F459947

General Info

Members Datasets Scaffolds Average Seq Length
530 253 1060 303

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10014686|Ga0157370_100146864
Length 342
Sequence MEFLPVVVQTSRSPIASDFNGQGGNFGVTRRSTSLAGVSPFDAPGAWLRCALHAHTTNSDGELAPELLARHYEWAGYDVLAISDHWVRTEVPSTEKLLVIPSVELNAIAPSRDDDAHVLALGLAVDPVVPELEFAPLQEVVSWTVANGGVAFLAHTYWSGLRVSQWEDCEGLAGIEVWNTGCELELGRGDSSLHWDEALERGRELYGLATDDSHHPGYDSGFAWTWVRAEERTQAAVLEALRTGRFYGSTGPRIDAVDVSDGDVTVRCSPAASVTLYTGRRRGARANAGRLGYPHNAQILERDERGSITAVRLERPFSQPYGRVEIADAEGNRAWTNPLWIA

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
117 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
118 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
123 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
124 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
138 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
139 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
158 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
159 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
160 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
163 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
164 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
172 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
173 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
176 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.74
Rhizosphere 91.51
Stem 0
Stem Tuber 0
Unclassified 2.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10014686 3300013104 Bacteria 7999
2 Ga0070658_10019322 3300005327 Bacteria 5457
3 Ga0070658_10026096 3300005327 Bacteria 4687
4 Ga0070658_10041793 3300005327 Bacteria 3699
5 Ga0070683_100109587 3300005329 Bacteria 2604
6 Ga0070683_100213883 3300005329 Unclassified 1832
7 Ga0070683_100349679 3300005329 Bacteria 1408
8 Ga0070690_100222552 3300005330 Bacteria 1323
9 Ga0070670_100007002 3300005331 Bacteria 9554
10 Ga0070680_100057510 3300005336 Bacteria 3179
11 Ga0070680_100060848 3300005336 Bacteria 3090
12 Ga0070680_100082841 3300005336 Bacteria 2648
13 Ga0070680_100098798 3300005336 Bacteria 2422
14 Ga0070682_100040362 3300005337 Bacteria 2871
15 Ga0070682_100043653 3300005337 Bacteria 2773
16 Ga0068868_100062336 3300005338 Bacteria 2955
17 Ga0070660_100005649 3300005339 Bacteria 8668
18 Ga0070660_100005959 3300005339 Bacteria 8425
19 Ga0070660_100010773 3300005339 Bacteria 6472
20 Ga0070660_100016960 3300005339 Bacteria 5301
21 Ga0070660_100079475 3300005339 Bacteria 2573
22 Ga0070660_100350526 3300005339 Bacteria 1216
23 Ga0070661_100003244 3300005344 Bacteria 11212
24 Ga0070661_100004837 3300005344 Bacteria 9273
25 Ga0070661_100026577 3300005344 Bacteria 4163
26 Ga0070661_100109169 3300005344 Bacteria 2065
27 Ga0070671_100022161 3300005355 Bacteria 5189
28 Ga0070674_100010301 3300005356 Bacteria 5645
29 Ga0070674_100036805 3300005356 Bacteria 3288
30 Ga0070673_100005214 3300005364 Bacteria 8299
31 Ga0070688_100104956 3300005365 Bacteria 1870
32 Ga0070659_100006172 3300005366 Bacteria 8653
33 Ga0070659_100070377 3300005366 Bacteria 2779
34 Ga0070659_100177175 3300005366 Bacteria 1748
35 Ga0070667_100426886 3300005367 Bacteria 1209
36 Ga0070714_100057021 3300005435 Bacteria 3342
37 Ga0070711_100234838 3300005439 Bacteria 1431
38 Ga0070705_100192132 3300005440 Bacteria 1392
39 Ga0070700_100008471 3300005441 Bacteria 5598
40 Ga0070700_100403373 3300005441 Unclassified 1028
41 Ga0070694_100053147 3300005444 Bacteria 2741
42 Ga0070708_100037480 3300005445 Bacteria 4230
43 Ga0070663_100109853 3300005455 Bacteria 2071
44 Ga0070678_100169969 3300005456 Bacteria 1774
45 Ga0070681_10005650 3300005458 Bacteria 12088
46 Ga0070681_10025620 3300005458 Bacteria 5933
47 Ga0070681_10026629 3300005458 Bacteria 5812
48 Ga0070681_10057036 3300005458 Bacteria 3886
49 Ga0070681_10070353 3300005458 Bacteria 3465
50 Ga0070681_10088405 3300005458 Bacteria 3050
51 Ga0070681_10434987 3300005458 Bacteria 1224
52 Ga0068867_100054634 3300005459 Bacteria 2950
53 Ga0070685_10172301 3300005466 Bacteria 1388
54 Ga0070706_100009868 3300005467 Bacteria 8872
55 Ga0070706_100019484 3300005467 Bacteria 6257
56 Ga0070707_100005697 3300005468 Bacteria 11625
57 Ga0070707_100268351 3300005468 Bacteria 1660
58 Ga0070698_100022630 3300005471 Bacteria 6573
59 Ga0070698_100077787 3300005471 Bacteria 3316
60 Ga0070698_100170035 3300005471 Bacteria 2121
61 Ga0070698_100515056 3300005471 Bacteria 1135
62 Ga0070699_100016026 3300005518 Bacteria 6436
63 Ga0070699_100017467 3300005518 Bacteria 6157
64 Ga0070699_100166654 3300005518 Bacteria 1951
65 Ga0070699_100286876 3300005518 Bacteria 1475
66 Ga0070679_100011093 3300005530 Bacteria 8575
67 Ga0070679_100067470 3300005530 Bacteria 3567
68 Ga0070679_100080315 3300005530 Bacteria 3250
69 Ga0070679_100105395 3300005530 Bacteria 2806
70 Ga0070679_100149093 3300005530 Bacteria 2316
71 Ga0070679_100209285 3300005530 Bacteria 1914
72 Ga0070679_100252543 3300005530 Unclassified 1719
73 Ga0070684_100087678 3300005535 Bacteria 2763
74 Ga0070684_100126001 3300005535 Bacteria 2307
75 Ga0070684_100142288 3300005535 Bacteria 2169
76 Ga0070684_100147609 3300005535 Bacteria 2129
77 Ga0070697_100283458 3300005536 Bacteria 1422
78 Ga0068853_100110838 3300005539 Bacteria 2438
79 Ga0070693_100159686 3300005547 Bacteria 1435
80 Ga0070665_100042873 3300005548 Bacteria 4548
81 Ga0070665_100437700 3300005548 Bacteria 1317
82 Ga0068855_100013836 3300005563 Bacteria 9729
83 Ga0068855_100024003 3300005563 Bacteria 7300
84 Ga0068855_100050632 3300005563 Bacteria 4893
85 Ga0068855_100075515 3300005563 Bacteria 3913
86 Ga0068855_100495923 3300005563 Unclassified 1328
87 Ga0068857_100012757 3300005577 Bacteria 7326
88 Ga0068857_100084823 3300005577 Bacteria 2831
89 Ga0068857_100085606 3300005577 Bacteria 2817
90 Ga0068856_100037872 3300005614 Bacteria 4732
91 Ga0068856_100070455 3300005614 Bacteria 3459
92 Ga0068852_100007847 3300005616 Bacteria 7814
93 Ga0068852_100059999 3300005616 Bacteria 3301
94 Ga0068852_100088223 3300005616 Bacteria 2770
95 Ga0068852_100359985 3300005616 Bacteria 1423
96 Ga0068864_100072939 3300005618 Bacteria 2993
97 Ga0068866_10016427 3300005718 Bacteria 3309
98 Ga0068861_100189613 3300005719 Bacteria 1718
99 Ga0068870_10003490 3300005840 Bacteria 6669
100 Ga0068858_100044925 3300005842 Bacteria 4094
101 Ga0068860_100049072 3300005843 Bacteria 4023
102 Ga0081539_10000294 3300005985 Bacteria 112974
103 Ga0075433_10142423 3300006852 Bacteria 2131
104 Ga0068865_100073557 3300006881 Bacteria 2431
105 Ga0068865_100099578 3300006881 Bacteria 2125
106 Ga0068865_100153500 3300006881 Bacteria 1749
107 Ga0075436_100026163 3300006914 Bacteria 4018
108 Ga0075436_100050626 3300006914 Bacteria 2867
109 Ga0075435_100055610 3300007076 Bacteria 3196
110 Ga0105240_10065537 3300009093 Bacteria 4509
111 Ga0105240_10180643 3300009093 Bacteria 2490
112 Ga0105240_10230272 3300009093 Bacteria 2154
113 Ga0111539_10083004 3300009094 Bacteria 3769
114 Ga0111539_10099078 3300009094 Bacteria 3423
115 Ga0105245_10143438 3300009098 Bacteria 2251
116 Ga0114129_10090183 3300009147 Bacteria 4250
117 Ga0114129_10091765 3300009147 Bacteria 4207
118 Ga0105243_10039954 3300009148 Bacteria 3661
119 Ga0105243_10068493 3300009148 Bacteria 2860
120 Ga0105242_10047676 3300009176 Bacteria 3480
121 Ga0105248_10135546 3300009177 Bacteria 2777
122 Ga0105237_10063071 3300009545 Bacteria 3704
123 Ga0105237_10572183 3300009545 Bacteria 1137
124 Ga0105238_10005266 3300009551 Bacteria 12790
125 Ga0105238_10370199 3300009551 Bacteria 1423
126 Ga0105249_10164565 3300009553 Bacteria 2146
127 Ga0105239_10763758 3300010375 Unclassified 1107
128 Ga0105246_10010520 3300011119 Bacteria 5728
129 Ga0105246_10183390 3300011119 Bacteria 1614
130 Ga0157373_10040219 3300013100 Bacteria 3346
131 Ga0157371_10162597 3300013102 Bacteria 1594
132 Ga0157370_10021407 3300013104 Bacteria 6444
133 Ga0157370_10045508 3300013104 Bacteria 4210
134 Ga0157370_10180640 3300013104 Bacteria 1961
135 Ga0157370_10351400 3300013104 Bacteria 1359
136 Ga0157369_10019130 3300013105 Bacteria 7666
137 Ga0157369_10111031 3300013105 Bacteria 2914
138 Ga0157369_10141850 3300013105 Bacteria 2542
139 Ga0157369_10143868 3300013105 Bacteria 2522
140 Ga0157369_10259822 3300013105 Bacteria 1811
141 Ga0157372_10009877 3300013307 Bacteria 10153
142 Ga0157372_10045224 3300013307 Bacteria 4882
143 Ga0157372_10083090 3300013307 Bacteria 3627
144 Ga0157372_10202486 3300013307 Bacteria 2300
145 Ga0157372_10263278 3300013307 Bacteria 2002
146 Ga0157375_10004601 3300013308 Bacteria 11989
147 Ga0157375_10052516 3300013308 Bacteria 4007
148 Ga0157375_10860433 3300013308 Unclassified 1053
149 Ga0157380_10018542 3300014326 Bacteria 5166
150 Ga0157379_10081836 3300014968 Bacteria 2892
151 Ga0157379_10158259 3300014968 Bacteria 2044
152 Ga0157376_10118226 3300014969 Bacteria 2345
153 Ga0157376_10289588 3300014969 Bacteria 1546
154 Ga0206354_11621865 3300020081 Bacteria 3388
155 Ga0206353_10307015 3300020082 Bacteria 3614
156 Ga0206353_10735197 3300020082 Bacteria 3939
157 Ga0207688_10016017 3300025901 Bacteria 4064
158 Ga0207688_10142510 3300025901 Bacteria 1411
159 Ga0207647_10063184 3300025904 Bacteria 2253
160 Ga0207699_10158985 3300025906 Bacteria 1502
161 Ga0207643_10002251 3300025908 Bacteria 10513
162 Ga0207643_10234048 3300025908 Bacteria 1127
163 Ga0207705_10054958 3300025909 Bacteria 2870
164 Ga0207705_10074353 3300025909 Bacteria 2467
165 Ga0207705_10092484 3300025909 Bacteria 2216
166 Ga0207705_10236879 3300025909 Bacteria 1389
167 Ga0207684_10017284 3300025910 Bacteria 6187
168 Ga0207684_10023546 3300025910 Bacteria 5258
169 Ga0207654_10167173 3300025911 Bacteria 1425
170 Ga0207707_10009140 3300025912 Bacteria 8607
171 Ga0207707_10034627 3300025912 Bacteria 4418
172 Ga0207707_10048159 3300025912 Bacteria 3712
173 Ga0207707_10060613 3300025912 Bacteria 3291
174 Ga0207695_10135042 3300025913 Bacteria 2421
175 Ga0207671_10067658 3300025914 Bacteria 2660
176 Ga0207671_10163080 3300025914 Bacteria 1727
177 Ga0207693_10094049 3300025915 Bacteria 2349
178 Ga0207660_10034071 3300025917 Bacteria 3527
179 Ga0207660_10161048 3300025917 Bacteria 1731
180 Ga0207657_10000523 3300025919 Bacteria 40648
181 Ga0207657_10002448 3300025919 Bacteria 20057
182 Ga0207657_10003418 3300025919 Bacteria 16947
183 Ga0207657_10003834 3300025919 Bacteria 15968
184 Ga0207657_10005194 3300025919 Bacteria 13655
185 Ga0207657_10008493 3300025919 Bacteria 10417
186 Ga0207657_10011705 3300025919 Bacteria 8693
187 Ga0207657_10323407 3300025919 Bacteria 1219
188 Ga0207649_10036322 3300025920 Bacteria 2967
189 Ga0207652_10013381 3300025921 Bacteria 6643
190 Ga0207652_10019374 3300025921 Bacteria 5596
191 Ga0207652_10029870 3300025921 Bacteria 4561
192 Ga0207652_10044278 3300025921 Bacteria 3791
193 Ga0207652_10093350 3300025921 Bacteria 2648
194 Ga0207652_10208612 3300025921 Bacteria 1759
195 Ga0207646_10002534 3300025922 Bacteria 21550
196 Ga0207694_10065287 3300025924 Bacteria 2837
197 Ga0207650_10011314 3300025925 Bacteria 6140
198 Ga0207687_10053829 3300025927 Bacteria 2813
199 Ga0207664_10006011 3300025929 Bacteria 8309
200 Ga0207664_10034417 3300025929 Bacteria 3902
201 Ga0207664_10051235 3300025929 Bacteria 3258
202 Ga0207664_10227459 3300025929 Bacteria 1620
203 Ga0207664_10374765 3300025929 Bacteria 1263
204 Ga0207644_10514913 3300025931 Bacteria 988
205 Ga0207690_10005115 3300025932 Bacteria 7747
206 Ga0207690_10031959 3300025932 Bacteria 3373
207 Ga0207706_10007115 3300025933 Bacteria 10354
208 Ga0207706_10010507 3300025933 Bacteria 8460
209 Ga0207709_10009851 3300025935 Bacteria 5261
210 Ga0207669_10033331 3300025937 Bacteria 2905
211 Ga0207669_10065958 3300025937 Bacteria 2249
212 Ga0207669_10196642 3300025937 Bacteria 1460
213 Ga0207704_10130857 3300025938 Bacteria 1737
214 Ga0207691_10052518 3300025940 Bacteria 3723
215 Ga0207691_10133364 3300025940 Bacteria 2192
216 Ga0207661_10024416 3300025944 Bacteria 4582
217 Ga0207661_10095049 3300025944 Bacteria 2491
218 Ga0207661_10099184 3300025944 Bacteria 2442
219 Ga0207661_10333265 3300025944 Bacteria 1366
220 Ga0207667_10100897 3300025949 Bacteria 2977
221 Ga0207667_10145894 3300025949 Bacteria 2436
222 Ga0207667_10152026 3300025949 Bacteria 2382
223 Ga0207667_10558667 3300025949 Bacteria 1157
224 Ga0207668_10120751 3300025972 Bacteria 1984
225 Ga0207703_10399479 3300026035 Bacteria 1275
226 Ga0207639_10195990 3300026041 Bacteria 1729
227 Ga0207678_10044429 3300026067 Bacteria 3843
228 Ga0207678_10180013 3300026067 Bacteria 1805
229 Ga0207708_10018844 3300026075 Bacteria 5198
230 Ga0207708_10097425 3300026075 Bacteria 2273
231 Ga0207702_10106154 3300026078 Bacteria 2488
232 Ga0207648_10239158 3300026089 Bacteria 1616
233 Ga0207674_10014270 3300026116 Bacteria 8780
234 Ga0207674_10031572 3300026116 Bacteria 5563
235 Ga0207674_10046203 3300026116 Bacteria 4472
236 Ga0207674_10100404 3300026116 Bacteria 2875
237 Ga0207674_10286042 3300026116 Bacteria 1597
238 Ga0207675_100031233 3300026118 Bacteria 4961
239 Ga0207683_10055273 3300026121 Bacteria 3481
240 Ga0207698_10019613 3300026142 Bacteria 4634
241 Ga0268266_10303294 3300028379 Bacteria 1491
242 Ga0265319_1001008 3300028563 Bacteria 17574
243 Ga0265319_1048339 3300028563 Bacteria 1412
244 Ga0265319_1079821 3300028563 Bacteria 1040
245 Ga0265334_10000248 3300028573 Bacteria 30961
246 Ga0265334_10003569 3300028573 Bacteria 7049
247 Ga0265334_10042942 3300028573 Bacteria 1761
248 Ga0265318_10000303 3300028577 Bacteria 39690
249 Ga0265318_10000982 3300028577 Bacteria 18274
250 Ga0265338_10003055 3300028800 Bacteria 24061
251 Ga0265338_10015934 3300028800 Bacteria 8221
252 Ga0265338_10083830 3300028800 Bacteria 2664
253 Ga0265338_10129523 3300028800 Bacteria 1995
254 Ga0265338_10152079 3300028800 Bacteria 1797
255 Ga0265324_10017363 3300029957 Bacteria 2618
256 Ga0265330_10020041 3300031235 Bacteria 3058
257 Ga0265320_10006988 3300031240 Bacteria 7042
258 Ga0265320_10013106 3300031240 Bacteria 4782
259 Ga0265325_10000058 3300031241 Bacteria 76250
260 Ga0265329_10017799 3300031242 Bacteria 2439
261 Ga0265329_10019580 3300031242 Bacteria 2295
262 Ga0265340_10000310 3300031247 Bacteria 25679
263 Ga0265340_10014758 3300031247 Bacteria 4073
264 Ga0265339_10138461 3300031249 Bacteria 1240
265 Ga0265327_10004922 3300031251 Bacteria 11520
266 Ga0265327_10006105 3300031251 Bacteria 9763
267 Ga0265327_10016013 3300031251 Bacteria 4796
268 Ga0265327_10031429 3300031251 Bacteria 2983
269 Ga0265316_10000677 3300031344 Bacteria 37948
270 Ga0265316_10007566 3300031344 Bacteria 10222
271 Ga0265313_10007562 3300031595 Bacteria 7385
272 Ga0265313_10033399 3300031595 Bacteria 2615
273 Ga0265314_10003537 3300031711 Bacteria 15091
274 Ga0265314_10006697 3300031711 Bacteria 10122
275 Ga0265342_10001041 3300031712 Bacteria 27186
276 Ga0265342_10007711 3300031712 Bacteria 7836
277 Ga0307405_10041401 3300031731 Bacteria 2796
278 Ga0307406_10064031 3300031901 Bacteria 2384
279 Ga0307409_100004610 3300031995 Bacteria 7780
280 Ga0307416_100007197 3300032002 Bacteria 7046
281 Ga0307415_100000579 3300032126 Bacteria 16085
282 Ga0373958_0024809 3300034819 Bacteria 1138
283 Ga0373945_0007355 3300035116 Bacteria 3570
284 Ga0373960_0032992 3300035121 Bacteria 1457
285 Ga0373943_0015749 3300035170 Bacteria 3438
286 Ga0373946_0051120 3300035171 Bacteria 1729
287 Ga0373962_0050772 3300035242 Bacteria 1195
288 Ga0373935_0036524 3300035692 Bacteria 3072
289 Ga0373933_0079413 3300035724 Bacteria 2009
290 Ga0373947_0001437 3300035725 Bacteria 14644
291 Ga0373925_0014217 3300037068 Bacteria 5759
292 Ga0395899_0015517 3300037312 Bacteria 5808
293 Ga0395899_0071730 3300037312 Bacteria 2535
294 Ga0395900_0027315 3300037418 Bacteria 5845
295 Ga0395900_0034003 3300037418 Bacteria 5247
296 Ga0395900_0111091 3300037418 Bacteria 2815
297 Ga0395898_0024615 3300037466 Bacteria 6071
298 Ga0395898_0033733 3300037466 Bacteria 5106
299 Ga0395898_0059449 3300037466 Bacteria 3718
300 Ga0395898_0079268 3300037466 Bacteria 3168
301 Ga0395898_0142961 3300037466 Bacteria 2291
302 Ga0395898_0205855 3300037466 Bacteria 1877
303 Ga0395898_0216632 3300037466 Bacteria 1826
304 Ga0395905_0003664 3300037471 Bacteria 16295
305 Ga0395905_0035086 3300037471 Bacteria 4709
306 Ga0395905_0048546 3300037471 Bacteria 3978
307 Ga0395901_0001426 3300038443 Bacteria 24921
308 Ga0395901_0020937 3300038443 Bacteria 6699
309 Ga0395901_0021621 3300038443 Bacteria 6591
310 Ga0395901_0031917 3300038443 Bacteria 5432
311 Ga0395901_0118801 3300038443 Bacteria 2778
312 Ga0395901_0184634 3300038443 Bacteria 2187
313 Ga0395901_0273403 3300038443 Bacteria 1757
314 Ga0395901_0550707 3300038443 Bacteria 1169
315 Ga0436365_1186631 3300039437 Bacteria 1497
316 Ga0436365_1684611 3300039437 Bacteria 4014
317 Ga0436360_0228179 3300039438 Bacteria 4087
318 Ga0436363_1074191 3300039450 Bacteria 1377
319 Ga0451807_1516737 3300041486 Unclassified 950
320 Ga0451853_0797023 3300041512 Bacteria 5452
321 Ga0439434_0008314 3300042435 Bacteria 3043
322 Ga0439459_0025144 3300042438 Unclassified 1174
323 Ga0466966_0183051 3300044684 Bacteria 1271
324 Ga0466961_0001503 3300044693 Bacteria 14474
325 Ga0466961_0003222 3300044693 Bacteria 10150
326 Ga0466961_0091149 3300044693 Bacteria 1925
327 Ga0466963_0000931 3300044694 Bacteria 14949
328 Ga0466963_0001489 3300044694 Bacteria 12648
329 Ga0466963_0016443 3300044694 Bacteria 4601
330 Ga0466963_0019957 3300044694 Bacteria 4211
331 Ga0466963_0035339 3300044694 Bacteria 3255
332 Ga0466963_0217345 3300044694 Bacteria 1338
333 Ga0466964_0004694 3300044706 Bacteria 5050
334 Ga0466964_0006586 3300044706 Bacteria 4331
335 Ga0466971_0000602 3300044719 Bacteria 14279
336 Ga0466971_0012472 3300044719 Bacteria 3727
337 Ga0466971_0062894 3300044719 Bacteria 1680
338 Ga0466968_0027048 3300044735 Bacteria 2358
339 Ga0466957_0000159 3300044842 Bacteria 29481
340 Ga0466957_0072535 3300044842 Bacteria 2132
341 Ga0466957_0126509 3300044842 Bacteria 1633
342 Ga0466960_0024193 3300044901 Bacteria 2738
343 Ga0466959_0085390 3300045049 Bacteria 2271
344 Ga0466958_0000770 3300045836 Bacteria 14089
345 Ga0466967_0000393 3300045976 Bacteria 20421
346 Ga0466967_0000488 3300045976 Bacteria 19271
347 Ga0466967_0001271 3300045976 Bacteria 14311
348 Ga0466967_0009374 3300045976 Bacteria 7259
349 Ga0466967_0014166 3300045976 Bacteria 6197
350 Ga0466967_0022310 3300045976 Bacteria 5163
351 Ga0466967_0024263 3300045976 Bacteria 4983
352 Ga0466967_0031816 3300045976 Bacteria 4447
353 Ga0466967_0038725 3300045976 Bacteria 4091
354 Ga0466967_0068286 3300045976 Bacteria 3173
355 Ga0466967_0092154 3300045976 Bacteria 2755
356 Ga0466967_0176454 3300045976 Bacteria 2013
357 Ga0466967_0197301 3300045976 Bacteria 1905
358 Ga0466967_0232348 3300045976 Bacteria 1756
359 Ga0466967_0628241 3300045976 Bacteria 1061
360 Ga0495603_0131804 3300046455 Bacteria 1455
361 Ga0495641_0038369 3300046461 Bacteria 2238
362 Ga0495641_0068892 3300046461 Bacteria 1590
363 Ga0495651_0008808 3300046462 Bacteria 7740
364 Ga0495651_0011238 3300046462 Bacteria 6880
365 Ga0495651_0046504 3300046462 Bacteria 3358
366 Ga0495653_0023245 3300046463 Bacteria 5012
367 Ga0495653_0028887 3300046463 Bacteria 4433
368 Ga0495653_0074045 3300046463 Bacteria 2539
369 Ga0495664_0050022 3300046477 Bacteria 2481
370 Ga0495608_0001903 3300046511 Bacteria 14964
371 Ga0495608_0043316 3300046511 Bacteria 3007
372 Ga0495608_0043998 3300046511 Bacteria 2982
373 Ga0495618_0106546 3300046514 Bacteria 1795
374 Ga0495630_0056288 3300046517 Bacteria 2947
375 Ga0495630_0415825 3300046517 Bacteria 1030
376 Ga0495640_0061114 3300046533 Bacteria 2560
377 Ga0495667_0026121 3300046559 Bacteria 3934
378 Ga0495667_0051129 3300046559 Bacteria 2727
379 Ga0495634_0058265 3300046642 Bacteria 2575
380 Ga0495657_0079555 3300046675 Bacteria 2123
381 Ga0495599_0128739 3300046678 Bacteria 1573
382 Ga0495599_0157744 3300046678 Bacteria 1403
383 Ga0495623_0037214 3300046679 Bacteria 3115
384 Ga0495613_0050968 3300046689 Bacteria 3052
385 Ga0495671_0177471 3300046692 Bacteria 1035
386 Ga0495600_0144537 3300046809 Bacteria 1542
387 Ga0495581_0214728 3300047315 Bacteria 1125
388 Ga0495604_0127178 3300047317 Bacteria 1836
389 Ga0495674_0004694 3300047319 Bacteria 13140
390 Ga0495674_0139597 3300047319 Bacteria 2038
391 Ga0495676_0116393 3300047321 Bacteria 1952
392 Ga0495676_0192413 3300047321 Bacteria 1422
393 Ga0495680_0049066 3300047322 Bacteria 3310
394 Ga0495680_0235459 3300047322 Bacteria 1302
395 Ga0495675_0224307 3300047444 Bacteria 1136
396 Ga0495684_0039288 3300047471 Bacteria 3627
397 Ga0495684_0167011 3300047471 Bacteria 1639
398 Ga0495593_0168804 3300047673 Unclassified 1103
399 Ga0495602_0174513 3300048088 Bacteria 1664
400 Ga0495602_0414493 3300048088 Bacteria 958
401 Ga0495614_0099151 3300048089 Bacteria 1272
402 Ga0496100_0010510 3300048903 Bacteria 5242
403 Ga0496100_0061733 3300048903 Bacteria 2470
404 Ga0496100_0531827 3300048903 Unclassified 908
405 Ga0496101_0012712 3300048904 Bacteria 5626
406 Ga0496101_0028589 3300048904 Bacteria 3893
407 Ga0496101_0241534 3300048904 Bacteria 1406
408 Ga0496102_0002458 3300048905 Bacteria 15809
409 Ga0496102_0018688 3300048905 Bacteria 6096
410 Ga0496102_0082398 3300048905 Bacteria 2967
411 Ga0496103_0015418 3300048906 Bacteria 4547
412 Ga0496103_0050875 3300048906 Bacteria 2564
413 Ga0496103_0181676 3300048906 Bacteria 1352
414 Ga0496104_0218393 3300048907 Bacteria 1818
415 Ga0496105_0000369 3300048908 Bacteria 29744
416 Ga0496105_0108577 3300048908 Bacteria 2291
417 Ga0496106_0012755 3300048909 Bacteria 6205
418 Ga0496106_0065585 3300048909 Bacteria 2764
419 Ga0496107_0007256 3300048910 Bacteria 7636
420 Ga0496107_0008369 3300048910 Bacteria 7156
421 Ga0496107_0028370 3300048910 Bacteria 3977
422 Ga0496108_0016028 3300048911 Bacteria 6110
423 Ga0496109_0045112 3300048912 Bacteria 4000
424 Ga0496109_0532453 3300048912 Bacteria 1108
425 Ga0496110_0000726 3300048913 Bacteria 22801
426 Ga0496110_0037197 3300048913 Bacteria 4230
427 Ga0496111_0017699 3300048914 Bacteria 4928
428 Ga0496111_0041281 3300048914 Bacteria 3310
429 Ga0496111_0045863 3300048914 Bacteria 3146
430 Ga0496111_0109365 3300048914 Bacteria 2035
431 Ga0496112_0012177 3300048915 Bacteria 7895
432 Ga0496112_0047453 3300048915 Bacteria 4213
433 Ga0496112_0067284 3300048915 Bacteria 3535
434 Ga0496112_0093133 3300048915 Bacteria 2983
435 Ga0496112_0118028 3300048915 Bacteria 2623
436 Ga0496112_0136654 3300048915 Bacteria 2421
437 Ga0496113_0053308 3300048916 Bacteria 3024
438 Ga0496114_0000388 3300048917 Bacteria 32487
439 Ga0496114_0002364 3300048917 Bacteria 14362
440 Ga0496115_0000930 3300048918 Bacteria 21216
441 Ga0496115_0363560 3300048918 Bacteria 1179
442 Ga0501031_0006555 3300049568 Bacteria 7592
443 Ga0501031_0015377 3300049568 Bacteria 4968
444 Ga0501036_0011939 3300049572 Bacteria 7202
445 Ga0501036_0019266 3300049572 Bacteria 5726
446 Ga0501037_0090477 3300049573 Bacteria 2213
447 Ga0501038_0000829 3300049574 Bacteria 27517
448 Ga0501039_0351491 3300049575 Unclassified 1158
449 Ga0501040_0062819 3300049576 Bacteria 2555
450 Ga0501040_0135066 3300049576 Bacteria 1736
451 Ga0501040_0209863 3300049576 Bacteria 1384
452 Ga0501041_0010388 3300049577 Bacteria 5488
453 Ga0501042_0030896 3300049578 Bacteria 3788
454 Ga0501042_0218550 3300049578 Unclassified 1374
455 Ga0501043_0082729 3300049579 Bacteria 2523
456 Ga0501046_0118709 3300049580 Bacteria 2014
457 Ga0501047_0013757 3300049581 Bacteria 7684
458 Ga0501048_0019264 3300049582 Bacteria 5009
459 Ga0501048_0212757 3300049582 Bacteria 1371
460 Ga0501067_0000584 3300049583 Bacteria 19724
461 Ga0501067_0012778 3300049583 Bacteria 4651
462 Ga0501067_0041360 3300049583 Bacteria 2559
463 Ga0501067_0059305 3300049583 Bacteria 2118
464 Ga0501067_0104298 3300049583 Bacteria 1575
465 Ga0501068_0007980 3300049584 Bacteria 5869
466 Ga0501068_0017103 3300049584 Bacteria 4191
467 Ga0501068_0057198 3300049584 Bacteria 2364
468 Ga0501069_0000256 3300049585 Bacteria 24083
469 Ga0501069_0010511 3300049585 Bacteria 4901
470 Ga0501069_0051747 3300049585 Bacteria 2286
471 Ga0501069_0054682 3300049585 Bacteria 2223
472 Ga0501069_0087048 3300049585 Bacteria 1764
473 Ga0501070_0006892 3300049586 Bacteria 9667
474 Ga0501070_0012673 3300049586 Bacteria 7111
475 Ga0501071_0001507 3300049587 Bacteria 13537
476 Ga0501071_0026141 3300049587 Bacteria 4095
477 Ga0501071_0027189 3300049587 Bacteria 4023
478 Ga0501071_0178863 3300049587 Unclassified 1589
479 Ga0501072_0013793 3300049588 Bacteria 6188
480 Ga0501072_0022497 3300049588 Bacteria 4889
481 Ga0501073_0120628 3300049589 Bacteria 1817
482 Ga0501073_0188523 3300049589 Bacteria 1427
483 Ga0501074_0007453 3300049590 Bacteria 7913
484 Ga0501074_0010174 3300049590 Bacteria 6828
485 Ga0501075_0036357 3300049591 Bacteria 3675
486 Ga0501075_0080824 3300049591 Bacteria 2460
487 Ga0501076_0008812 3300049592 Bacteria 7413
488 Ga0501076_0094331 3300049592 Bacteria 2409
489 Ga0501076_0111795 3300049592 Bacteria 2208
490 Ga0501077_0002307 3300049593 Bacteria 11487
491 Ga0501077_0091038 3300049593 Bacteria 1933
492 Ga0501079_0009524 3300049741 Bacteria 7364
493 Ga0501079_0082327 3300049741 Bacteria 2489
494 Ga0501079_0206022 3300049741 Bacteria 1536
495 Ga0501080_0008539 3300049742 Bacteria 9288
496 Ga0501080_0008547 3300049742 Bacteria 9284
497 Ga0501080_0099130 3300049742 Bacteria 2704
498 Ga0501080_0167870 3300049742 Bacteria 2025
499 Ga0501081_0066634 3300049743 Bacteria 2504
500 Ga0501035_0090651 3300049822 Bacteria 2691
501 Ga0501044_0389710 3300049823 Bacteria 1307
502 Ga0501045_0001408 3300049824 Bacteria 16054
503 Ga0501045_0029653 3300049824 Bacteria 3955
504 Ga0501045_0047733 3300049824 Bacteria 3120
505 nmdc:mga05p37_473761_c1 3300050507 Bacteria 1444
506 nmdc:mga05p37_95867_c1 3300050507 Bacteria 3655
507 nmdc:mga08y16_136336_c1 3300050511 Bacteria 2551
508 nmdc:mga0n895_15249_c1 3300050512 Bacteria 7002
509 nmdc:mga0rr50_39682_c1 3300050513 Bacteria 3417
510 nmdc:mga08x19_100315_c1 3300050514 Bacteria 1920
511 nmdc:mga08x19_39605_c1 3300050514 Bacteria 2996
512 nmdc:mga0a205_77500_c1 3300050515 Bacteria 3212
513 Ga0495601_0014049 3300053077 Bacteria 4823
514 Ga0495601_0107159 3300053077 Bacteria 1808
515 Ga0495619_0007846 3300053085 Bacteria 6753
516 Ga0495619_0008870 3300053085 Bacteria 6357
517 Ga0495619_0072600 3300053085 Bacteria 2305
518 Ga0495619_0080807 3300053085 Bacteria 2188
519 Ga0495619_0242368 3300053085 Bacteria 1249
520 Ga0501084_0015621 3300054114 Bacteria 6296
521 Ga0501084_0231267 3300054114 Bacteria 1561
522 Ga0501082_0011346 3300060353 Bacteria 7661
523 Ga0501082_0013879 3300060353 Bacteria 6926
524 Ga0466962_0000782 3300061719 Bacteria 14304
525 Ga0466962_0018267 3300061719 Bacteria 3373
526 Ga0466962_0067097 3300061719 Bacteria 1713
527 Ga0530510_0003714 3300061734 Bacteria 10507
528 Ga0530510_0076940 3300061734 Bacteria 2425
529 Ga0530510_0123902 3300061734 Bacteria 1899
530 Ga0530510_0446210 3300061734 Bacteria 978
531 Ga0157370_10014686
532 Ga0070658_10019322
533 Ga0070658_10026096
534 Ga0070658_10041793
535 Ga0070683_100109587
536 Ga0070683_100213883
537 Ga0070683_100349679
538 Ga0070690_100222552
539 Ga0070670_100007002
540 Ga0070680_100057510
541 Ga0070680_100060848
542 Ga0070680_100082841
543 Ga0070680_100098798
544 Ga0070682_100040362
545 Ga0070682_100043653
546 Ga0068868_100062336
547 Ga0070660_100005649
548 Ga0070660_100005959
549 Ga0070660_100010773
550 Ga0070660_100016960
551 Ga0070660_100079475
552 Ga0070660_100350526
553 Ga0070661_100003244
554 Ga0070661_100004837
555 Ga0070661_100026577
556 Ga0070661_100109169
557 Ga0070671_100022161
558 Ga0070674_100010301
559 Ga0070674_100036805
560 Ga0070673_100005214
561 Ga0070688_100104956
562 Ga0070659_100006172
563 Ga0070659_100070377
564 Ga0070659_100177175
565 Ga0070667_100426886
566 Ga0070714_100057021
567 Ga0070711_100234838
568 Ga0070705_100192132
569 Ga0070700_100008471
570 Ga0070700_100403373
571 Ga0070694_100053147
572 Ga0070708_100037480
573 Ga0070663_100109853
574 Ga0070678_100169969
575 Ga0070681_10005650
576 Ga0070681_10025620
577 Ga0070681_10026629
578 Ga0070681_10057036
579 Ga0070681_10070353
580 Ga0070681_10088405
581 Ga0070681_10434987
582 Ga0068867_100054634
583 Ga0070685_10172301
584 Ga0070706_100009868
585 Ga0070706_100019484
586 Ga0070707_100005697
587 Ga0070707_100268351
588 Ga0070698_100022630
589 Ga0070698_100077787
590 Ga0070698_100170035
591 Ga0070698_100515056
592 Ga0070699_100016026
593 Ga0070699_100017467
594 Ga0070699_100166654
595 Ga0070699_100286876
596 Ga0070679_100011093
597 Ga0070679_100067470
598 Ga0070679_100080315
599 Ga0070679_100105395
600 Ga0070679_100149093
601 Ga0070679_100209285
602 Ga0070679_100252543
603 Ga0070684_100087678
604 Ga0070684_100126001
605 Ga0070684_100142288
606 Ga0070684_100147609
607 Ga0070697_100283458
608 Ga0068853_100110838
609 Ga0070693_100159686
610 Ga0070665_100042873
611 Ga0070665_100437700
612 Ga0068855_100013836
613 Ga0068855_100024003
614 Ga0068855_100050632
615 Ga0068855_100075515
616 Ga0068855_100495923
617 Ga0068857_100012757
618 Ga0068857_100084823
619 Ga0068857_100085606
620 Ga0068856_100037872
621 Ga0068856_100070455
622 Ga0068852_100007847
623 Ga0068852_100059999
624 Ga0068852_100088223
625 Ga0068852_100359985
626 Ga0068864_100072939
627 Ga0068866_10016427
628 Ga0068861_100189613
629 Ga0068870_10003490
630 Ga0068858_100044925
631 Ga0068860_100049072
632 Ga0081539_10000294
633 Ga0075433_10142423
634 Ga0068865_100073557
635 Ga0068865_100099578
636 Ga0068865_100153500
637 Ga0075436_100026163
638 Ga0075436_100050626
639 Ga0075435_100055610
640 Ga0105240_10065537
641 Ga0105240_10180643
642 Ga0105240_10230272
643 Ga0111539_10083004
644 Ga0111539_10099078
645 Ga0105245_10143438
646 Ga0114129_10090183
647 Ga0114129_10091765
648 Ga0105243_10039954
649 Ga0105243_10068493
650 Ga0105242_10047676
651 Ga0105248_10135546
652 Ga0105237_10063071
653 Ga0105237_10572183
654 Ga0105238_10005266
655 Ga0105238_10370199
656 Ga0105249_10164565
657 Ga0105239_10763758
658 Ga0105246_10010520
659 Ga0105246_10183390
660 Ga0157373_10040219
661 Ga0157371_10162597
662 Ga0157370_10021407
663 Ga0157370_10045508
664 Ga0157370_10180640
665 Ga0157370_10351400
666 Ga0157369_10019130
667 Ga0157369_10111031
668 Ga0157369_10141850
669 Ga0157369_10143868
670 Ga0157369_10259822
671 Ga0157372_10009877
672 Ga0157372_10045224
673 Ga0157372_10083090
674 Ga0157372_10202486
675 Ga0157372_10263278
676 Ga0157375_10004601
677 Ga0157375_10052516
678 Ga0157375_10860433
679 Ga0157380_10018542
680 Ga0157379_10081836
681 Ga0157379_10158259
682 Ga0157376_10118226
683 Ga0157376_10289588
684 Ga0206354_11621865
685 Ga0206353_10307015
686 Ga0206353_10735197
687 Ga0207688_10016017
688 Ga0207688_10142510
689 Ga0207647_10063184
690 Ga0207699_10158985
691 Ga0207643_10002251
692 Ga0207643_10234048
693 Ga0207705_10054958
694 Ga0207705_10074353
695 Ga0207705_10092484
696 Ga0207705_10236879
697 Ga0207684_10017284
698 Ga0207684_10023546
699 Ga0207654_10167173
700 Ga0207707_10009140
701 Ga0207707_10034627
702 Ga0207707_10048159
703 Ga0207707_10060613
704 Ga0207695_10135042
705 Ga0207671_10067658
706 Ga0207671_10163080
707 Ga0207693_10094049
708 Ga0207660_10034071
709 Ga0207660_10161048
710 Ga0207657_10000523
711 Ga0207657_10002448
712 Ga0207657_10003418
713 Ga0207657_10003834
714 Ga0207657_10005194
715 Ga0207657_10008493
716 Ga0207657_10011705
717 Ga0207657_10323407
718 Ga0207649_10036322
719 Ga0207652_10013381
720 Ga0207652_10019374
721 Ga0207652_10029870
722 Ga0207652_10044278
723 Ga0207652_10093350
724 Ga0207652_10208612
725 Ga0207646_10002534
726 Ga0207694_10065287
727 Ga0207650_10011314
728 Ga0207687_10053829
729 Ga0207664_10006011
730 Ga0207664_10034417
731 Ga0207664_10051235
732 Ga0207664_10227459
733 Ga0207664_10374765
734 Ga0207644_10514913
735 Ga0207690_10005115
736 Ga0207690_10031959
737 Ga0207706_10007115
738 Ga0207706_10010507
739 Ga0207709_10009851
740 Ga0207669_10033331
741 Ga0207669_10065958
742 Ga0207669_10196642
743 Ga0207704_10130857
744 Ga0207691_10052518
745 Ga0207691_10133364
746 Ga0207661_10024416
747 Ga0207661_10095049
748 Ga0207661_10099184
749 Ga0207661_10333265
750 Ga0207667_10100897
751 Ga0207667_10145894
752 Ga0207667_10152026
753 Ga0207667_10558667
754 Ga0207668_10120751
755 Ga0207703_10399479
756 Ga0207639_10195990
757 Ga0207678_10044429
758 Ga0207678_10180013
759 Ga0207708_10018844
760 Ga0207708_10097425
761 Ga0207702_10106154
762 Ga0207648_10239158
763 Ga0207674_10014270
764 Ga0207674_10031572
765 Ga0207674_10046203
766 Ga0207674_10100404
767 Ga0207674_10286042
768 Ga0207675_100031233
769 Ga0207683_10055273
770 Ga0207698_10019613
771 Ga0268266_10303294
772 Ga0265319_1001008
773 Ga0265319_1048339
774 Ga0265319_1079821
775 Ga0265334_10000248
776 Ga0265334_10003569
777 Ga0265334_10042942
778 Ga0265318_10000303
779 Ga0265318_10000982
780 Ga0265338_10003055
781 Ga0265338_10015934
782 Ga0265338_10083830
783 Ga0265338_10129523
784 Ga0265338_10152079
785 Ga0265324_10017363
786 Ga0265330_10020041
787 Ga0265320_10006988
788 Ga0265320_10013106
789 Ga0265325_10000058
790 Ga0265329_10017799
791 Ga0265329_10019580
792 Ga0265340_10000310
793 Ga0265340_10014758
794 Ga0265339_10138461
795 Ga0265327_10004922
796 Ga0265327_10006105
797 Ga0265327_10016013
798 Ga0265327_10031429
799 Ga0265316_10000677
800 Ga0265316_10007566
801 Ga0265313_10007562
802 Ga0265313_10033399
803 Ga0265314_10003537
804 Ga0265314_10006697
805 Ga0265342_10001041
806 Ga0265342_10007711
807 Ga0307405_10041401
808 Ga0307406_10064031
809 Ga0307409_100004610
810 Ga0307416_100007197
811 Ga0307415_100000579
812 Ga0373958_0024809
813 Ga0373945_0007355
814 Ga0373960_0032992
815 Ga0373943_0015749
816 Ga0373946_0051120
817 Ga0373962_0050772
818 Ga0373935_0036524
819 Ga0373933_0079413
820 Ga0373947_0001437
821 Ga0373925_0014217
822 Ga0395899_0015517
823 Ga0395899_0071730
824 Ga0395900_0027315
825 Ga0395900_0034003
826 Ga0395900_0111091
827 Ga0395898_0024615
828 Ga0395898_0033733
829 Ga0395898_0059449
830 Ga0395898_0079268
831 Ga0395898_0142961
832 Ga0395898_0205855
833 Ga0395898_0216632
834 Ga0395905_0003664
835 Ga0395905_0035086
836 Ga0395905_0048546
837 Ga0395901_0001426
838 Ga0395901_0020937
839 Ga0395901_0021621
840 Ga0395901_0031917
841 Ga0395901_0118801
842 Ga0395901_0184634
843 Ga0395901_0273403
844 Ga0395901_0550707
845 Ga0436365_1186631
846 Ga0436365_1684611
847 Ga0436360_0228179
848 Ga0436363_1074191
849 Ga0451807_1516737
850 Ga0451853_0797023
851 Ga0439434_0008314
852 Ga0439459_0025144
853 Ga0466966_0183051
854 Ga0466961_0001503
855 Ga0466961_0003222
856 Ga0466961_0091149
857 Ga0466963_0000931
858 Ga0466963_0001489
859 Ga0466963_0016443
860 Ga0466963_0019957
861 Ga0466963_0035339
862 Ga0466963_0217345
863 Ga0466964_0004694
864 Ga0466964_0006586
865 Ga0466971_0000602
866 Ga0466971_0012472
867 Ga0466971_0062894
868 Ga0466968_0027048
869 Ga0466957_0000159
870 Ga0466957_0072535
871 Ga0466957_0126509
872 Ga0466960_0024193
873 Ga0466959_0085390
874 Ga0466958_0000770
875 Ga0466967_0000393
876 Ga0466967_0000488
877 Ga0466967_0001271
878 Ga0466967_0009374
879 Ga0466967_0014166
880 Ga0466967_0022310
881 Ga0466967_0024263
882 Ga0466967_0031816
883 Ga0466967_0038725
884 Ga0466967_0068286
885 Ga0466967_0092154
886 Ga0466967_0176454
887 Ga0466967_0197301
888 Ga0466967_0232348
889 Ga0466967_0628241
890 Ga0495603_0131804
891 Ga0495641_0038369
892 Ga0495641_0068892
893 Ga0495651_0008808
894 Ga0495651_0011238
895 Ga0495651_0046504
896 Ga0495653_0023245
897 Ga0495653_0028887
898 Ga0495653_0074045
899 Ga0495664_0050022
900 Ga0495608_0001903
901 Ga0495608_0043316
902 Ga0495608_0043998
903 Ga0495618_0106546
904 Ga0495630_0056288
905 Ga0495630_0415825
906 Ga0495640_0061114
907 Ga0495667_0026121
908 Ga0495667_0051129
909 Ga0495634_0058265
910 Ga0495657_0079555
911 Ga0495599_0128739
912 Ga0495599_0157744
913 Ga0495623_0037214
914 Ga0495613_0050968
915 Ga0495671_0177471
916 Ga0495600_0144537
917 Ga0495581_0214728
918 Ga0495604_0127178
919 Ga0495674_0004694
920 Ga0495674_0139597
921 Ga0495676_0116393
922 Ga0495676_0192413
923 Ga0495680_0049066
924 Ga0495680_0235459
925 Ga0495675_0224307
926 Ga0495684_0039288
927 Ga0495684_0167011
928 Ga0495593_0168804
929 Ga0495602_0174513
930 Ga0495602_0414493
931 Ga0495614_0099151
932 Ga0496100_0010510
933 Ga0496100_0061733
934 Ga0496100_0531827
935 Ga0496101_0012712
936 Ga0496101_0028589
937 Ga0496101_0241534
938 Ga0496102_0002458
939 Ga0496102_0018688
940 Ga0496102_0082398
941 Ga0496103_0015418
942 Ga0496103_0050875
943 Ga0496103_0181676
944 Ga0496104_0218393
945 Ga0496105_0000369
946 Ga0496105_0108577
947 Ga0496106_0012755
948 Ga0496106_0065585
949 Ga0496107_0007256
950 Ga0496107_0008369
951 Ga0496107_0028370
952 Ga0496108_0016028
953 Ga0496109_0045112
954 Ga0496109_0532453
955 Ga0496110_0000726
956 Ga0496110_0037197
957 Ga0496111_0017699
958 Ga0496111_0041281
959 Ga0496111_0045863
960 Ga0496111_0109365
961 Ga0496112_0012177
962 Ga0496112_0047453
963 Ga0496112_0067284
964 Ga0496112_0093133
965 Ga0496112_0118028
966 Ga0496112_0136654
967 Ga0496113_0053308
968 Ga0496114_0000388
969 Ga0496114_0002364
970 Ga0496115_0000930
971 Ga0496115_0363560
972 Ga0501031_0006555
973 Ga0501031_0015377
974 Ga0501036_0011939
975 Ga0501036_0019266
976 Ga0501037_0090477
977 Ga0501038_0000829
978 Ga0501039_0351491
979 Ga0501040_0062819
980 Ga0501040_0135066
981 Ga0501040_0209863
982 Ga0501041_0010388
983 Ga0501042_0030896
984 Ga0501042_0218550
985 Ga0501043_0082729
986 Ga0501046_0118709
987 Ga0501047_0013757
988 Ga0501048_0019264
989 Ga0501048_0212757
990 Ga0501067_0000584
991 Ga0501067_0012778
992 Ga0501067_0041360
993 Ga0501067_0059305
994 Ga0501067_0104298
995 Ga0501068_0007980
996 Ga0501068_0017103
997 Ga0501068_0057198
998 Ga0501069_0000256
999 Ga0501069_0010511
1000 Ga0501069_0051747
1001 Ga0501069_0054682
1002 Ga0501069_0087048
1003 Ga0501070_0006892
1004 Ga0501070_0012673
1005 Ga0501071_0001507
1006 Ga0501071_0026141
1007 Ga0501071_0027189
1008 Ga0501071_0178863
1009 Ga0501072_0013793
1010 Ga0501072_0022497
1011 Ga0501073_0120628
1012 Ga0501073_0188523
1013 Ga0501074_0007453
1014 Ga0501074_0010174
1015 Ga0501075_0036357
1016 Ga0501075_0080824
1017 Ga0501076_0008812
1018 Ga0501076_0094331
1019 Ga0501076_0111795
1020 Ga0501077_0002307
1021 Ga0501077_0091038
1022 Ga0501079_0009524
1023 Ga0501079_0082327
1024 Ga0501079_0206022
1025 Ga0501080_0008539
1026 Ga0501080_0008547
1027 Ga0501080_0099130
1028 Ga0501080_0167870
1029 Ga0501081_0066634
1030 Ga0501035_0090651
1031 Ga0501044_0389710
1032 Ga0501045_0001408
1033 Ga0501045_0029653
1034 Ga0501045_0047733
1035 nmdc:mga05p37_473761_c1
1036 nmdc:mga05p37_95867_c1
1037 nmdc:mga08y16_136336_c1
1038 nmdc:mga0n895_15249_c1
1039 nmdc:mga0rr50_39682_c1
1040 nmdc:mga08x19_100315_c1
1041 nmdc:mga08x19_39605_c1
1042 nmdc:mga0a205_77500_c1
1043 Ga0495601_0014049
1044 Ga0495601_0107159
1045 Ga0495619_0007846
1046 Ga0495619_0008870
1047 Ga0495619_0072600
1048 Ga0495619_0080807
1049 Ga0495619_0242368
1050 Ga0501084_0015621
1051 Ga0501084_0231267
1052 Ga0501082_0011346
1053 Ga0501082_0013879
1054 Ga0466962_0000782
1055 Ga0466962_0018267
1056 Ga0466962_0067097
1057 Ga0530510_0003714
1058 Ga0530510_0076940
1059 Ga0530510_0123902
1060 Ga0530510_0446210

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ug9-assembly1.cif.gz_A crystal structure of rnase am php domain 0.776 13 181
4gyf-assembly1.cif.gz_A crystal structure of histidinol phosphate phosphatase (hisk) from lactococcus lactis subsp. lactis il1403 complexed with zn, l-histidinol and phosphate 0.7532 12 71
2anu-assembly1.cif.gz_C crystal structure of predicted metal-dependent phosphoesterase (php family) (tm0559) from thermotoga maritima at 2.40 a resolution 0.7238 9 205
2anu-assembly1.cif.gz_A crystal structure of predicted metal-dependent phosphoesterase (php family) (tm0559) from thermotoga maritima at 2.40 a resolution 0.7181 9 205
2yb4-assembly1.cif.gz_A structure of an amidohydrolase from chromobacterium violaceum (efi target efi-500202) with bound so4, no metal 0.7123 13 181
ID Description Score Start End Superfamily
af_Q59R21_3_288_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8186 14 52 3.20.20.140
af_Q54IG4_130_328_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7766 11 190 3.20.20.140
af_Q57860_1_200_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7609 11 186 3.20.20.140
3umuA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7536 12 71 3.20.20.140
2yb4A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7289 13 181 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A7Y5X3S0-F1-model_v4 CehA/McbA family metallohydrolase 0.9723 1 239 GO:0004534
GO:0035312
AF-A0A537ZS52-F1-model_v4 Polymerase/histidinol phosphatase N-terminal domain-containing protein 0.9647 7 303 GO:0004534
GO:0035312
AF-A0A7M2Z136-F1-model_v4 PHP domain-containing protein 0.9644 1 303 GO:0004534
GO:0035312
AF-A0A7M2Z136-F1-model_v4 PHP domain-containing protein 0.9612 1 303 GO:0004534
GO:0035312
AF-A0A538HVG8-F1-model_v4 Uncharacterized protein 0.9604 213 305

Map