F459987

General Info

Members Datasets Scaffolds Average Seq Length
530 233 1060 84

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0701893|Ga0436365_0701893_68_319
Length 83
Sequence VTTTVWIAPSATSFSCLCEPCLEHARTHGLLFADALMQASVRGSIPSEIELTRRCAAGHEIVLRRVQRPPSLPRHDERQLVLQ

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
105 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
106 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
109 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
118 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
136 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
137 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
138 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
139 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
147 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
162 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
163 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
217 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
218 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
219 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
229 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.98
Metatranscriptomes 3.02
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.87
Rhizosphere 90.19
Stem 0
Stem Tuber 0
Unclassified 3.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0701893 3300039437 Bacteria 1069
2 Ga0070658_10062197 3300005327 Bacteria 3042
3 Ga0070658_10097813 3300005327 Bacteria 2423
4 Ga0070658_10504240 3300005327 Bacteria 1045
5 Ga0070683_100119475 3300005329 Bacteria 2489
6 Ga0070683_100225128 3300005329 Bacteria 1782
7 Ga0070683_100292981 3300005329 Bacteria 1548
8 Ga0070683_100500572 3300005329 Bacteria 1161
9 Ga0070683_101446541 3300005329 Bacteria 661
10 Ga0070683_101566247 3300005329 Bacteria 633
11 Ga0070680_100153110 3300005336 Bacteria 1936
12 Ga0070680_100300768 3300005336 Bacteria 1361
13 Ga0070680_100852557 3300005336 Bacteria 785
14 Ga0070680_100886019 3300005336 Bacteria 770
15 Ga0070682_100206142 3300005337 Bacteria 1390
16 Ga0070682_101359676 3300005337 Bacteria 606
17 Ga0068868_100591880 3300005338 Bacteria 982
18 Ga0070660_100035792 3300005339 Bacteria 3759
19 Ga0070660_100294433 3300005339 Bacteria 1329
20 Ga0070660_100295845 3300005339 Bacteria 1326
21 Ga0070660_100973497 3300005339 Bacteria 716
22 Ga0070660_101274368 3300005339 Bacteria 623
23 Ga0070660_101555829 3300005339 Bacteria 562
24 Ga0070691_10821502 3300005341 Bacteria 568
25 Ga0070661_100024555 3300005344 Bacteria 4323
26 Ga0070661_100060619 3300005344 Bacteria 2776
27 Ga0070661_100604824 3300005344 Bacteria 887
28 Ga0070661_100943074 3300005344 Bacteria 714
29 Ga0070661_101516816 3300005344 Bacteria 565
30 Ga0070661_101733287 3300005344 Bacteria 529
31 Ga0070659_100743076 3300005366 Bacteria 850
32 Ga0070709_10296964 3300005434 Bacteria 1179
33 Ga0070709_10315465 3300005434 Bacteria 1146
34 Ga0070714_100215125 3300005435 Bacteria 1764
35 Ga0070714_100693894 3300005435 Unclassified 982
36 Ga0070713_100200048 3300005436 Bacteria 1804
37 Ga0070710_10140270 3300005437 Bacteria 1482
38 Ga0070710_10227836 3300005437 Bacteria 1189
39 Ga0070710_10687766 3300005437 Bacteria 721
40 Ga0070711_100013583 3300005439 Bacteria 5116
41 Ga0070711_100889194 3300005439 Bacteria 760
42 Ga0070711_101065228 3300005439 Bacteria 696
43 Ga0070705_100652455 3300005440 Bacteria 821
44 Ga0070708_100804374 3300005445 Bacteria 884
45 Ga0070708_101193281 3300005445 Unclassified 712
46 Ga0070663_101283833 3300005455 Bacteria 645
47 Ga0070663_101308525 3300005455 Bacteria 640
48 Ga0070678_101221127 3300005456 Bacteria 698
49 Ga0070678_101649782 3300005456 Bacteria 603
50 Ga0070662_101666803 3300005457 Bacteria 551
51 Ga0070681_10017798 3300005458 Bacteria 7100
52 Ga0070681_10031962 3300005458 Bacteria 5284
53 Ga0070681_10038129 3300005458 Bacteria 4819
54 Ga0070681_10156281 3300005458 Bacteria 2205
55 Ga0070681_10190537 3300005458 Bacteria 1970
56 Ga0070681_10279109 3300005458 Bacteria 1581
57 Ga0070681_10523078 3300005458 Bacteria 1100
58 Ga0070706_100642987 3300005467 Bacteria 985
59 Ga0070706_101254798 3300005467 Unclassified 680
60 Ga0070707_100986456 3300005468 Bacteria 808
61 Ga0070707_101411751 3300005468 Bacteria 663
62 Ga0070698_100792040 3300005471 Bacteria 892
63 Ga0070699_101510767 3300005518 Bacteria 616
64 Ga0070679_100053210 3300005530 Bacteria 4030
65 Ga0070679_100146636 3300005530 Bacteria 2337
66 Ga0070679_100159613 3300005530 Bacteria 2229
67 Ga0070679_100590826 3300005530 Bacteria 1054
68 Ga0070679_101784731 3300005530 Unclassified 563
69 Ga0070684_100049912 3300005535 Bacteria 3633
70 Ga0070684_100230109 3300005535 Bacteria 1692
71 Ga0070684_100497581 3300005535 Bacteria 1129
72 Ga0070684_100880179 3300005535 Bacteria 839
73 Ga0070684_101035582 3300005535 Bacteria 770
74 Ga0070684_101875798 3300005535 Unclassified 566
75 Ga0070697_101572983 3300005536 Bacteria 588
76 Ga0068853_100139657 3300005539 Bacteria 2174
77 Ga0068853_100261028 3300005539 Bacteria 1592
78 Ga0068853_101766400 3300005539 Bacteria 600
79 Ga0070665_100011253 3300005548 Bacteria 9048
80 Ga0070665_101269717 3300005548 Bacteria 747
81 Ga0068855_100076153 3300005563 Bacteria 3894
82 Ga0068855_100098953 3300005563 Bacteria 3359
83 Ga0068855_100301361 3300005563 Bacteria 1775
84 Ga0068855_100404452 3300005563 Bacteria 1495
85 Ga0068855_100591451 3300005563 Bacteria 1198
86 Ga0068855_100722259 3300005563 Bacteria 1064
87 Ga0068857_100336713 3300005577 Bacteria 1395
88 Ga0068857_101000889 3300005577 Bacteria 804
89 Ga0068854_102033118 3300005578 Bacteria 530
90 Ga0068856_100262134 3300005614 Bacteria 1744
91 Ga0068856_100282119 3300005614 Bacteria 1678
92 Ga0068856_100529565 3300005614 Bacteria 1199
93 Ga0068856_100630588 3300005614 Bacteria 1092
94 Ga0068852_100125770 3300005616 Bacteria 2354
95 Ga0068852_100384479 3300005616 Bacteria 1377
96 Ga0068852_100637197 3300005616 Bacteria 1072
97 Ga0068851_10511552 3300005834 Bacteria 721
98 Ga0068858_102327344 3300005842 Bacteria 529
99 Ga0070717_11219155 3300006028 Bacteria 685
100 Ga0070715_10120062 3300006163 Bacteria 1252
101 Ga0070716_100313804 3300006173 Bacteria 1096
102 Ga0097621_100577141 3300006237 Bacteria 1026
103 Ga0068871_100166588 3300006358 Bacteria 1887
104 Ga0075433_11075021 3300006852 Bacteria 700
105 Ga0075434_100292884 3300006871 Bacteria 1648
106 Ga0075436_100137669 3300006914 Bacteria 1715
107 Ga0075435_100049753 3300007076 Bacteria 3372
108 Ga0105240_10092476 3300009093 Bacteria 3693
109 Ga0105240_10604472 3300009093 Bacteria 1207
110 Ga0105240_10609632 3300009093 Bacteria 1201
111 Ga0105240_11001525 3300009093 Bacteria 894
112 Ga0105240_11411339 3300009093 Bacteria 732
113 Ga0105240_11661589 3300009093 Unclassified 667
114 Ga0105240_11678798 3300009093 Bacteria 663
115 Ga0105245_11015489 3300009098 Bacteria 874
116 Ga0105245_12122064 3300009098 Bacteria 616
117 Ga0105241_10351757 3300009174 Bacteria 1279
118 Ga0105241_10895225 3300009174 Bacteria 824
119 Ga0105241_11118618 3300009174 Bacteria 742
120 Ga0105241_11344072 3300009174 Bacteria 682
121 Ga0105242_10022608 3300009176 Bacteria 4948
122 Ga0105242_12142923 3300009176 Bacteria 603
123 Ga0105242_12318574 3300009176 Bacteria 583
124 Ga0105237_10176046 3300009545 Bacteria 2139
125 Ga0105237_10326609 3300009545 Bacteria 1538
126 Ga0105237_11643281 3300009545 Bacteria 649
127 Ga0105238_10237010 3300009551 Bacteria 1802
128 Ga0105238_10761001 3300009551 Bacteria 983
129 Ga0105238_10899756 3300009551 Bacteria 903
130 Ga0105239_10817819 3300010375 Bacteria 1068
131 Ga0105239_11067906 3300010375 Bacteria 929
132 Ga0157373_10929920 3300013100 Bacteria 646
133 Ga0157370_10015630 3300013104 Bacteria 7709
134 Ga0157370_10036790 3300013104 Bacteria 4749
135 Ga0157370_10177450 3300013104 Bacteria 1980
136 Ga0157370_10249394 3300013104 Bacteria 1642
137 Ga0157370_10438106 3300013104 Bacteria 1202
138 Ga0157370_10942473 3300013104 Bacteria 783
139 Ga0157370_10990745 3300013104 Bacteria 761
140 Ga0157369_10002657 3300013105 Bacteria 21337
141 Ga0157369_10126450 3300013105 Bacteria 2710
142 Ga0157369_10539486 3300013105 Bacteria 1206
143 Ga0157369_10652667 3300013105 Bacteria 1085
144 Ga0157369_10699311 3300013105 Bacteria 1044
145 Ga0157369_11824049 3300013105 Unclassified 618
146 Ga0157369_12352150 3300013105 Bacteria 540
147 Ga0157369_12387206 3300013105 Bacteria 536
148 Ga0157374_10952066 3300013296 Bacteria 877
149 Ga0157378_10202794 3300013297 Bacteria 1877
150 Ga0157378_11109875 3300013297 Bacteria 828
151 Ga0157372_10040317 3300013307 Bacteria 5157
152 Ga0157372_10315109 3300013307 Bacteria 1821
153 Ga0157372_10470703 3300013307 Bacteria 1465
154 Ga0157372_12383447 3300013307 Bacteria 608
155 Ga0157372_12918432 3300013307 Bacteria 547
156 Ga0157372_13034919 3300013307 Unclassified 536
157 Ga0157375_12109058 3300013308 Bacteria 671
158 Ga0182008_10051801 3300014497 Bacteria 2036
159 Ga0182008_10130853 3300014497 Bacteria 1251
160 Ga0182008_10196099 3300014497 Bacteria 1026
161 Ga0182008_10439384 3300014497 Bacteria 707
162 Ga0182008_10598067 3300014497 Bacteria 619
163 Ga0157376_11458542 3300014969 Bacteria 717
164 Ga0182006_1290120 3300015261 Bacteria 537
165 Ga0182007_10124110 3300015262 Bacteria 865
166 Ga0182007_10261022 3300015262 Bacteria 624
167 Ga0197907_11154728 3300020069 Unclassified 642
168 Ga0206356_10212333 3300020070 Bacteria 1154
169 Ga0206356_10602804 3300020070 Bacteria 1880
170 Ga0206356_10900205 3300020070 Bacteria 726
171 Ga0206356_10985006 3300020070 Bacteria 643
172 Ga0206356_11621634 3300020070 Bacteria 871
173 Ga0206356_11651324 3300020070 Unclassified 850
174 Ga0206354_10547085 3300020081 Bacteria 1172
175 Ga0206354_10974966 3300020081 Bacteria 3062
176 Ga0206354_11443079 3300020081 Bacteria 623
177 Ga0206353_10119475 3300020082 Bacteria 903
178 Ga0206353_10181076 3300020082 Bacteria 771
179 Ga0206353_10203657 3300020082 Bacteria 1800
180 Ga0206353_10379293 3300020082 Bacteria 718
181 Ga0206353_10381735 3300020082 Bacteria 590
182 Ga0206353_12046548 3300020082 Bacteria 746
183 Ga0213876_10134117 3300021384 Bacteria 1317
184 Ga0207692_10254480 3300025898 Bacteria 1054
185 Ga0207692_10391886 3300025898 Bacteria 864
186 Ga0207692_10425751 3300025898 Bacteria 832
187 Ga0207685_10166623 3300025905 Bacteria 1010
188 Ga0207685_10551124 3300025905 Bacteria 613
189 Ga0207699_10229628 3300025906 Bacteria 1271
190 Ga0207705_10038581 3300025909 Bacteria 3420
191 Ga0207705_10096962 3300025909 Bacteria 2165
192 Ga0207654_10275734 3300025911 Bacteria 1136
193 Ga0207654_10279964 3300025911 Bacteria 1128
194 Ga0207654_11059716 3300025911 Bacteria 590
195 Ga0207707_10006845 3300025912 Bacteria 9940
196 Ga0207707_10016574 3300025912 Bacteria 6424
197 Ga0207707_10034460 3300025912 Bacteria 4429
198 Ga0207707_10258541 3300025912 Bacteria 1511
199 Ga0207707_10529672 3300025912 Bacteria 1003
200 Ga0207695_10040302 3300025913 Bacteria 5010
201 Ga0207695_10126563 3300025913 Bacteria 2516
202 Ga0207695_10807599 3300025913 Bacteria 818
203 Ga0207695_10887671 3300025913 Bacteria 771
204 Ga0207695_10897261 3300025913 Bacteria 766
205 Ga0207671_10070235 3300025914 Bacteria 2610
206 Ga0207671_10252371 3300025914 Bacteria 1387
207 Ga0207693_10621426 3300025915 Bacteria 840
208 Ga0207663_10008237 3300025916 Bacteria 5441
209 Ga0207663_10358400 3300025916 Bacteria 1106
210 Ga0207663_11554184 3300025916 Bacteria 533
211 Ga0207660_10038517 3300025917 Bacteria 3338
212 Ga0207660_10237079 3300025917 Bacteria 1436
213 Ga0207660_10352203 3300025917 Bacteria 1180
214 Ga0207660_11123413 3300025917 Bacteria 640
215 Ga0207657_10002824 3300025919 Bacteria 18667
216 Ga0207657_10012342 3300025919 Bacteria 8437
217 Ga0207657_10042675 3300025919 Bacteria 4000
218 Ga0207657_10234387 3300025919 Bacteria 1467
219 Ga0207657_10315293 3300025919 Bacteria 1237
220 Ga0207657_10374978 3300025919 Bacteria 1121
221 Ga0207649_10182642 3300025920 Bacteria 1469
222 Ga0207649_10550181 3300025920 Bacteria 883
223 Ga0207649_10865025 3300025920 Bacteria 708
224 Ga0207649_10993820 3300025920 Bacteria 660
225 Ga0207652_10058222 3300025921 Bacteria 3329
226 Ga0207652_10176814 3300025921 Bacteria 1917
227 Ga0207652_10384415 3300025921 Bacteria 1267
228 Ga0207652_10504941 3300025921 Bacteria 1089
229 Ga0207652_11509310 3300025921 Bacteria 576
230 Ga0207646_11573269 3300025922 Bacteria 568
231 Ga0207694_10128491 3300025924 Bacteria 2029
232 Ga0207694_10272545 3300025924 Bacteria 1388
233 Ga0207694_10542028 3300025924 Bacteria 976
234 Ga0207650_11354546 3300025925 Bacteria 606
235 Ga0207700_11901263 3300025928 Bacteria 521
236 Ga0207664_10110404 3300025929 Bacteria 2287
237 Ga0207664_10146145 3300025929 Bacteria 2005
238 Ga0207664_10443211 3300025929 Bacteria 1158
239 Ga0207664_11093410 3300025929 Bacteria 713
240 Ga0207664_11295758 3300025929 Bacteria 648
241 Ga0207686_10026385 3300025934 Bacteria 3388
242 Ga0207686_11797206 3300025934 Bacteria 507
243 Ga0207665_10352578 3300025939 Bacteria 1111
244 Ga0207661_10219213 3300025944 Bacteria 1681
245 Ga0207661_10733126 3300025944 Bacteria 909
246 Ga0207661_11920036 3300025944 Bacteria 538
247 Ga0207679_10856665 3300025945 Bacteria 830
248 Ga0207667_10089901 3300025949 Bacteria 3173
249 Ga0207667_10193033 3300025949 Bacteria 2089
250 Ga0207667_10392924 3300025949 Bacteria 1412
251 Ga0207667_10522619 3300025949 Bacteria 1202
252 Ga0207667_11100607 3300025949 Bacteria 778
253 Ga0207667_11628129 3300025949 Bacteria 614
254 Ga0207667_11923042 3300025949 Bacteria 553
255 Ga0207640_10291217 3300025981 Bacteria 1287
256 Ga0207658_10004832 3300025986 Bacteria 9316
257 Ga0207703_10215430 3300026035 Bacteria 1714
258 Ga0207639_10347792 3300026041 Bacteria 1323
259 Ga0207639_11055905 3300026041 Bacteria 761
260 Ga0207678_10180042 3300026067 Bacteria 1805
261 Ga0207678_11001189 3300026067 Bacteria 740
262 Ga0207702_10737219 3300026078 Bacteria 972
263 Ga0207674_10300614 3300026116 Bacteria 1554
264 Ga0207674_10362945 3300026116 Bacteria 1400
265 Ga0207683_10161621 3300026121 Bacteria 2025
266 Ga0207698_10074300 3300026142 Bacteria 2711
267 Ga0207698_11272475 3300026142 Bacteria 750
268 Ga0268266_10025493 3300028379 Bacteria 5031
269 Ga0268266_11021513 3300028379 Bacteria 800
270 Ga0265334_10293483 3300028573 Unclassified 557
271 Ga0265318_10119073 3300028577 Bacteria 971
272 Ga0265322_10013003 3300028654 Bacteria 2409
273 Ga0265338_10054346 3300028800 Bacteria 3572
274 Ga0265338_11136464 3300028800 Bacteria 525
275 Ga0265330_10063123 3300031235 Bacteria 1610
276 Ga0265325_10146629 3300031241 Bacteria 1119
277 Ga0265339_10041736 3300031249 Bacteria 2544
278 Ga0265331_10145100 3300031250 Bacteria 1078
279 Ga0265331_10168352 3300031250 Bacteria 992
280 Ga0265327_10008869 3300031251 Bacteria 7391
281 Ga0265316_10008441 3300031344 Bacteria 9562
282 Ga0265313_10002660 3300031595 Bacteria 15177
283 Ga0265314_10003929 3300031711 Bacteria 14127
284 Ga0265342_10021116 3300031712 Bacteria 4164
285 Ga0373926_0010942 3300035083 Bacteria 3046
286 Ga0373926_0141747 3300035083 Bacteria 913
287 Ga0373944_0008204 3300035089 Bacteria 2818
288 Ga0373936_0014573 3300035113 Bacteria 3009
289 Ga0373936_0031561 3300035113 Bacteria 2092
290 Ga0373945_0003761 3300035116 Bacteria 4789
291 Ga0373945_0036219 3300035116 Bacteria 1767
292 Ga0373943_0000538 3300035170 Bacteria 16397
293 Ga0373943_0014138 3300035170 Bacteria 3609
294 Ga0373946_0761651 3300035171 Bacteria 508
295 Ga0373924_0485403 3300035410 Bacteria 555
296 Ga0373935_0087987 3300035692 Bacteria 2029
297 Ga0373935_0109829 3300035692 Bacteria 1829
298 Ga0373927_0025083 3300035695 Bacteria 3898
299 Ga0373947_0000066 3300035725 Bacteria 52968
300 Ga0373947_0003591 3300035725 Bacteria 9146
301 Ga0373937_0227948 3300036401 Bacteria 1754
302 Ga0373925_0003351 3300037068 Bacteria 12427
303 Ga0373925_0033365 3300037068 Bacteria 3793
304 Ga0395899_0199877 3300037312 Bacteria 1394
305 Ga0395899_0271593 3300037312 Bacteria 1156
306 Ga0395900_0168172 3300037418 Bacteria 2233
307 Ga0395900_0339514 3300037418 Bacteria 1478
308 Ga0395900_0526595 3300037418 Bacteria 1129
309 Ga0395900_0995215 3300037418 Bacteria 758
310 Ga0395900_1013075 3300037418 Bacteria 750
311 Ga0395900_1735454 3300037418 Bacteria 535
312 Ga0395898_0005527 3300037466 Bacteria 13639
313 Ga0395898_0134482 3300037466 Bacteria 2367
314 Ga0395898_0144583 3300037466 Bacteria 2276
315 Ga0395898_0590784 3300037466 Bacteria 1053
316 Ga0395898_0597639 3300037466 Bacteria 1046
317 Ga0395898_0679479 3300037466 Bacteria 972
318 Ga0395905_0036251 3300037471 Bacteria 4632
319 Ga0436364_1209114 3300037853 Bacteria 1589
320 Ga0395901_0033926 3300038443 Bacteria 5270
321 Ga0395901_0121797 3300038443 Bacteria 2741
322 Ga0395901_0259497 3300038443 Bacteria 1809
323 Ga0395901_0467664 3300038443 Bacteria 1287
324 Ga0395901_0654807 3300038443 Bacteria 1053
325 Ga0395901_1530528 3300038443 Bacteria 622
326 Ga0395901_1715721 3300038443 Bacteria 579
327 Ga0436365_1634939 3300039437 Bacteria 4555
328 Ga0436360_0341402 3300039438 Bacteria 1642
329 Ga0436363_1450105 3300039450 Bacteria 572
330 Ga0436362_0430525 3300039453 Bacteria 568
331 Ga0439448_0245944 3300042005 Bacteria 631
332 Ga0466969_0182511 3300044656 Bacteria 960
333 Ga0466972_0365937 3300044658 Bacteria 675
334 Ga0466972_0506811 3300044658 Bacteria 568
335 Ga0466965_0223203 3300044683 Bacteria 1005
336 Ga0466966_0023644 3300044684 Bacteria 4023
337 Ga0466966_0030664 3300044684 Bacteria 3488
338 Ga0466966_0070743 3300044684 Bacteria 2187
339 Ga0466961_0000424 3300044693 Bacteria 26980
340 Ga0466961_0031926 3300044693 Bacteria 3385
341 Ga0466961_0043938 3300044693 Bacteria 2861
342 Ga0466961_0081722 3300044693 Bacteria 2044
343 Ga0466961_0845817 3300044693 Unclassified 545
344 Ga0466963_0002241 3300044694 Bacteria 10726
345 Ga0466963_0017573 3300044694 Bacteria 4460
346 Ga0466963_0050294 3300044694 Bacteria 2759
347 Ga0466963_0237634 3300044694 Bacteria 1277
348 Ga0466963_0280746 3300044694 Bacteria 1170
349 Ga0466963_0499790 3300044694 Bacteria 858
350 Ga0466964_0002641 3300044706 Bacteria 6420
351 Ga0466964_0185908 3300044706 Bacteria 988
352 Ga0466971_0001169 3300044719 Bacteria 10913
353 Ga0466971_0054512 3300044719 Bacteria 1802
354 Ga0466971_0070049 3300044719 Bacteria 1592
355 Ga0466968_0006432 3300044735 Bacteria 4428
356 Ga0466968_0327035 3300044735 Bacteria 741
357 Ga0466970_0090985 3300044765 Bacteria 1656
358 Ga0466957_0000598 3300044842 Bacteria 18341
359 Ga0466957_0124850 3300044842 Bacteria 1644
360 Ga0466957_0185481 3300044842 Bacteria 1360
361 Ga0466957_0521968 3300044842 Unclassified 825
362 Ga0466957_0744322 3300044842 Unclassified 694
363 Ga0466960_0120950 3300044901 Bacteria 1371
364 Ga0466960_0490225 3300044901 Bacteria 719
365 Ga0466959_0013344 3300045049 Bacteria 5956
366 Ga0466959_0050603 3300045049 Bacteria 3050
367 Ga0466959_0061341 3300045049 Bacteria 2734
368 Ga0466959_0177405 3300045049 Bacteria 1492
369 Ga0466959_0273973 3300045049 Bacteria 1159
370 Ga0451576_0270243 3300045051 Bacteria 1777
371 Ga0466958_0002350 3300045836 Bacteria 9459
372 Ga0466958_0011139 3300045836 Bacteria 5059
373 Ga0466958_0022990 3300045836 Bacteria 3656
374 Ga0466958_0070650 3300045836 Bacteria 2137
375 Ga0466958_0644653 3300045836 Unclassified 689
376 Ga0466958_0829750 3300045836 Bacteria 603
377 Ga0466967_0000221 3300045976 Bacteria 24435
378 Ga0466967_0002137 3300045976 Bacteria 12121
379 Ga0466967_0002877 3300045976 Bacteria 10952
380 Ga0466967_0013743 3300045976 Bacteria 6272
381 Ga0466967_0094365 3300045976 Bacteria 2724
382 Ga0466967_0108376 3300045976 Bacteria 2549
383 Ga0466967_0142539 3300045976 Bacteria 2233
384 Ga0466967_0200384 3300045976 Bacteria 1890
385 Ga0466967_0226024 3300045976 Bacteria 1780
386 Ga0466967_0270845 3300045976 Bacteria 1627
387 Ga0466967_0493690 3300045976 Bacteria 1200
388 Ga0466967_0819939 3300045976 Bacteria 924
389 Ga0466967_0919477 3300045976 Bacteria 870
390 Ga0466967_0946046 3300045976 Bacteria 857
391 Ga0466967_0954055 3300045976 Bacteria 853
392 Ga0466967_1714386 3300045976 Bacteria 626
393 Ga0466967_2030007 3300045976 Bacteria 572
394 Ga0466967_2296544 3300045976 Bacteria 535
395 Ga0495603_0363413 3300046455 Bacteria 830
396 Ga0495629_0000194 3300046459 Bacteria 54501
397 Ga0495641_0000850 3300046461 Bacteria 26094
398 Ga0495651_0025004 3300046462 Bacteria 4646
399 Ga0495651_0037562 3300046462 Bacteria 3771
400 Ga0495653_0026482 3300046463 Bacteria 4649
401 Ga0495582_0000317 3300046473 Bacteria 26470
402 Ga0495582_0066628 3300046473 Bacteria 1990
403 Ga0495605_0050655 3300046474 Bacteria 2025
404 Ga0495639_0001774 3300046475 Bacteria 9556
405 Ga0495662_0053966 3300046476 Bacteria 1941
406 Ga0495664_0022024 3300046477 Bacteria 3687
407 Ga0495664_0251138 3300046477 Bacteria 1069
408 Ga0495594_0103780 3300046499 Bacteria 1600
409 Ga0495608_0043053 3300046511 Bacteria 3018
410 Ga0495608_0067597 3300046511 Bacteria 2338
411 Ga0495618_0044439 3300046514 Bacteria 2802
412 Ga0495628_0045334 3300046516 Bacteria 3497
413 Ga0495630_0069394 3300046517 Bacteria 2651
414 Ga0495630_0117512 3300046517 Bacteria 2016
415 Ga0495666_0117399 3300046526 Bacteria 1247
416 Ga0495652_0160597 3300046529 Bacteria 1745
417 Ga0495665_0030981 3300046531 Bacteria 2862
418 Ga0495586_0148751 3300046535 Bacteria 1317
419 Ga0495587_0084731 3300046536 Bacteria 1835
420 Ga0495645_0028989 3300046543 Bacteria 4023
421 Ga0495667_0023127 3300046559 Bacteria 4188
422 Ga0495667_0137838 3300046559 Bacteria 1573
423 Ga0495667_0816426 3300046559 Bacteria 574
424 Ga0495634_0025218 3300046642 Bacteria 4165
425 Ga0495635_0051537 3300046663 Bacteria 2835
426 Ga0495588_0713411 3300046674 Bacteria 524
427 Ga0495657_0261949 3300046675 Bacteria 1038
428 Ga0495657_0638657 3300046675 Bacteria 614
429 Ga0495599_0061543 3300046678 Bacteria 2346
430 Ga0495646_0607810 3300046680 Bacteria 555
431 Ga0495647_0004994 3300046681 Bacteria 4345
432 Ga0495658_0000224 3300046683 Bacteria 32518
433 Ga0495658_0103528 3300046683 Bacteria 1702
434 Ga0495613_0001177 3300046689 Bacteria 19969
435 Ga0495613_0035864 3300046689 Bacteria 3679
436 Ga0495624_0010250 3300046690 Bacteria 6460
437 Ga0495600_0002823 3300046809 Bacteria 10102
438 Ga0495600_0052183 3300046809 Bacteria 2670
439 Ga0495600_0449906 3300046809 Bacteria 797
440 Ga0495581_0001581 3300047315 Bacteria 12707
441 Ga0495604_0008755 3300047317 Bacteria 7997
442 Ga0495604_0385655 3300047317 Bacteria 925
443 Ga0495674_0260957 3300047319 Bacteria 1423
444 Ga0495674_0403296 3300047319 Bacteria 1103
445 Ga0495676_0002504 3300047321 Bacteria 16355
446 Ga0495676_0049841 3300047321 Bacteria 3363
447 Ga0495680_0006155 3300047322 Bacteria 11193
448 Ga0495680_0930331 3300047322 Bacteria 560
449 Ga0495675_0089447 3300047444 Bacteria 1933
450 Ga0495684_0057953 3300047471 Bacteria 2951
451 Ga0495684_0118247 3300047471 Bacteria 1997
452 Ga0495593_0012213 3300047673 Bacteria 4910
453 Ga0495602_0445319 3300048088 Bacteria 915
454 Ga0495614_0002669 3300048089 Bacteria 7928
455 Ga0495614_0118667 3300048089 Bacteria 1165
456 Ga0496100_0007025 3300048903 Bacteria 6176
457 Ga0496100_0030659 3300048903 Bacteria 3337
458 Ga0496100_0085189 3300048903 Bacteria 2144
459 Ga0496100_0146082 3300048903 Bacteria 1682
460 Ga0496100_0620669 3300048903 Bacteria 840
461 Ga0496101_0005132 3300048904 Bacteria 8327
462 Ga0496101_0026950 3300048904 Bacteria 3996
463 Ga0496101_0094320 3300048904 Bacteria 2230
464 Ga0496101_0106271 3300048904 Bacteria 2107
465 Ga0496102_0050087 3300048905 Bacteria 3802
466 Ga0496102_0206878 3300048905 Bacteria 1850
467 Ga0496102_0322514 3300048905 Bacteria 1455
468 Ga0496102_0476866 3300048905 Bacteria 1169
469 Ga0496102_0721240 3300048905 Bacteria 920
470 Ga0496103_0050432 3300048906 Bacteria 2575
471 Ga0496103_0067591 3300048906 Bacteria 2232
472 Ga0496103_0540089 3300048906 Bacteria 745
473 Ga0496104_0013997 3300048907 Bacteria 7237
474 Ga0496104_0134903 3300048907 Bacteria 2371
475 Ga0496105_0016517 3300048908 Bacteria 5894
476 Ga0496105_0080302 3300048908 Bacteria 2694
477 Ga0496105_0422944 3300048908 Bacteria 1054
478 Ga0496106_0010080 3300048909 Bacteria 6979
479 Ga0496106_0065857 3300048909 Bacteria 2758
480 Ga0496106_0138875 3300048909 Bacteria 1910
481 Ga0496107_0070179 3300048910 Bacteria 2543
482 Ga0496107_0122337 3300048910 Bacteria 1917
483 Ga0496107_0395070 3300048910 Bacteria 1028
484 Ga0496107_0580209 3300048910 Bacteria 829
485 Ga0496108_0039156 3300048911 Bacteria 3952
486 Ga0496109_0025879 3300048912 Bacteria 5230
487 Ga0496110_0357001 3300048913 Bacteria 1332
488 Ga0496111_0022179 3300048914 Bacteria 4442
489 Ga0496111_1352347 3300048914 Bacteria 500
490 Ga0496112_0058996 3300048915 Bacteria 3781
491 Ga0496112_0124519 3300048915 Bacteria 2548
492 Ga0496112_0138139 3300048915 Bacteria 2407
493 Ga0496113_0068055 3300048916 Bacteria 2702
494 Ga0496113_0227936 3300048916 Bacteria 1485
495 Ga0496113_0615543 3300048916 Bacteria 869
496 Ga0496114_0002271 3300048917 Bacteria 14633
497 Ga0496114_0019327 3300048917 Bacteria 5519
498 Ga0496114_0078049 3300048917 Bacteria 2793
499 Ga0496114_0248069 3300048917 Bacteria 1566
500 Ga0496115_0003388 3300048918 Bacteria 11443
501 Ga0496115_0003556 3300048918 Bacteria 11211
502 Ga0496115_0010180 3300048918 Bacteria 7018
503 Ga0501046_0696649 3300049580 Bacteria 716
504 Ga0501047_0481621 3300049581 Bacteria 1068
505 Ga0501067_0000845 3300049583 Bacteria 16504
506 Ga0501067_0170486 3300049583 Bacteria 1212
507 Ga0501068_0486858 3300049584 Bacteria 799
508 Ga0501069_0001111 3300049585 Bacteria 12988
509 Ga0501069_0130380 3300049585 Unclassified 1439
510 Ga0501069_0222881 3300049585 Bacteria 1096
511 Ga0501069_0572757 3300049585 Bacteria 676
512 Ga0501070_0088289 3300049586 Bacteria 2566
513 Ga0501070_0877017 3300049586 Bacteria 701
514 Ga0501074_0069857 3300049590 Bacteria 2525
515 Ga0501081_0629947 3300049743 Bacteria 803
516 Ga0501035_0348460 3300049822 Bacteria 1240
517 Ga0501044_1213376 3300049823 Bacteria 622
518 nmdc:mga0n895_63654_c1 3300050512 Bacteria 3647
519 nmdc:mga0rr50_5367_c1 3300050513 Bacteria 7637
520 nmdc:mga08x19_91593_c1 3300050514 Bacteria 2007
521 Ga0495601_0077459 3300053077 Bacteria 2129
522 Ga0495612_0009638 3300053078 Bacteria 3912
523 Ga0495655_0000869 3300053083 Bacteria 4720
524 Ga0495595_0007508 3300053084 Bacteria 4466
525 Ga0495595_0106303 3300053084 Bacteria 1358
526 Ga0495619_0112832 3300053085 Bacteria 1858
527 Ga0466962_0000257 3300061719 Bacteria 22422
528 Ga0466962_0167721 3300061719 Bacteria 1068
529 Ga0466962_0224272 3300061719 Bacteria 921
530 Ga0530510_0039653 3300061734 Bacteria 3400
531 Ga0436365_0701893
532 Ga0070658_10062197
533 Ga0070658_10097813
534 Ga0070658_10504240
535 Ga0070683_100119475
536 Ga0070683_100225128
537 Ga0070683_100292981
538 Ga0070683_100500572
539 Ga0070683_101446541
540 Ga0070683_101566247
541 Ga0070680_100153110
542 Ga0070680_100300768
543 Ga0070680_100852557
544 Ga0070680_100886019
545 Ga0070682_100206142
546 Ga0070682_101359676
547 Ga0068868_100591880
548 Ga0070660_100035792
549 Ga0070660_100294433
550 Ga0070660_100295845
551 Ga0070660_100973497
552 Ga0070660_101274368
553 Ga0070660_101555829
554 Ga0070691_10821502
555 Ga0070661_100024555
556 Ga0070661_100060619
557 Ga0070661_100604824
558 Ga0070661_100943074
559 Ga0070661_101516816
560 Ga0070661_101733287
561 Ga0070659_100743076
562 Ga0070709_10296964
563 Ga0070709_10315465
564 Ga0070714_100215125
565 Ga0070714_100693894
566 Ga0070713_100200048
567 Ga0070710_10140270
568 Ga0070710_10227836
569 Ga0070710_10687766
570 Ga0070711_100013583
571 Ga0070711_100889194
572 Ga0070711_101065228
573 Ga0070705_100652455
574 Ga0070708_100804374
575 Ga0070708_101193281
576 Ga0070663_101283833
577 Ga0070663_101308525
578 Ga0070678_101221127
579 Ga0070678_101649782
580 Ga0070662_101666803
581 Ga0070681_10017798
582 Ga0070681_10031962
583 Ga0070681_10038129
584 Ga0070681_10156281
585 Ga0070681_10190537
586 Ga0070681_10279109
587 Ga0070681_10523078
588 Ga0070706_100642987
589 Ga0070706_101254798
590 Ga0070707_100986456
591 Ga0070707_101411751
592 Ga0070698_100792040
593 Ga0070699_101510767
594 Ga0070679_100053210
595 Ga0070679_100146636
596 Ga0070679_100159613
597 Ga0070679_100590826
598 Ga0070679_101784731
599 Ga0070684_100049912
600 Ga0070684_100230109
601 Ga0070684_100497581
602 Ga0070684_100880179
603 Ga0070684_101035582
604 Ga0070684_101875798
605 Ga0070697_101572983
606 Ga0068853_100139657
607 Ga0068853_100261028
608 Ga0068853_101766400
609 Ga0070665_100011253
610 Ga0070665_101269717
611 Ga0068855_100076153
612 Ga0068855_100098953
613 Ga0068855_100301361
614 Ga0068855_100404452
615 Ga0068855_100591451
616 Ga0068855_100722259
617 Ga0068857_100336713
618 Ga0068857_101000889
619 Ga0068854_102033118
620 Ga0068856_100262134
621 Ga0068856_100282119
622 Ga0068856_100529565
623 Ga0068856_100630588
624 Ga0068852_100125770
625 Ga0068852_100384479
626 Ga0068852_100637197
627 Ga0068851_10511552
628 Ga0068858_102327344
629 Ga0070717_11219155
630 Ga0070715_10120062
631 Ga0070716_100313804
632 Ga0097621_100577141
633 Ga0068871_100166588
634 Ga0075433_11075021
635 Ga0075434_100292884
636 Ga0075436_100137669
637 Ga0075435_100049753
638 Ga0105240_10092476
639 Ga0105240_10604472
640 Ga0105240_10609632
641 Ga0105240_11001525
642 Ga0105240_11411339
643 Ga0105240_11661589
644 Ga0105240_11678798
645 Ga0105245_11015489
646 Ga0105245_12122064
647 Ga0105241_10351757
648 Ga0105241_10895225
649 Ga0105241_11118618
650 Ga0105241_11344072
651 Ga0105242_10022608
652 Ga0105242_12142923
653 Ga0105242_12318574
654 Ga0105237_10176046
655 Ga0105237_10326609
656 Ga0105237_11643281
657 Ga0105238_10237010
658 Ga0105238_10761001
659 Ga0105238_10899756
660 Ga0105239_10817819
661 Ga0105239_11067906
662 Ga0157373_10929920
663 Ga0157370_10015630
664 Ga0157370_10036790
665 Ga0157370_10177450
666 Ga0157370_10249394
667 Ga0157370_10438106
668 Ga0157370_10942473
669 Ga0157370_10990745
670 Ga0157369_10002657
671 Ga0157369_10126450
672 Ga0157369_10539486
673 Ga0157369_10652667
674 Ga0157369_10699311
675 Ga0157369_11824049
676 Ga0157369_12352150
677 Ga0157369_12387206
678 Ga0157374_10952066
679 Ga0157378_10202794
680 Ga0157378_11109875
681 Ga0157372_10040317
682 Ga0157372_10315109
683 Ga0157372_10470703
684 Ga0157372_12383447
685 Ga0157372_12918432
686 Ga0157372_13034919
687 Ga0157375_12109058
688 Ga0182008_10051801
689 Ga0182008_10130853
690 Ga0182008_10196099
691 Ga0182008_10439384
692 Ga0182008_10598067
693 Ga0157376_11458542
694 Ga0182006_1290120
695 Ga0182007_10124110
696 Ga0182007_10261022
697 Ga0197907_11154728
698 Ga0206356_10212333
699 Ga0206356_10602804
700 Ga0206356_10900205
701 Ga0206356_10985006
702 Ga0206356_11621634
703 Ga0206356_11651324
704 Ga0206354_10547085
705 Ga0206354_10974966
706 Ga0206354_11443079
707 Ga0206353_10119475
708 Ga0206353_10181076
709 Ga0206353_10203657
710 Ga0206353_10379293
711 Ga0206353_10381735
712 Ga0206353_12046548
713 Ga0213876_10134117
714 Ga0207692_10254480
715 Ga0207692_10391886
716 Ga0207692_10425751
717 Ga0207685_10166623
718 Ga0207685_10551124
719 Ga0207699_10229628
720 Ga0207705_10038581
721 Ga0207705_10096962
722 Ga0207654_10275734
723 Ga0207654_10279964
724 Ga0207654_11059716
725 Ga0207707_10006845
726 Ga0207707_10016574
727 Ga0207707_10034460
728 Ga0207707_10258541
729 Ga0207707_10529672
730 Ga0207695_10040302
731 Ga0207695_10126563
732 Ga0207695_10807599
733 Ga0207695_10887671
734 Ga0207695_10897261
735 Ga0207671_10070235
736 Ga0207671_10252371
737 Ga0207693_10621426
738 Ga0207663_10008237
739 Ga0207663_10358400
740 Ga0207663_11554184
741 Ga0207660_10038517
742 Ga0207660_10237079
743 Ga0207660_10352203
744 Ga0207660_11123413
745 Ga0207657_10002824
746 Ga0207657_10012342
747 Ga0207657_10042675
748 Ga0207657_10234387
749 Ga0207657_10315293
750 Ga0207657_10374978
751 Ga0207649_10182642
752 Ga0207649_10550181
753 Ga0207649_10865025
754 Ga0207649_10993820
755 Ga0207652_10058222
756 Ga0207652_10176814
757 Ga0207652_10384415
758 Ga0207652_10504941
759 Ga0207652_11509310
760 Ga0207646_11573269
761 Ga0207694_10128491
762 Ga0207694_10272545
763 Ga0207694_10542028
764 Ga0207650_11354546
765 Ga0207700_11901263
766 Ga0207664_10110404
767 Ga0207664_10146145
768 Ga0207664_10443211
769 Ga0207664_11093410
770 Ga0207664_11295758
771 Ga0207686_10026385
772 Ga0207686_11797206
773 Ga0207665_10352578
774 Ga0207661_10219213
775 Ga0207661_10733126
776 Ga0207661_11920036
777 Ga0207679_10856665
778 Ga0207667_10089901
779 Ga0207667_10193033
780 Ga0207667_10392924
781 Ga0207667_10522619
782 Ga0207667_11100607
783 Ga0207667_11628129
784 Ga0207667_11923042
785 Ga0207640_10291217
786 Ga0207658_10004832
787 Ga0207703_10215430
788 Ga0207639_10347792
789 Ga0207639_11055905
790 Ga0207678_10180042
791 Ga0207678_11001189
792 Ga0207702_10737219
793 Ga0207674_10300614
794 Ga0207674_10362945
795 Ga0207683_10161621
796 Ga0207698_10074300
797 Ga0207698_11272475
798 Ga0268266_10025493
799 Ga0268266_11021513
800 Ga0265334_10293483
801 Ga0265318_10119073
802 Ga0265322_10013003
803 Ga0265338_10054346
804 Ga0265338_11136464
805 Ga0265330_10063123
806 Ga0265325_10146629
807 Ga0265339_10041736
808 Ga0265331_10145100
809 Ga0265331_10168352
810 Ga0265327_10008869
811 Ga0265316_10008441
812 Ga0265313_10002660
813 Ga0265314_10003929
814 Ga0265342_10021116
815 Ga0373926_0010942
816 Ga0373926_0141747
817 Ga0373944_0008204
818 Ga0373936_0014573
819 Ga0373936_0031561
820 Ga0373945_0003761
821 Ga0373945_0036219
822 Ga0373943_0000538
823 Ga0373943_0014138
824 Ga0373946_0761651
825 Ga0373924_0485403
826 Ga0373935_0087987
827 Ga0373935_0109829
828 Ga0373927_0025083
829 Ga0373947_0000066
830 Ga0373947_0003591
831 Ga0373937_0227948
832 Ga0373925_0003351
833 Ga0373925_0033365
834 Ga0395899_0199877
835 Ga0395899_0271593
836 Ga0395900_0168172
837 Ga0395900_0339514
838 Ga0395900_0526595
839 Ga0395900_0995215
840 Ga0395900_1013075
841 Ga0395900_1735454
842 Ga0395898_0005527
843 Ga0395898_0134482
844 Ga0395898_0144583
845 Ga0395898_0590784
846 Ga0395898_0597639
847 Ga0395898_0679479
848 Ga0395905_0036251
849 Ga0436364_1209114
850 Ga0395901_0033926
851 Ga0395901_0121797
852 Ga0395901_0259497
853 Ga0395901_0467664
854 Ga0395901_0654807
855 Ga0395901_1530528
856 Ga0395901_1715721
857 Ga0436365_1634939
858 Ga0436360_0341402
859 Ga0436363_1450105
860 Ga0436362_0430525
861 Ga0439448_0245944
862 Ga0466969_0182511
863 Ga0466972_0365937
864 Ga0466972_0506811
865 Ga0466965_0223203
866 Ga0466966_0023644
867 Ga0466966_0030664
868 Ga0466966_0070743
869 Ga0466961_0000424
870 Ga0466961_0031926
871 Ga0466961_0043938
872 Ga0466961_0081722
873 Ga0466961_0845817
874 Ga0466963_0002241
875 Ga0466963_0017573
876 Ga0466963_0050294
877 Ga0466963_0237634
878 Ga0466963_0280746
879 Ga0466963_0499790
880 Ga0466964_0002641
881 Ga0466964_0185908
882 Ga0466971_0001169
883 Ga0466971_0054512
884 Ga0466971_0070049
885 Ga0466968_0006432
886 Ga0466968_0327035
887 Ga0466970_0090985
888 Ga0466957_0000598
889 Ga0466957_0124850
890 Ga0466957_0185481
891 Ga0466957_0521968
892 Ga0466957_0744322
893 Ga0466960_0120950
894 Ga0466960_0490225
895 Ga0466959_0013344
896 Ga0466959_0050603
897 Ga0466959_0061341
898 Ga0466959_0177405
899 Ga0466959_0273973
900 Ga0451576_0270243
901 Ga0466958_0002350
902 Ga0466958_0011139
903 Ga0466958_0022990
904 Ga0466958_0070650
905 Ga0466958_0644653
906 Ga0466958_0829750
907 Ga0466967_0000221
908 Ga0466967_0002137
909 Ga0466967_0002877
910 Ga0466967_0013743
911 Ga0466967_0094365
912 Ga0466967_0108376
913 Ga0466967_0142539
914 Ga0466967_0200384
915 Ga0466967_0226024
916 Ga0466967_0270845
917 Ga0466967_0493690
918 Ga0466967_0819939
919 Ga0466967_0919477
920 Ga0466967_0946046
921 Ga0466967_0954055
922 Ga0466967_1714386
923 Ga0466967_2030007
924 Ga0466967_2296544
925 Ga0495603_0363413
926 Ga0495629_0000194
927 Ga0495641_0000850
928 Ga0495651_0025004
929 Ga0495651_0037562
930 Ga0495653_0026482
931 Ga0495582_0000317
932 Ga0495582_0066628
933 Ga0495605_0050655
934 Ga0495639_0001774
935 Ga0495662_0053966
936 Ga0495664_0022024
937 Ga0495664_0251138
938 Ga0495594_0103780
939 Ga0495608_0043053
940 Ga0495608_0067597
941 Ga0495618_0044439
942 Ga0495628_0045334
943 Ga0495630_0069394
944 Ga0495630_0117512
945 Ga0495666_0117399
946 Ga0495652_0160597
947 Ga0495665_0030981
948 Ga0495586_0148751
949 Ga0495587_0084731
950 Ga0495645_0028989
951 Ga0495667_0023127
952 Ga0495667_0137838
953 Ga0495667_0816426
954 Ga0495634_0025218
955 Ga0495635_0051537
956 Ga0495588_0713411
957 Ga0495657_0261949
958 Ga0495657_0638657
959 Ga0495599_0061543
960 Ga0495646_0607810
961 Ga0495647_0004994
962 Ga0495658_0000224
963 Ga0495658_0103528
964 Ga0495613_0001177
965 Ga0495613_0035864
966 Ga0495624_0010250
967 Ga0495600_0002823
968 Ga0495600_0052183
969 Ga0495600_0449906
970 Ga0495581_0001581
971 Ga0495604_0008755
972 Ga0495604_0385655
973 Ga0495674_0260957
974 Ga0495674_0403296
975 Ga0495676_0002504
976 Ga0495676_0049841
977 Ga0495680_0006155
978 Ga0495680_0930331
979 Ga0495675_0089447
980 Ga0495684_0057953
981 Ga0495684_0118247
982 Ga0495593_0012213
983 Ga0495602_0445319
984 Ga0495614_0002669
985 Ga0495614_0118667
986 Ga0496100_0007025
987 Ga0496100_0030659
988 Ga0496100_0085189
989 Ga0496100_0146082
990 Ga0496100_0620669
991 Ga0496101_0005132
992 Ga0496101_0026950
993 Ga0496101_0094320
994 Ga0496101_0106271
995 Ga0496102_0050087
996 Ga0496102_0206878
997 Ga0496102_0322514
998 Ga0496102_0476866
999 Ga0496102_0721240
1000 Ga0496103_0050432
1001 Ga0496103_0067591
1002 Ga0496103_0540089
1003 Ga0496104_0013997
1004 Ga0496104_0134903
1005 Ga0496105_0016517
1006 Ga0496105_0080302
1007 Ga0496105_0422944
1008 Ga0496106_0010080
1009 Ga0496106_0065857
1010 Ga0496106_0138875
1011 Ga0496107_0070179
1012 Ga0496107_0122337
1013 Ga0496107_0395070
1014 Ga0496107_0580209
1015 Ga0496108_0039156
1016 Ga0496109_0025879
1017 Ga0496110_0357001
1018 Ga0496111_0022179
1019 Ga0496111_1352347
1020 Ga0496112_0058996
1021 Ga0496112_0124519
1022 Ga0496112_0138139
1023 Ga0496113_0068055
1024 Ga0496113_0227936
1025 Ga0496113_0615543
1026 Ga0496114_0002271
1027 Ga0496114_0019327
1028 Ga0496114_0078049
1029 Ga0496114_0248069
1030 Ga0496115_0003388
1031 Ga0496115_0003556
1032 Ga0496115_0010180
1033 Ga0501046_0696649
1034 Ga0501047_0481621
1035 Ga0501067_0000845
1036 Ga0501067_0170486
1037 Ga0501068_0486858
1038 Ga0501069_0001111
1039 Ga0501069_0130380
1040 Ga0501069_0222881
1041 Ga0501069_0572757
1042 Ga0501070_0088289
1043 Ga0501070_0877017
1044 Ga0501074_0069857
1045 Ga0501081_0629947
1046 Ga0501035_0348460
1047 Ga0501044_1213376
1048 nmdc:mga0n895_63654_c1
1049 nmdc:mga0rr50_5367_c1
1050 nmdc:mga08x19_91593_c1
1051 Ga0495601_0077459
1052 Ga0495612_0009638
1053 Ga0495655_0000869
1054 Ga0495595_0007508
1055 Ga0495595_0106303
1056 Ga0495619_0112832
1057 Ga0466962_0000257
1058 Ga0466962_0167721
1059 Ga0466962_0224272
1060 Ga0530510_0039653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xmo-assembly1.cif.gz_A the crystal structure of lmo2642 0.9498 50 65
7xv0-assembly1.cif.gz_A crystal structure of rpa70n-blmp1 fusion 0.8242 50 66
4ipg-assembly1.cif.gz_A structure of the n-terminal domain of rpa70, e7r, e100r mutant 0.8157 50 66
7zd7-assembly1.cif.gz_A crystal structure of the r24e/e352t double mutant of s-adenosyl-l-homocysteine hydrolase from synechocystis sp. pcc 6803 cocrystallized with adenosine in the presence of rb+ cations 0.8153 49 64
5eay-assembly1.cif.gz_B crystal structure of a dna2 peptide in complex with rpa 70n 0.7995 50 66
ID Description Score Start End Superfamily
2xmoA01 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9498 50 65 3.60.21.10
3sk1A02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8512 50 66 3.30.720.110
af_Q8IIN5_1_445_1.10.1370.30 Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; 0.7385 48 67 1.10.1370.30
af_I1NGP4_33_562_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7359 41 68 3.50.50.60
af_Q9C8U5_24_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7355 50 65 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A538J393-F1-model_v4 Uncharacterized protein 0.9414 2 65
AF-A0A7Y6CF62-F1-model_v4 Uncharacterized protein 0.9109 2 71
AF-A0A134A868-F1-model_v4 NIF system FeS cluster assembly NifU N-terminal domain-containing protein 0.9027 11 43
AF-A0A7W1GJJ4-F1-model_v4 Uncharacterized protein 0.8957 2 71
AF-A0A7W0P8V5-F1-model_v4 Uncharacterized protein 0.8915 2 68

Map