425 3300005466 Bacteria 1750
62 Ga0070684_100011844 3300005535 Bacteria 6962
63 Ga0070684_100018710 3300005535 Bacteria 5713
64 Ga0070672_100036382 3300005543 Bacteria 3750
65 Ga0070672_100315994 3300005543 Bacteria 1327
66 Ga0070686_100088327 3300005544 Bacteria 2068
67 Ga0070696_100356624 3300005546 Bacteria 1134
68 Ga0070696_100398159 3300005546 Bacteria 1077
69 Ga0070693_100014921 3300005547 Bacteria 3994
70 Ga0070665_100273536 3300005548 Bacteria 1691
71 Ga0070664_100036777 3300005564 Bacteria 4113
72 Ga0070664_100072587 3300005564 Bacteria 2952
73 Ga0070664_100534184 3300005564 Bacteria 1083
74 Ga0068854_100017097 3300005578 Bacteria 4850
75 Ga0068854_100161695 3300005578 Bacteria 1735
76 Ga0068854_100266935 3300005578 Bacteria 1372
77 Ga0068854_100316220 3300005578 Bacteria 1267
78 Ga0068856_100127804 3300005614 Bacteria 2545
79 Ga0068856_100130704 3300005614 Bacteria 2515
80 Ga0070702_100029382 3300005615 Bacteria 2988
81 Ga0068852_100071300 3300005616 Bacteria 3050
82 Ga0068852_100190170 3300005616 Bacteria 1936
83 Ga0068852_100962955 3300005616 Bacteria 872
84 Ga0068859_100166049 3300005617 Bacteria 2287
85 Ga0068864_100290764 3300005618 Bacteria 1528
86 Ga0068866_10101729 3300005718 Bacteria 1586
87 Ga0068861_100017159 3300005719 Bacteria 5133
88 Ga0068851_10033667 3300005834 Bacteria 2555
89 Ga0068851_10069759 3300005834 Bacteria 1816
90 Ga0068863_100673422 3300005841 Bacteria 1027
91 Ga0068860_100100960 3300005843 Bacteria 2753
92 Ga0068860_100150765 3300005843 Bacteria 2239
93 Ga0068862_100059079 3300005844 Bacteria 3291
94 Ga0081455_10033611 3300005937 Bacteria 4606
95 Ga0081455_10268255 3300005937 Bacteria 1240
96 Ga0081538_10056536 3300005981 Bacteria 2297
97 Ga0081540_1001136 3300005983 Bacteria 23508
98 Ga0081539_10007026 3300005985 Bacteria 10441
99 Ga0070717_10349651 3300006028 Bacteria 1321
100 Ga0070717_10475891 3300006028 Bacteria 1127
101 Ga0075365_10000613 3300006038 Bacteria 14040
102 Ga0075363_100035035 3300006048 Bacteria 2624
103 Ga0075364_10029765 3300006051 Bacteria 3502
104 Ga0075364_10352956 3300006051 Bacteria 1002
105 Ga0070716_100042737 3300006173 Bacteria 2531
106 Ga0070716_100320504 3300006173 Bacteria 1086
107 Ga0070712_100000291 3300006175 Bacteria 28230
108 Ga0070712_100003623 3300006175 Bacteria 9526
109 Ga0070712_100029181 3300006175 Bacteria 3696
110 Ga0070712_100029630 3300006175 Bacteria 3671
111 Ga0070712_100040857 3300006175 Bacteria 3182
112 Ga0070712_100143208 3300006175 Bacteria 1827
113 Ga0070712_100461151 3300006175 Bacteria 1060
114 Ga0070712_100502498 3300006175 Bacteria 1016
115 Ga0075362_10200822 3300006177 Bacteria 970
116 Ga0075433_10001496 3300006852 Bacteria 17263
117 Ga0075434_100285857 3300006871 Bacteria 1669
118 Ga0075434_100517388 3300006871 Bacteria 1214
119 Ga0068865_100033938 3300006881 Bacteria 3420
120 Ga0068865_100116593 3300006881 Bacteria 1978
121 Ga0097620_100166042 3300006931 Bacteria 2287
122 Ga0111539_10033829 3300009094 Bacteria 6202
123 Ga0111539_10035535 3300009094 Bacteria 6032
124 Ga0111539_10218612 3300009094 Bacteria 2219
125 Ga0111539_10273152 3300009094 Bacteria 1967
126 Ga0105245_10003774 3300009098 Bacteria 13482
127 Ga0105247_10245008 3300009101 Bacteria 1223
128 Ga0114129_10347664 3300009147 Bacteria 1965
129 Ga0105243_10048567 3300009148 Bacteria 3346
130 Ga0105243_10255602 3300009148 Bacteria 1566
131 Ga0105241_10338434 3300009174 Bacteria 1303
132 Ga0105242_10146820 3300009176 Bacteria 2052
133 Ga0105242_10180637 3300009176 Bacteria 1861
134 Ga0105242_10457447 3300009176 Bacteria 1204
135 Ga0105242_11107773 3300009176 Bacteria 806
136 Ga0105248_10112321 3300009177 Bacteria 3073
137 Ga0105237_10008164 3300009545 Bacteria 11370
138 Ga0105237_10280665 3300009545 Bacteria 1668
139 Ga0105237_10380303 3300009545 Bacteria 1417
140 Ga0105237_10725828 3300009545 Bacteria 1000
141 Ga0105237_10731224 3300009545 Bacteria 996
142 Ga0105238_10689150 3300009551 Bacteria 1033
143 Ga0105249_10368355 3300009553 Bacteria 1460
144 Ga0105239_10019802 3300010375 Bacteria 7427
145 Ga0105239_10233306 3300010375 Bacteria 2065
146 Ga0105239_11117694 3300010375 Bacteria 907
147 Ga0105246_10060405 3300011119 Bacteria 2634
148 Ga0105246_10124576 3300011119 Bacteria 1915
149 Ga0105246_10163413 3300011119 Bacteria 1698
150 Ga0157374_10008004 3300013296 Bacteria 9037
151 Ga0157378_10469168 3300013297 Bacteria 1252
152 Ga0163162_10033953 3300013306 Bacteria 5074
153 Ga0163162_10719347 3300013306 Bacteria 1119
154 Ga0157372_10130394 3300013307 Bacteria 2892
155 Ga0157372_10323079 3300013307 Bacteria 1797
156 Ga0157375_10034216 3300013308 Bacteria 4839
157 Ga0157375_10097056 3300013308 Bacteria 3021
158 Ga0157375_10454071 3300013308 Bacteria 1447
159 Ga0157375_10995147 3300013308 Bacteria 978
160 Ga0163163_10070357 3300014325 Bacteria 3484
161 Ga0163163_10138401 3300014325 Bacteria 2476
162 Ga0157380_10048676 3300014326 Bacteria 3339
163 Ga0157380_10305955 3300014326 Bacteria 1466
164 Ga0157380_10342268 3300014326 Bacteria 1396
165 Ga0157380_10542005 3300014326 Bacteria 1139
166 Ga0157377_10002266 3300014745 Bacteria 8462
167 Ga0157377_10110763 3300014745 Bacteria 1650
168 Ga0157379_10003412 3300014968 Bacteria 13436
169 Ga0157379_10265880 3300014968 Bacteria 1559
170 Ga0157379_10555095 3300014968 Bacteria 1069
171 Ga0157376_10735243 3300014969 Bacteria 995
172 Ga0163161_10096746 3300017792 Bacteria 2192
173 Ga0206353_11201049 3300020082 Bacteria 2427
174 Ga0213873_10053668 3300021358 Bacteria 1074
175 Ga0213874_10000706 3300021377 Bacteria 6742
176 Ga0213874_10027723 3300021377 Bacteria 1613
177 Ga0213874_10078135 3300021377 Bacteria 1068
178 Ga0213876_10023009 3300021384 Bacteria 3292
179 Ga0213876_10035566 3300021384 Bacteria 2627
180 Ga0213875_10000146 3300021388 Bacteria 75051
181 Ga0213875_10062286 3300021388 Bacteria 1745
182 Ga0207426_1023650 3300025302 Bacteria 2095
183 Ga0207656_10055272 3300025321 Bacteria 1727
184 Ga0207656_10085800 3300025321 Bacteria 1422
185 Ga0207688_10003163 3300025901 Bacteria 8980
186 Ga0207688_10052298 3300025901 Bacteria 2288
187 Ga0207688_10188803 3300025901 Bacteria 1231
188 Ga0207647_10084234 3300025904 Bacteria 1903
189 Ga0207699_10394631 3300025906 Bacteria 984
190 Ga0207643_10062160 3300025908 Bacteria 2134
191 Ga0207643_10089360 3300025908 Bacteria 1794
192 Ga0207705_10206712 3300025909 Bacteria 1488
193 Ga0207671_10003557 3300025914 Bacteria 15440
194 Ga0207693_10000185 3300025915 Bacteria 56784
195 Ga0207693_10121146 3300025915 Bacteria 2054
196 Ga0207693_10297050 3300025915 Bacteria 1265
197 Ga0207693_10422841 3300025915 Bacteria 1041
198 Ga0207693_10459987 3300025915 Bacteria 994
199 Ga0207663_10043656 3300025916 Bacteria 2746
200 Ga0207663_10044316 3300025916 Bacteria 2730
201 Ga0207663_10168745 3300025916 Bacteria 1552
202 Ga0207660_10189766 3300025917 Bacteria 1600
203 Ga0207662_10216693 3300025918 Bacteria 1245
204 Ga0207657_10013357 3300025919 Bacteria 8056
205 Ga0207657_10136478 3300025919 Bacteria 2007
206 Ga0207649_10382777 3300025920 Bacteria 1049
207 Ga0207652_10487559 3300025921 Bacteria 1110
208 Ga0207681_10161678 3300025923 Bacteria 1689
209 Ga0207650_10159208 3300025925 Bacteria 1788
210 Ga0207659_10080772 3300025926 Bacteria 2403
211 Ga0207659_10128737 3300025926 Bacteria 1950
212 Ga0207687_10007520 3300025927 Bacteria 7163
213 Ga0207687_10305409 3300025927 Bacteria 1283
214 Ga0207700_10178046 3300025928 Bacteria 1778
215 Ga0207700_10209752 3300025928 Bacteria 1646
216 Ga0207700_10221182 3300025928 Bacteria 1605
217 Ga0207700_10588476 3300025928 Bacteria 990
218 Ga0207664_10074546 3300025929 Bacteria 2742
219 Ga0207664_10119965 3300025929 Bacteria 2199
220 Ga0207664_10592121 3300025929 Bacteria 996
221 Ga0207690_10070681 3300025932 Bacteria 2405
222 Ga0207706_10019307 3300025933 Bacteria 6131
223 Ga0207706_10287064 3300025933 Bacteria 1435
224 Ga0207709_10018268 3300025935 Bacteria 3925
225 Ga0207670_10151482 3300025936 Bacteria 1721
226 Ga0207670_10401900 3300025936 Bacteria 1095
227 Ga0207670_10417562 3300025936 Bacteria 1076
228 Ga0207704_10073760 3300025938 Bacteria 2174
229 Ga0207704_10226323 3300025938 Bacteria 1388
230 Ga0207665_10013104 3300025939 Bacteria 5449
231 Ga0207665_10156948 3300025939 Bacteria 1634
232 Ga0207691_10002625 3300025940 Bacteria 17551
233 Ga0207691_10324929 3300025940 Bacteria 1319
234 Ga0207711_10424127 3300025941 Bacteria 1237
235 Ga0207711_10629861 3300025941 Bacteria 1001
236 Ga0207689_10009172 3300025942 Bacteria 8560
237 Ga0207689_10235162 3300025942 Bacteria 1514
238 Ga0207689_10272751 3300025942 Bacteria 1401
239 Ga0207679_10026722 3300025945 Bacteria 3983
240 Ga0207679_10175928 3300025945 Bacteria 1766
241 Ga0207679_10248135 3300025945 Bacteria 1512
242 Ga0207651_10505384 3300025960 Bacteria 1045
243 Ga0207712_10033733 3300025961 Bacteria 3462
244 Ga0207668_10016104 3300025972 Bacteria 4659
245 Ga0207668_10031144 3300025972 Bacteria 3511
246 Ga0207668_10173384 3300025972 Bacteria 1694
247 Ga0207658_10435895 3300025986 Bacteria 1158
248 Ga0207658_10701174 3300025986 Bacteria 915
249 Ga0207677_10514272 3300026023 Bacteria 1037
250 Ga0207678_10002043 3300026067 Bacteria 18307
251 Ga0207678_10049843 3300026067 Bacteria 3619
252 Ga0207678_10165168 3300026067 Bacteria 1890
253 Ga0207678_10541160 3300026067 Bacteria 1018
254 Ga0207708_10000487 3300026075 Bacteria 30579
255 Ga0207708_10000627 3300026075 Bacteria 27167
256 Ga0207708_10077076 3300026075 Bacteria 2558
257 Ga0207702_10060760 3300026078 Bacteria 3222
258 Ga0207702_10225576 3300026078 Bacteria 1748
259 Ga0207648_10007590 3300026089 Bacteria 10638
260 Ga0207648_10216667 3300026089 Bacteria 1700
261 Ga0207648_10266674 3300026089 Bacteria 1529
262 Ga0207676_10613658 3300026095 Bacteria 1046
263 Ga0207674_10166551 3300026116 Bacteria 2158
264 Ga0207675_100014166 3300026118 Bacteria 7437
265 Ga0207675_100028444 3300026118 Bacteria 5204
266 Ga0207675_100061841 3300026118 Bacteria 3496
267 Ga0207675_100554298 3300026118 Bacteria 1149
268 Ga0207683_10036034 3300026121 Bacteria 4305
269 Ga0207683_10117315 3300026121 Bacteria 2387
270 Ga0207683_10161824 3300026121 Bacteria 2024
271 Ga0207698_10084474 3300026142 Bacteria 2574
272 Ga0207428_10097898 3300027907 Bacteria 2270
273 Ga0268266_10306799 3300028379 Bacteria 1482
274 Ga0268264_10123376 3300028381 Bacteria 2286
275 Ga0265319_1005914 3300028563 Bacteria 5754
276 Ga0265318_10002796 3300028577 Bacteria 9135
277 Ga0265338_10285436 3300028800 Bacteria 1204
278 Ga0265325_10099302 3300031241 Bacteria 1427
279 Ga0265316_10102240 3300031344 Bacteria 2177
280 Ga0265314_10065106 3300031711 Bacteria 2463
281 Ga0307405_10147521 3300031731 Bacteria 1650
282 Ga0307406_10470443 3300031901 Bacteria 1013
283 Ga0307416_101528713 3300032002 Bacteria 773
284 Ga0307415_100047290 3300032126 Bacteria 2896
285 Ga0373953_0027624 3300035117 Bacteria 2182
286 Ga0373943_0184641 3300035170 Bacteria 1148
287 Ga0373946_0130099 3300035171 Bacteria 1157
288 Ga0373924_0019997 3300035410 Bacteria 2599
289 Ga0373925_0478498 3300037068 Bacteria 1021
290 Ga0395900_0092251 3300037418 Bacteria 3112
291 Ga0395900_0424552 3300037418 Bacteria 1290
292 Ga0395898_0000333 3300037466 Bacteria 106932
293 Ga0436364_0323249 3300037853 Bacteria 4276
294 Ga0436364_0496303 3300037853 Bacteria 5778
295 Ga0436364_0942527 3300037853 Bacteria 46992
296 Ga0436364_1007776 3300037853 Bacteria 1548
297 Ga0436364_1220218 3300037853 Bacteria 5982
298 Ga0395901_0480730 3300038443 Bacteria 1267
299 Ga0395901_0814915 3300038443 Bacteria 921
300 Ga0436365_0279799 3300039437 Bacteria 4721
301 Ga0436365_0283986 3300039437 Bacteria 3535
302 Ga0436365_0411023 3300039437 Bacteria 4519
303 Ga0436365_0426998 3300039437 Bacteria 3830
304 Ga0436365_0549747 3300039437 Bacteria 818
305 Ga0436365_1174820 3300039437 Bacteria 4647
306 Ga0436365_1850052 3300039437 Bacteria 1639
307 Ga0436365_1894942 3300039437 Bacteria 936
308 Ga0436363_0068389 3300039450 Bacteria 2043
309 Ga0436363_0088292 3300039450 Bacteria 1452
310 Ga0436363_0106856 3300039450 Bacteria 940
311 Ga0436363_0450168 3300039450 Bacteria 6775
312 Ga0436363_0474127 3300039450 Bacteria 3539
313 Ga0436363_0681393 3300039450 Bacteria 4032
314 Ga0436363_1121180 3300039450 Bacteria 914
315 Ga0436363_1314657 3300039450 Bacteria 4120
316 Ga0436362_0578607 3300039453 Bacteria 991
317 Ga0436362_0830906 3300039453 Bacteria 1019
318 Ga0436362_1181234 3300039453 Bacteria 7588
319 Ga0451837_0411115 3300041494 Bacteria 920
320 Ga0451843_0031096 3300041509 Bacteria 1044
321 Ga0466966_0032742 3300044684 Bacteria 3366
322 Ga0466966_0108564 3300044684 Bacteria 1712
323 Ga0466966_0113863 3300044684 Bacteria 1666
324 Ga0466961_0035139 3300044693 Bacteria 3218
325 Ga0466961_0080520 3300044693 Bacteria 2062
326 Ga0466961_0126947 3300044693 Bacteria 1600
327 Ga0466963_0004410 3300044694 Bacteria 8175
328 Ga0466963_0019046 3300044694 Bacteria 4298
329 Ga0466963_0036024 3300044694 Bacteria 3225
330 Ga0466963_0045876 3300044694 Bacteria 2879
331 Ga0466963_0170107 3300044694 Bacteria 1519
332 Ga0466971_0010277 3300044719 Bacteria 4089
333 Ga0466971_0010929 3300044719 Bacteria 3971
334 Ga0466971_0103113 3300044719 Bacteria 1312
335 Ga0466968_0049056 3300044735 Bacteria 1798
336 Ga0466968_0088308 3300044735 Bacteria 1370
337 Ga0466968_0200605 3300044735 Bacteria 934
338 Ga0466970_0126505 3300044765 Bacteria 1402
339 Ga0466970_0159634 3300044765 Bacteria 1247
340 Ga0466957_0001767 3300044842 Bacteria 11376
341 Ga0466957_0006207 3300044842 Bacteria 6747
342 Ga0466957_0092360 3300044842 Bacteria 1898
343 Ga0466957_0099659 3300044842 Bacteria 1830
344 Ga0466957_0149694 3300044842 Bacteria 1508
345 Ga0466957_0428172 3300044842 Bacteria 909
346 Ga0466960_0000019 3300044901 Bacteria 55224
347 Ga0466960_0003734 3300044901 Bacteria 5885
348 Ga0466960_0017030 3300044901 Bacteria 3163
349 Ga0466960_0054814 3300044901 Bacteria 1937
350 Ga0466960_0138717 3300044901 Bacteria 1290
351 Ga0466960_0321681 3300044901 Bacteria 876
352 Ga0466959_0009480 3300045049 Bacteria 6927
353 Ga0466959_0013279 3300045049 Bacteria 5966
354 Ga0466959_0026595 3300045049 Bacteria 4288
355 Ga0466959_0123648 3300045049 Bacteria 1837
356 Ga0466959_0130097 3300045049 Bacteria 1784
357 Ga0466959_0143895 3300045049 Bacteria 1683
358 Ga0466959_0163671 3300045049 Bacteria 1563
359 Ga0466959_0204515 3300045049 Bacteria 1374
360 Ga0466959_0215877 3300045049 Bacteria 1332
361 Ga0466958_0000316 3300045836 Bacteria 19191
362 Ga0466958_0003073 3300045836 Bacteria 8561
363 Ga0466958_0006671 3300045836 Bacteria 6298
364 Ga0466958_0008436 3300045836 Bacteria 5716
365 Ga0466958_0008476 3300045836 Bacteria 5707
366 Ga0466958_0011412 3300045836 Bacteria 5004
367 Ga0466958_0021165 3300045836 Bacteria 3797
368 Ga0466958_0023773 3300045836 Bacteria 3601
369 Ga0466958_0074875 3300045836 Bacteria 2076
370 Ga0466958_0293341 3300045836 Bacteria 1043
371 Ga0466958_0368581 3300045836 Bacteria 925
372 Ga0466967_0010318 3300045976 Bacteria 6998
373 Ga0466967_0054073 3300045976 Bacteria 3532
374 Ga0466967_0074201 3300045976 Bacteria 3054
375 Ga0466967_0151579 3300045976 Bacteria 2167
376 Ga0466967_0197326 3300045976 Bacteria 1905
377 Ga0466967_0204850 3300045976 Bacteria 1869
378 Ga0466967_0550659 3300045976 Bacteria 1135
379 Ga0466967_0667660 3300045976 Bacteria 1028
380 Ga0466967_0705496 3300045976 Bacteria 999
381 Ga0466967_0919030 3300045976 Bacteria 870
382 Ga0495592_0428670 3300046454 Bacteria 833
383 Ga0495629_0376167 3300046459 Bacteria 967
384 Ga0495651_0133642 3300046462 Bacteria 1808
385 Ga0495653_0080544 3300046463 Bacteria 2409
386 Ga0495650_0000012 3300046471 Bacteria 613144
387 Ga0495582_0223903 3300046473 Bacteria 1077
388 Ga0495664_0208706 3300046477 Bacteria 1183
389 Ga0495608_0002572 3300046511 Bacteria 13029
390 Ga0495628_0123207 3300046516 Bacteria 1987
391 Ga0495630_0071903 3300046517 Bacteria 2604
392 Ga0495652_0107238 3300046529 Bacteria 2254
393 Ga0495640_0017104 3300046533 Bacteria 5411
394 Ga0495645_0000405 3300046543 Bacteria 29730
395 Ga0495667_0013028 3300046559 Bacteria 5632
396 Ga0495667_0242629 3300046559 Bacteria 1147
397 Ga0495634_0024611 3300046642 Bacteria 4222
398 Ga0495635_0036484 3300046663 Bacteria 3407
399 Ga0495657_0041480 3300046675 Bacteria 3148
400 Ga0495646_0016990 3300046680 Bacteria 4620
401 Ga0495613_0169061 3300046689 Bacteria 1552
402 Ga0495671_0082143 3300046692 Bacteria 1579
403 Ga0495600_0017914 3300046809 Bacteria 4508
404 Ga0495604_0029742 3300047317 Bacteria 4345
405 Ga0495604_0116650 3300047317 Bacteria 1938
406 Ga0495674_0123610 3300047319 Bacteria 2185
407 Ga0495680_0017973 3300047322 Bacteria 6015
408 Ga0495685_044743 3300047447 Bacteria 1509
409 Ga0495684_0006072 3300047471 Bacteria 9392
410 Ga0495684_0072609 3300047471 Bacteria 2614
411 Ga0495602_0076408 3300048088 Bacteria 2837
412 Ga0495602_0111565 3300048088 Bacteria 2221
413 Ga0496100_0000246 3300048903 Bacteria 28402
414 Ga0496100_0008598 3300048903 Bacteria 5699
415 Ga0496100_0023716 3300048903 Bacteria 3732
416 Ga0496100_0232560 3300048903 Bacteria 1357
417 Ga0496100_0598377 3300048903 Bacteria 856
418 Ga0496101_0032179 3300048904 Bacteria 3690
419 Ga0496101_0127798 3300048904 Bacteria 1927
420 Ga0496101_0336625 3300048904 Bacteria 1185
421 Ga0496102_0089147 3300048905 Bacteria 2853
422 Ga0496102_0341771 3300048905 Bacteria 1409
423 Ga0496102_0401357 3300048905 Bacteria 1289
424 Ga0496102_0508273 3300048905 Bacteria 1127
425 Ga0496102_0867619 3300048905 Bacteria 824
426 Ga0496103_0090923 3300048906 Bacteria 1926
427 Ga0496103_0178144 3300048906 Bacteria 1366
428 Ga0496103_0297790 3300048906 Bacteria 1038
429 Ga0496103_0445892 3300048906 Bacteria 830
430 Ga0496104_0037701 3300048907 Bacteria 4520
431 Ga0496104_0060299 3300048907 Bacteria 3594
432 Ga0496104_0090182 3300048907 Bacteria 2929
433 Ga0496104_0250229 3300048907 Bacteria 1685
434 Ga0496104_0346207 3300048907 Bacteria 1399
435 Ga0496104_0465955 3300048907 Bacteria 1175
436 Ga0496105_0021327 3300048908 Bacteria 5242
437 Ga0496105_0045698 3300048908 Bacteria 3614
438 Ga0496105_0056044 3300048908 Bacteria 3254
439 Ga0496105_0734038 3300048908 Bacteria 755
440 Ga0496106_0005030 3300048909 Bacteria 9783
441 Ga0496106_0007047 3300048909 Bacteria 8301
442 Ga0496106_0040841 3300048909 Bacteria 3476
443 Ga0496106_0041460 3300048909 Bacteria 3449
444 Ga0496106_0130773 3300048909 Bacteria 1968
445 Ga0496106_0659144 3300048909 Bacteria 836
446 Ga0496107_0003409 3300048910 Bacteria 10629
447 Ga0496107_0111348 3300048910 Bacteria 2012
448 Ga0496107_0131029 3300048910 Bacteria 1851
449 Ga0496107_0173006 3300048910 Bacteria 1603
450 Ga0496107_0565594 3300048910 Bacteria 841
451 Ga0496108_0022421 3300048911 Bacteria 5190
452 Ga0496108_0052974 3300048911 Bacteria 3401
453 Ga0496108_0127857 3300048911 Bacteria 2183
454 Ga0496108_0175585 3300048911 Bacteria 1854
455 Ga0496108_0264994 3300048911 Bacteria 1495
456 Ga0496109_0004984 3300048912 Bacteria 11089
457 Ga0496109_0011794 3300048912 Bacteria 7522
458 Ga0496109_0019150 3300048912 Bacteria 6029
459 Ga0496109_0062923 3300048912 Bacteria 3393
460 Ga0496109_0101327 3300048912 Bacteria 2672
461 Ga0496109_0429296 3300048912 Bacteria 1248
462 Ga0496110_0022375 3300048913 Bacteria 5367
463 Ga0496110_0024614 3300048913 Bacteria 5133
464 Ga0496110_0137249 3300048913 Bacteria 2210
465 Ga0496110_0393837 3300048913 Bacteria 1263
466 Ga0496111_0059198 3300048914 Bacteria 2775
467 Ga0496112_0001879 3300048915 Bacteria 16560
468 Ga0496112_0010386 3300048915 Bacteria 8442
469 Ga0496112_0018475 3300048915 Bacteria 6565
470 Ga0496112_0039867 3300048915 Bacteria 4590
471 Ga0496112_0225683 3300048915 Bacteria 1828
472 Ga0496113_0033449 3300048916 Bacteria 3743
473 Ga0496113_0043637 3300048916 Bacteria 3319
474 Ga0496113_0060954 3300048916 Bacteria 2845
475 Ga0496113_0079249 3300048916 Bacteria 2514
476 Ga0496113_0092959 3300048916 Bacteria 2327
477 Ga0496113_0292539 3300048916 Bacteria 1303
478 Ga0496114_0164438 3300048917 Bacteria 1931
479 Ga0496114_0298215 3300048917 Bacteria 1423
480 Ga0496115_0000069 3300048918 Bacteria 93286
481 Ga0496115_0000100 3300048918 Bacteria 81390
482 Ga0496115_0012374 3300048918 Bacteria 6418
483 Ga0496115_0077097 3300048918 Bacteria 2710
484 Ga0496115_0465708 3300048918 Bacteria 1019
485 Ga0496119_0080120 3300048922 Bacteria 1884
486 Ga0496121_0003954 3300048924 Bacteria 20476
487 Ga0496121_0031288 3300048924 Bacteria 4864
488 Ga0501031_0018623 3300049568 Bacteria 4523
489 Ga0501034_0253182 3300049571 Bacteria 1705
490 Ga0501036_0100305 3300049572 Bacteria 2449
491 Ga0501038_0273392 3300049574 Bacteria 1332
492 Ga0501039_0007834 3300049575 Bacteria 8143
493 Ga0501042_0219566 3300049578 Bacteria 1371
494 Ga0501043_0803916 3300049579 Bacteria 680
495 Ga0501048_0460354 3300049582 Bacteria 911
496 Ga0501071_0410335 3300049587 Bacteria 1034
497 Ga0501072_0126564 3300049588 Bacteria 2036
498 Ga0501077_0315444 3300049593 Bacteria 997
499 Ga0501081_0301589 3300049743 Bacteria 1175
500 nmdc:mga03n38_132949_c1 3300050490 Bacteria 1235
501 nmdc:mga03n38_20967_c1 3300050490 Bacteria 2622
502 nmdc:mga03n38_24766_c1 3300050490 Bacteria 2457
503 nmdc:mga00v17_14570_c1 3300050491 Bacteria 4393
504 nmdc:mga00v17_27956_c1 3300050491 Bacteria 3298
505 nmdc:mga0yw44_103407_c1 3300050492 Bacteria 1817
506 nmdc:mga0yw44_46077_c1 3300050492 Bacteria 2617
507 nmdc:mga05p37_229388_c1 3300050507 Bacteria 2238
508 nmdc:mga0qj67_23398_c1 3300050509 Bacteria 4752
509 nmdc:mga0qj67_263704_c1 3300050509 Bacteria 1397
510 nmdc:mga0qj67_4579_c1 3300050509 Bacteria 10029
511 nmdc:mga06r32_56906_c1 3300050510 Bacteria 3755
512 nmdc:mga08y16_152126_c1 3300050511 Bacteria 2405
513 nmdc:mga08y16_200252_c1 3300050511 Bacteria 2069
514 nmdc:mga0n895_136271_c1 3300050512 Bacteria 2482
515 nmdc:mga08x19_39003_c1 3300050514 Bacteria 3018
516 nmdc:mga0a205_1968_c1 3300050515 Bacteria 17890
517 Ga0495601_0136951 3300053077 Bacteria 1596
518 Ga0495655_0039263 3300053083 Bacteria 1199
519 Ga0495655_0098455 3300053083 Bacteria 863
520 Ga0495595_0236855 3300053084 Bacteria 912
521 Ga0495619_0029770 3300053085 Bacteria 3530
522 Ga0495619_0173294 3300053085 Bacteria 1492
523 Ga0500568_0027019 3300053139 Bacteria 2404
524 Ga0500616_0039739 3300053153 Bacteria 2534
525 Ga0500616_0070926 3300053153 Bacteria 1777
526 Ga0501084_0085381 3300054114 Bacteria 2650
527 Ga0466962_0005558 3300061719 Bacteria 6051
528 Ga0466962_0068207 3300061719 Bacteria 1698
529 Ga0466962_0184297 3300061719 Bacteria 1018
530 Ga0530510_0266107 3300061734 Bacteria 1279
531 Ga0496111_0395677
532 JGI24737J22298_10053049
533 JGI24743J22301_10030084
534 Ga0070658_10057391
535 Ga0070683_100031485
536 Ga0070690_100252218
537 Ga0070670_100218241
538 Ga0070670_100373694
539 Ga0068869_100007594
540 Ga0068869_100144175
541 Ga0068869_100211138
542 Ga0068869_100523599
543 Ga0070680_100134667
544 Ga0070682_100004120
545 Ga0070682_100068720
546 Ga0070682_100518496
547 Ga0068868_100027653
548 Ga0068868_100069475
549 Ga0068868_100103784
550 Ga0068868_100363461
551 Ga0070660_100004708
552 Ga0070660_100009841
553 Ga0070689_100135012
554 Ga0070689_100347380
555 Ga0070691_10029887
556 Ga0070687_100209711
557 Ga0070661_100082927
558 Ga0070692_10020284
559 Ga0070668_100023054
560 Ga0070668_100435354
561 Ga0070669_100143533
562 Ga0070669_100505484
563 Ga0070675_100039435
564 Ga0070674_100335396
565 Ga0070673_100100154
566 Ga0070673_100533913
567 Ga0070659_100003019
568 Ga0070709_10023066
569 Ga0070709_10188854
570 Ga0070714_100039700
571 Ga0070713_100031055
572 Ga0070713_100276084
573 Ga0070701_10028541
574 Ga0070701_10152756
575 Ga0070701_10219933
576 Ga0070711_100069206
577 Ga0070711_100200156
578 Ga0070705_100148694
579 Ga0070700_100002205
580 Ga0070700_100031082
581 Ga0070700_100042244
582 Ga0070663_100023670
583 Ga0070663_100091537
584 Ga0070678_100177915
585 Ga0070678_100193029
586 Ga0070662_100008035
587 Ga0068867_100036585
588 Ga0068867_100153995
589 Ga0070685_10062810
590 Ga0070685_10087989
591 Ga0070685_10102425
592 Ga0070684_100011844
593 Ga0070684_100018710
594 Ga0070672_100036382
595 Ga0070672_100315994
596 Ga0070686_100088327
597 Ga0070696_100356624
598 Ga0070696_100398159
599 Ga0070693_100014921
600 Ga0070665_100273536
601 Ga0070664_100036777
602 Ga0070664_100072587
603 Ga0070664_100534184
604 Ga0068854_100017097
605 Ga0068854_100161695
606 Ga0068854_100266935
607 Ga0068854_100316220
608 Ga0068856_100127804
609 Ga0068856_100130704
610 Ga0070702_100029382
611 Ga0068852_100071300
612 Ga0068852_100190170
613 Ga0068852_100962955
614 Ga0068859_100166049
615 Ga0068864_100290764
616 Ga0068866_10101729
617 Ga0068861_100017159
618 Ga0068851_10033667
619 Ga0068851_10069759
620 Ga0068863_100673422
621 Ga0068860_100100960
622 Ga0068860_100150765
623 Ga0068862_100059079
624 Ga0081455_10033611
625 Ga0081455_10268255
626 Ga0081538_10056536
627 Ga0081540_1001136
628 Ga0081539_10007026
629 Ga0070717_10349651
630 Ga0070717_10475891
631 Ga0075365_10000613
632 Ga0075363_100035035
633 Ga0075364_10029765
634 Ga0075364_10352956
635 Ga0070716_100042737
636 Ga0070716_100320504
637 Ga0070712_100000291
638 Ga0070712_100003623
639 Ga0070712_100029181
640 Ga0070712_100029630
641 Ga0070712_100040857
642 Ga0070712_100143208
643 Ga0070712_100461151
644 Ga0070712_100502498
645 Ga0075362_10200822
646 Ga0075433_10001496
647 Ga0075434_100285857
648 Ga0075434_100517388
649 Ga0068865_100033938
650 Ga0068865_100116593
651 Ga0097620_100166042
652 Ga0111539_10033829
653 Ga0111539_10035535
654 Ga0111539_10218612
655 Ga0111539_10273152
656 Ga0105245_10003774
657 Ga0105247_10245008
658 Ga0114129_10347664
659 Ga0105243_10048567
660 Ga0105243_10255602
661 Ga0105241_10338434
662 Ga0105242_10146820
663 Ga0105242_10180637
664 Ga0105242_10457447
665 Ga0105242_11107773
666 Ga0105248_10112321
667 Ga0105237_10008164
668 Ga0105237_10280665
669 Ga0105237_10380303
670 Ga0105237_10725828
671 Ga0105237_10731224
672 Ga0105238_10689150
673 Ga0105249_10368355
674 Ga0105239_10019802
675 Ga0105239_10233306
676 Ga0105239_11117694
677 Ga0105246_10060405
678 Ga0105246_10124576
679 Ga0105246_10163413
680 Ga0157374_10008004
681 Ga0157378_10469168
682 Ga0163162_10033953
683 Ga0163162_10719347
684 Ga0157372_10130394
685 Ga0157372_10323079
686 Ga0157375_10034216
687 Ga0157375_10097056
688 Ga0157375_10454071
689 Ga0157375_10995147
690 Ga0163163_10070357
691 Ga0163163_10138401
692 Ga0157380_10048676
693 Ga0157380_10305955
694 Ga0157380_10342268
695 Ga0157380_10542005
696 Ga0157377_10002266
697 Ga0157377_10110763
698 Ga0157379_10003412
699 Ga0157379_10265880
700 Ga0157379_10555095
701 Ga0157376_10735243
702 Ga0163161_10096746
703 Ga0206353_11201049
704 Ga0213873_10053668
705 Ga0213874_10000706
706 Ga0213874_10027723
707 Ga0213874_10078135
708 Ga0213876_10023009
709 Ga0213876_10035566
710 Ga0213875_10000146
711 Ga0213875_10062286
712 Ga0207426_1023650
713 Ga0207656_10055272
714 Ga0207656_10085800
715 Ga0207688_10003163
716 Ga0207688_10052298
717 Ga0207688_10188803
718 Ga0207647_10084234
719 Ga0207699_10394631
720 Ga0207643_10062160
721 Ga0207643_10089360
722 Ga0207705_10206712
723 Ga0207671_10003557
724 Ga0207693_10000185
725 Ga0207693_10121146
726 Ga0207693_10297050
727 Ga0207693_10422841
728 Ga0207693_10459987
729 Ga0207663_10043656
730 Ga0207663_10044316
731 Ga0207663_10168745
732 Ga0207660_10189766
733 Ga0207662_10216693
734 Ga0207657_10013357
735 Ga0207657_10136478
736 Ga0207649_10382777
737 Ga0207652_10487559
738 Ga0207681_10161678
739 Ga0207650_10159208
740 Ga0207659_10080772
741 Ga0207659_10128737
742 Ga0207687_10007520
743 Ga0207687_10305409
744 Ga0207700_10178046
745 Ga0207700_10209752
746 Ga0207700_10221182
747 Ga0207700_10588476
748 Ga0207664_10074546
749 Ga0207664_10119965
750 Ga0207664_10592121
751 Ga0207690_10070681
752 Ga0207706_10019307
753 Ga0207706_10287064
754 Ga0207709_10018268
755 Ga0207670_10151482
756 Ga0207670_10401900
757 Ga0207670_10417562
758 Ga0207704_10073760
759 Ga0207704_10226323
760 Ga0207665_10013104
761 Ga0207665_10156948
762 Ga0207691_10002625
763 Ga0207691_10324929
764 Ga0207711_10424127
765 Ga0207711_10629861
766 Ga0207689_10009172
767 Ga0207689_10235162
768 Ga0207689_10272751
769 Ga0207679_10026722
770 Ga0207679_10175928
771 Ga0207679_10248135
772 Ga0207651_10505384
773 Ga0207712_10033733
774 Ga0207668_10016104
775 Ga0207668_10031144
776 Ga0207668_10173384
777 Ga0207658_10435895
778 Ga0207658_10701174
779 Ga0207677_10514272
780 Ga0207678_10002043
781 Ga0207678_10049843
782 Ga0207678_10165168
783 Ga0207678_10541160
784 Ga0207708_10000487
785 Ga0207708_10000627
786 Ga0207708_10077076
787 Ga0207702_10060760
788 Ga0207702_10225576
789 Ga0207648_10007590
790 Ga0207648_10216667
791 Ga0207648_10266674
792 Ga0207676_10613658
793 Ga0207674_10166551
794 Ga0207675_100014166
795 Ga0207675_100028444
796 Ga0207675_100061841
797 Ga0207675_100554298
798 Ga0207683_10036034
799 Ga0207683_10117315
800 Ga0207683_10161824
801 Ga0207698_10084474
802 Ga0207428_10097898
803 Ga0268266_10306799
804 Ga0268264_10123376
805 Ga0265319_1005914
806 Ga0265318_10002796
807 Ga0265338_10285436
808 Ga0265325_10099302
809 Ga0265316_10102240
810 Ga0265314_10065106
811 Ga0307405_10147521
812 Ga0307406_10470443
813 Ga0307416_101528713
814 Ga0307415_100047290
815 Ga0373953_0027624
816 Ga0373943_0184641
817 Ga0373946_0130099
818 Ga0373924_0019997
819 Ga0373925_0478498
820 Ga0395900_0092251
821 Ga0395900_0424552
822 Ga0395898_0000333
823 Ga0436364_0323249
824 Ga0436364_0496303
825 Ga0436364_0942527
826 Ga0436364_1007776
827 Ga0436364_1220218
828 Ga0395901_0480730
829 Ga0395901_0814915
830 Ga0436365_0279799
831 Ga0436365_0283986
832 Ga0436365_0411023
833 Ga0436365_0426998
834 Ga0436365_0549747
835 Ga0436365_1174820
836 Ga0436365_1850052
837 Ga0436365_1894942
838 Ga0436363_0068389
839 Ga0436363_0088292
840 Ga0436363_0106856
841 Ga0436363_0450168
842 Ga0436363_0474127
843 Ga0436363_0681393
844 Ga0436363_1121180
845 Ga0436363_1314657
846 Ga0436362_0578607
847 Ga0436362_0830906
848 Ga0436362_1181234
849 Ga0451837_0411115
850 Ga0451843_0031096
851 Ga0466966_0032742
852 Ga0466966_0108564
853 Ga0466966_0113863
854 Ga0466961_0035139
855 Ga0466961_0080520
856 Ga0466961_0126947
857 Ga0466963_0004410
858 Ga0466963_0019046
859 Ga0466963_0036024
860 Ga0466963_0045876
861 Ga0466963_0170107
862 Ga0466971_0010277
863 Ga0466971_0010929
864 Ga0466971_0103113
865 Ga0466968_0049056
866 Ga0466968_0088308
867 Ga0466968_0200605
868 Ga0466970_0126505
869 Ga0466970_0159634
870 Ga0466957_0001767
871 Ga0466957_0006207
872 Ga0466957_0092360
873 Ga0466957_0099659
874 Ga0466957_0149694
875 Ga0466957_0428172
876 Ga0466960_0000019
877 Ga0466960_0003734
878 Ga0466960_0017030
879 Ga0466960_0054814
880 Ga0466960_0138717
881 Ga0466960_0321681
882 Ga0466959_0009480
883 Ga0466959_0013279
884 Ga0466959_0026595
885 Ga0466959_0123648
886 Ga0466959_0130097
887 Ga0466959_0143895
888 Ga0466959_0163671
889 Ga0466959_0204515
890 Ga0466959_0215877
891 Ga0466958_0000316
892 Ga0466958_0003073
893 Ga0466958_0006671
894 Ga0466958_0008436
895 Ga0466958_0008476
896 Ga0466958_0011412
897 Ga0466958_0021165
898 Ga0466958_0023773
899 Ga0466958_0074875
900 Ga0466958_0293341
901 Ga0466958_0368581
902 Ga0466967_0010318
903 Ga0466967_0054073
904 Ga0466967_0074201
905 Ga0466967_0151579
906 Ga0466967_0197326
907 Ga0466967_0204850
908 Ga0466967_0550659
909 Ga0466967_0667660
910 Ga0466967_0705496
911 Ga0466967_0919030
912 Ga0495592_0428670
913 Ga0495629_0376167
914 Ga0495651_0133642
915 Ga0495653_0080544
916 Ga0495650_0000012
917 Ga0495582_0223903
918 Ga0495664_0208706
919 Ga0495608_0002572
920 Ga0495628_0123207
921 Ga0495630_0071903
922 Ga0495652_0107238
923 Ga0495640_0017104
924 Ga0495645_0000405
925 Ga0495667_0013028
926 Ga0495667_0242629
927 Ga0495634_0024611
928 Ga0495635_0036484
929 Ga0495657_0041480
930 Ga0495646_0016990
931 Ga0495613_0169061
932 Ga0495671_0082143
933 Ga0495600_0017914
934 Ga0495604_0029742
935 Ga0495604_0116650
936 Ga0495674_0123610
937 Ga0495680_0017973
938 Ga0495685_044743
939 Ga0495684_0006072
940 Ga0495684_0072609
941 Ga0495602_0076408
942 Ga0495602_0111565
943 Ga0496100_0000246
944 Ga0496100_0008598
945 Ga0496100_0023716
946 Ga0496100_0232560
947 Ga0496100_0598377
948 Ga0496101_0032179
949 Ga0496101_0127798
950 Ga0496101_0336625
951 Ga0496102_0089147
952 Ga0496102_0341771
953 Ga0496102_0401357
954 Ga0496102_0508273
955 Ga0496102_0867619
956 Ga0496103_0090923
957 Ga0496103_0178144
958 Ga0496103_0297790
959 Ga0496103_0445892
960 Ga0496104_0037701
961 Ga0496104_0060299
962 Ga0496104_0090182
963 Ga0496104_0250229
964 Ga0496104_0346207
965 Ga0496104_0465955
966 Ga0496105_0021327
967 Ga0496105_0045698
968 Ga0496105_0056044
969 Ga0496105_0734038
970 Ga0496106_0005030
971 Ga0496106_0007047
972 Ga0496106_0040841
973 Ga0496106_0041460
974 Ga0496106_0130773
975 Ga0496106_0659144
976 Ga0496107_0003409
977 Ga0496107_0111348
978 Ga0496107_0131029
979 Ga0496107_0173006
980 Ga0496107_0565594
981 Ga0496108_0022421
982 Ga0496108_0052974
983 Ga0496108_0127857
984 Ga0496108_0175585
985 Ga0496108_0264994
986 Ga0496109_0004984
987 Ga0496109_0011794
988 Ga0496109_0019150
989 Ga0496109_0062923
990 Ga0496109_0101327
991 Ga0496109_0429296
992 Ga0496110_0022375
993 Ga0496110_0024614
994 Ga0496110_0137249
995 Ga0496110_0393837
996 Ga0496111_0059198
997 Ga0496112_0001879
998 Ga0496112_0010386
999 Ga0496112_0018475
1000 Ga0496112_0039867
1001 Ga0496112_0225683
1002 Ga0496113_0033449
1003 Ga0496113_0043637
1004 Ga0496113_0060954
1005 Ga0496113_0079249
1006 Ga0496113_0092959
1007 Ga0496113_0292539
1008 Ga0496114_0164438
1009 Ga0496114_0298215
1010 Ga0496115_0000069
1011 Ga0496115_0000100
1012 Ga0496115_0012374
1013 Ga0496115_0077097
1014 Ga0496115_0465708
1015 Ga0496119_0080120
1016 Ga0496121_0003954
1017 Ga0496121_0031288
1018 Ga0501031_0018623
1019 Ga0501034_0253182
1020 Ga0501036_0100305
1021 Ga0501038_0273392
1022 Ga0501039_0007834
1023 Ga0501042_0219566
1024 Ga0501043_0803916
1025 Ga0501048_0460354
1026 Ga0501071_0410335
1027 Ga0501072_0126564
1028 Ga0501077_0315444
1029 Ga0501081_0301589
1030 nmdc:mga03n38_132949_c1
1031 nmdc:mga03n38_20967_c1
1032 nmdc:mga03n38_24766_c1
1033 nmdc:mga00v17_14570_c1
1034 nmdc:mga00v17_27956_c1
1035 nmdc:mga0yw44_103407_c1
1036 nmdc:mga0yw44_46077_c1
1037 nmdc:mga05p37_229388_c1
1038 nmdc:mga0qj67_23398_c1
1039 nmdc:mga0qj67_263704_c1
1040 nmdc:mga0qj67_4579_c1
1041 nmdc:mga06r32_56906_c1
1042 nmdc:mga08y16_152126_c1
1043 nmdc:mga08y16_200252_c1
1044 nmdc:mga0n895_136271_c1
1045 nmdc:mga08x19_39003_c1
1046 nmdc:mga0a205_1968_c1
1047 Ga0495601_0136951
1048 Ga0495655_0039263
1049 Ga0495655_0098455
1050 Ga0495595_0236855
1051 Ga0495619_0029770
1052 Ga0495619_0173294
1053 Ga0500568_0027019
1054 Ga0500616_0039739
1055 Ga0500616_0070926
1056 Ga0501084_0085381
1057 Ga0466962_0005558
1058 Ga0466962_0068207
1059 Ga0466962_0184297
1060 Ga0530510_0266107

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02742

Fe_dep_repr_C

Iron dependent repressor, metal binding and dimerisation domain

108

177

0.97

PF04023

FeoA

FeoA domain

184

255

0.95

PF01325

Fe_dep_repress

Iron dependent repressor, N-terminal DNA binding domain

46

105

0.93

PF09339

HTH_IclR

IclR helix-turn-helix domain

55

101

0.92

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

59

98

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f5t-assembly1.cif.gz_A diphtheria tox repressor (c102d mutant) complexed with nickel and dtxr consensus binding sequence 0.9566 7 119
1c0w-assembly1.cif.gz_C crystal structure of the cobalt-activated diphtheria toxin repressor-dna complex reveals a metal binding sh-like domain 0.9539 7 132
2isy-assembly1.cif.gz_B crystal structure of the nickel-activated two-domain iron-dependent regulator (ider) 0.9518 7 132
1g3t-assembly1.cif.gz_B cys102ser dtxr 0.9487 3 132
7b25-assembly1.cif.gz_D dtxr-like iron-dependent regulator ider (q43a variant) complexed with cobalt and its consensus dna-binding sequence 0.9468 8 132
ID Description Score Start End Superfamily
1bi2B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9708 7 74 1.10.10.10
2tdxA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9708 7 74 1.10.10.10
3glxA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9607 7 72 1.10.10.10
3edpB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9578 26 65 1.10.10.10
1dtr001 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9519 7 74 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A838PLN7-F1-model_v4 Manganese transport regulator 0.9729 1 127 GO:0003677
GO:0003700
GO:0046914
GO:0046983
AF-A0A838PLN7-F1-model_v4 Manganese transport regulator 0.9654 1 127 GO:0003677
GO:0003700
GO:0046914
GO:0046983
AF-Q9F7T1-F1-model_v4 Iron dependent regulatory protein 0.9632 7 108 GO:0003677
GO:0003700
GO:0045892
GO:0046914
GO:0046983
AF-A0A2D7RIU0-F1-model_v4 Manganese transport regulator 0.958 6 110 GO:0003677
GO:0003700
GO:0005737
GO:0046914
GO:0046983
AF-A0A644W4M2-F1-model_v4 Transcriptional regulator MntR 0.9563 1 106 GO:0003677

Map