F459911
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 530 | 330 | 493 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300005337|Ga0070682_100222915|Ga0070682_1002229152 |
| Length | 169 |
| Sequence | MAFILTNAATCHRISGFTEIAGVGFVKTFSAKPHEVSHDWFVVDAADKVLGRLAAEIAYRLRGKHKPIYTPHVDTGDYIVVINVDKLRVTGNKAENKRYYRHSGYPGGIYETTFTKMHARFPGRPLEKAVKGMLPKGPLGYAMLKKLKVYAGAAHPHAAQQPRQLEVRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 2 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 3 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 4 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 5 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 6 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 7 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 8 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 9 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 10 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 11 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 12 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 13 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 14 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 15 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 16 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 17 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 18 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 19 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 20 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 21 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 22 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 23 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 24 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 25 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 26 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 27 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 28 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 29 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 30 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 31 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 32 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 33 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 34 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 35 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 36 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 37 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 38 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 39 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 40 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 41 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 42 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 44 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 51 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 74 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 85 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 90 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 91 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 98 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 173 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 174 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 175 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 177 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 178 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 179 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 180 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 181 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 182 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 184 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 186 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 187 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 188 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 190 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 191 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 192 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 193 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 198 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 201 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 202 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 205 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 209 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 210 | 3300041454 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT | Metatranscriptome | Rhizoplane |
| 211 | 3300041455 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT | Metatranscriptome | Rhizoplane |
| 212 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 216 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 217 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 218 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 219 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 220 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 221 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 222 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 223 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 224 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 225 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 226 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 227 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 228 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 229 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 230 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 231 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 232 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 233 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 234 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 235 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 236 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 237 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 238 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 239 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 247 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 248 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 249 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 256 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 257 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 258 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 259 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 260 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 265 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 266 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 267 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 300 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 301 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 305 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 306 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 310 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 311 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 312 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 313 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 314 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 315 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 318 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 319 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 327 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 328 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 329 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 330 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.6 |
| Metatranscriptomes | 6.42 |
| Isolates | 6.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.91 |
| Nodule | 1.89 |
| Rhizoplane | 5.09 |
| Rhizosphere | 81.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1048266 | 3300001904 | Bacteria | 655 |
| 2 | Ga0006759J45824_1005431 | 3300003163 | Bacteria | 2500 |
| 3 | rootH2_10010659 | 3300003320 | Bacteria | 1114 |
| 4 | rootH1_10007780 | 3300003323 | Bacteria | 5607 |
| 5 | Ga0007427J51700_123299 | 3300003559 | Bacteria | 627 |
| 6 | Ga0007409J51694_1049228 | 3300003575 | Bacteria | 688 |
| 7 | Ga0007429J51699_1049887 | 3300003579 | Bacteria | 722 |
| 8 | Ga0058860_10580578 | 3300004801 | Bacteria | 770 |
| 9 | Ga0065704_10553282 | 3300005289 | Bacteria | 633 |
| 10 | Ga0065712_10271024 | 3300005290 | Bacteria | 916 |
| 11 | Ga0065712_10576999 | 3300005290 | Bacteria | 603 |
| 12 | Ga0065712_10620510 | 3300005290 | Bacteria | 581 |
| 13 | Ga0070658_10188547 | 3300005327 | Bacteria | 1738 |
| 14 | Ga0070658_10266221 | 3300005327 | Bacteria | 1456 |
| 15 | Ga0070658_10776939 | 3300005327 | Bacteria | 832 |
| 16 | Ga0070683_100091001 | 3300005329 | Bacteria | 2864 |
| 17 | Ga0070690_100505707 | 3300005330 | Bacteria | 905 |
| 18 | Ga0070677_10187745 | 3300005333 | Bacteria | 989 |
| 19 | Ga0070680_100790945 | 3300005336 | Bacteria | 817 |
| 20 | Ga0070682_100222915 | 3300005337 | Bacteria | 1343 |
| 21 | Ga0068868_100025744 | 3300005338 | Bacteria | 4478 |
| 22 | Ga0068868_100188507 | 3300005338 | Bacteria | 1714 |
| 23 | Ga0068868_100315019 | 3300005338 | Bacteria | 1332 |
| 24 | Ga0070660_100031943 | 3300005339 | Bacteria | 3959 |
| 25 | Ga0070660_100281947 | 3300005339 | Bacteria | 1360 |
| 26 | Ga0070660_100607076 | 3300005339 | Bacteria | 915 |
| 27 | Ga0070689_100091715 | 3300005340 | Bacteria | 2395 |
| 28 | Ga0070661_100098154 | 3300005344 | Bacteria | 2176 |
| 29 | Ga0070675_100019434 | 3300005354 | Bacteria | 5415 |
| 30 | Ga0070671_100049003 | 3300005355 | Bacteria | 3514 |
| 31 | Ga0070673_100065827 | 3300005364 | Bacteria | 2892 |
| 32 | Ga0070659_100077804 | 3300005366 | Bacteria | 2646 |
| 33 | Ga0070659_100988714 | 3300005366 | Unclassified | 738 |
| 34 | Ga0070714_100104368 | 3300005435 | Bacteria | 2501 |
| 35 | Ga0070714_100256237 | 3300005435 | Bacteria | 1619 |
| 36 | Ga0070710_10822712 | 3300005437 | Bacteria | 665 |
| 37 | Ga0070701_10172724 | 3300005438 | Bacteria | 1260 |
| 38 | Ga0070700_101717950 | 3300005441 | Bacteria | 539 |
| 39 | Ga0070663_100124576 | 3300005455 | Bacteria | 1950 |
| 40 | Ga0070663_100264673 | 3300005455 | Unclassified | 1365 |
| 41 | Ga0070663_100542070 | 3300005455 | Bacteria | 971 |
| 42 | Ga0070678_100094789 | 3300005456 | Bacteria | 2298 |
| 43 | Ga0070662_100974577 | 3300005457 | Bacteria | 725 |
| 44 | Ga0070662_101099244 | 3300005457 | Bacteria | 682 |
| 45 | Ga0070681_10019167 | 3300005458 | Bacteria | 6847 |
| 46 | Ga0070681_10422911 | 3300005458 | Bacteria | 1244 |
| 47 | Ga0068867_100100840 | 3300005459 | Bacteria | 2205 |
| 48 | Ga0070685_10492864 | 3300005466 | Bacteria | 866 |
| 49 | Ga0070685_11426697 | 3300005466 | Bacteria | 532 |
| 50 | Ga0070707_101197140 | 3300005468 | Bacteria | 726 |
| 51 | Ga0070698_100576695 | 3300005471 | Bacteria | 1065 |
| 52 | Ga0070679_100221040 | 3300005530 | Bacteria | 1855 |
| 53 | Ga0070679_101911744 | 3300005530 | Bacteria | 542 |
| 54 | Ga0070684_100040791 | 3300005535 | Bacteria | 3999 |
| 55 | Ga0070684_100214510 | 3300005535 | Bacteria | 1755 |
| 56 | Ga0070697_100055150 | 3300005536 | Bacteria | 3231 |
| 57 | Ga0068853_100189267 | 3300005539 | Bacteria | 1869 |
| 58 | Ga0070672_100034137 | 3300005543 | Bacteria | 3859 |
| 59 | Ga0070696_100426396 | 3300005546 | Bacteria | 1042 |
| 60 | Ga0070665_100719023 | 3300005548 | Bacteria | 1012 |
| 61 | Ga0070704_100169456 | 3300005549 | Bacteria | 1735 |
| 62 | Ga0070704_101292714 | 3300005549 | Bacteria | 667 |
| 63 | Ga0070704_101684661 | 3300005549 | Bacteria | 586 |
| 64 | Ga0070664_100024396 | 3300005564 | Bacteria | 5001 |
| 65 | Ga0068854_100647553 | 3300005578 | Bacteria | 907 |
| 66 | Ga0068856_100108775 | 3300005614 | Bacteria | 2768 |
| 67 | Ga0068852_100001759 | 3300005616 | Bacteria | 14743 |
| 68 | Ga0068852_100021983 | 3300005616 | Bacteria | 5105 |
| 69 | Ga0068859_100061235 | 3300005617 | Bacteria | 3792 |
| 70 | Ga0068864_100147719 | 3300005618 | Bacteria | 2126 |
| 71 | Ga0068864_100433075 | 3300005618 | Bacteria | 1255 |
| 72 | Ga0068866_10271242 | 3300005718 | Bacteria | 1047 |
| 73 | Ga0068851_10009817 | 3300005834 | Bacteria | 4458 |
| 74 | Ga0068851_10030814 | 3300005834 | Bacteria | 2662 |
| 75 | Ga0068863_100966204 | 3300005841 | Bacteria | 854 |
| 76 | Ga0068858_100186764 | 3300005842 | Bacteria | 1958 |
| 77 | Ga0068860_101520606 | 3300005843 | Bacteria | 691 |
| 78 | Ga0075368_10322754 | 3300006042 | Bacteria | 669 |
| 79 | Ga0075363_100152546 | 3300006048 | Bacteria | 1305 |
| 80 | Ga0075364_10118324 | 3300006051 | Bacteria | 1772 |
| 81 | Ga0075364_10494932 | 3300006051 | Bacteria | 836 |
| 82 | Ga0070715_10360257 | 3300006163 | Bacteria | 797 |
| 83 | Ga0070716_100163095 | 3300006173 | Bacteria | 1446 |
| 84 | Ga0070712_101064899 | 3300006175 | Bacteria | 701 |
| 85 | Ga0070712_101067080 | 3300006175 | Bacteria | 700 |
| 86 | Ga0075362_10015321 | 3300006177 | Bacteria | 3116 |
| 87 | Ga0075362_10054872 | 3300006177 | Bacteria | 1792 |
| 88 | Ga0075367_10164091 | 3300006178 | Bacteria | 1382 |
| 89 | Ga0075369_10013586 | 3300006186 | Bacteria | 3236 |
| 90 | Ga0075366_10001852 | 3300006195 | Bacteria | 10665 |
| 91 | Ga0075366_10031402 | 3300006195 | Bacteria | 3125 |
| 92 | Ga0075366_10071725 | 3300006195 | Bacteria | 2063 |
| 93 | Ga0075366_10954697 | 3300006195 | Bacteria | 534 |
| 94 | Ga0097621_100030798 | 3300006237 | Bacteria | 4251 |
| 95 | Ga0097621_100048009 | 3300006237 | Bacteria | 3461 |
| 96 | Ga0068871_100019547 | 3300006358 | Bacteria | 5174 |
| 97 | Ga0068871_100049509 | 3300006358 | Bacteria | 3396 |
| 98 | Ga0075428_101221409 | 3300006844 | Bacteria | 792 |
| 99 | Ga0068865_102020607 | 3300006881 | Bacteria | 523 |
| 100 | Ga0097620_100061233 | 3300006931 | Bacteria | 3792 |
| 101 | Ga0105240_11163136 | 3300009093 | Bacteria | 818 |
| 102 | Ga0111539_10060204 | 3300009094 | Bacteria | 4500 |
| 103 | Ga0111539_10390106 | 3300009094 | Bacteria | 1621 |
| 104 | Ga0111539_10587431 | 3300009094 | Bacteria | 1297 |
| 105 | Ga0111539_10606705 | 3300009094 | Bacteria | 1275 |
| 106 | Ga0111539_11894233 | 3300009094 | Unclassified | 691 |
| 107 | Ga0105245_10754849 | 3300009098 | Bacteria | 1009 |
| 108 | Ga0105247_10745125 | 3300009101 | Bacteria | 742 |
| 109 | Ga0105243_10144671 | 3300009148 | Bacteria | 2033 |
| 110 | Ga0105241_10519824 | 3300009174 | Bacteria | 1064 |
| 111 | Ga0105241_11113792 | 3300009174 | Bacteria | 744 |
| 112 | Ga0105242_10472301 | 3300009176 | Unclassified | 1187 |
| 113 | Ga0105248_10184527 | 3300009177 | Bacteria | 2351 |
| 114 | Ga0105248_10470167 | 3300009177 | Bacteria | 1417 |
| 115 | Ga0105249_11421537 | 3300009553 | Bacteria | 766 |
| 116 | Ga0105239_10442194 | 3300010375 | Bacteria | 1474 |
| 117 | Ga0105239_10676179 | 3300010375 | Bacteria | 1180 |
| 118 | Ga0105239_11029141 | 3300010375 | Bacteria | 947 |
| 119 | Ga0157373_10055671 | 3300013100 | Bacteria | 2809 |
| 120 | Ga0157370_10002935 | 3300013104 | Bacteria | 20300 |
| 121 | Ga0157370_10088612 | 3300013104 | Bacteria | 2906 |
| 122 | Ga0157374_10095354 | 3300013296 | Bacteria | 2845 |
| 123 | Ga0157374_10125178 | 3300013296 | Bacteria | 2484 |
| 124 | Ga0157374_10344407 | 3300013296 | Bacteria | 1480 |
| 125 | Ga0157374_10862718 | 3300013296 | Bacteria | 922 |
| 126 | Ga0157378_10238003 | 3300013297 | Bacteria | 1738 |
| 127 | Ga0163162_10316061 | 3300013306 | Bacteria | 1694 |
| 128 | Ga0163162_10487671 | 3300013306 | Bacteria | 1364 |
| 129 | Ga0157375_10432340 | 3300013308 | Bacteria | 1482 |
| 130 | Ga0157375_11287532 | 3300013308 | Bacteria | 859 |
| 131 | Ga0163163_10157561 | 3300014325 | Bacteria | 2315 |
| 132 | Ga0163163_11029657 | 3300014325 | Bacteria | 887 |
| 133 | Ga0157376_10089491 | 3300014969 | Unclassified | 2662 |
| 134 | Ga0157376_10277773 | 3300014969 | Bacteria | 1576 |
| 135 | Ga0182006_1052209 | 3300015261 | Bacteria | 1571 |
| 136 | Ga0209672_100038 | 3300025228 | Bacteria | 286731 |
| 137 | Ga0209147_100235 | 3300025229 | Bacteria | 54699 |
| 138 | Ga0209148_1001389 | 3300025254 | Bacteria | 12488 |
| 139 | Ga0207697_10087497 | 3300025315 | Bacteria | 1318 |
| 140 | Ga0207656_10002235 | 3300025321 | Bacteria | 6486 |
| 141 | Ga0207656_10095578 | 3300025321 | Bacteria | 1355 |
| 142 | Ga0207656_10150232 | 3300025321 | Bacteria | 1103 |
| 143 | Ga0207682_10028984 | 3300025893 | Bacteria | 2212 |
| 144 | Ga0207642_10494421 | 3300025899 | Bacteria | 748 |
| 145 | Ga0207688_10288782 | 3300025901 | Bacteria | 1001 |
| 146 | Ga0207647_10015145 | 3300025904 | Bacteria | 5297 |
| 147 | Ga0207645_10168928 | 3300025907 | Bacteria | 1433 |
| 148 | Ga0207643_10312452 | 3300025908 | Bacteria | 980 |
| 149 | Ga0207705_10089853 | 3300025909 | Bacteria | 2248 |
| 150 | Ga0207684_10168852 | 3300025910 | Bacteria | 1886 |
| 151 | Ga0207654_10378193 | 3300025911 | Bacteria | 980 |
| 152 | Ga0207695_10076578 | 3300025913 | Bacteria | 3400 |
| 153 | Ga0207695_10140700 | 3300025913 | Bacteria | 2362 |
| 154 | Ga0207695_10974789 | 3300025913 | Bacteria | 727 |
| 155 | Ga0207671_10005622 | 3300025914 | Bacteria | 11488 |
| 156 | Ga0207693_10769985 | 3300025915 | Bacteria | 743 |
| 157 | Ga0207660_10969628 | 3300025917 | Bacteria | 694 |
| 158 | Ga0207657_10093367 | 3300025919 | Bacteria | 2506 |
| 159 | Ga0207657_10760595 | 3300025919 | Bacteria | 750 |
| 160 | Ga0207649_10151955 | 3300025920 | Bacteria | 1595 |
| 161 | Ga0207649_10153165 | 3300025920 | Bacteria | 1590 |
| 162 | Ga0207652_10163763 | 3300025921 | Bacteria | 1994 |
| 163 | Ga0207646_10743076 | 3300025922 | Bacteria | 876 |
| 164 | Ga0207650_10017043 | 3300025925 | Bacteria | 5084 |
| 165 | Ga0207659_10535626 | 3300025926 | Bacteria | 994 |
| 166 | Ga0207659_11205512 | 3300025926 | Bacteria | 651 |
| 167 | Ga0207687_10849691 | 3300025927 | Bacteria | 780 |
| 168 | Ga0207687_11283682 | 3300025927 | Bacteria | 629 |
| 169 | Ga0207664_10089886 | 3300025929 | Bacteria | 2516 |
| 170 | Ga0207664_10169003 | 3300025929 | Bacteria | 1870 |
| 171 | Ga0207664_11121405 | 3300025929 | Bacteria | 703 |
| 172 | Ga0207706_10048226 | 3300025933 | Bacteria | 3767 |
| 173 | Ga0207706_10286923 | 3300025933 | Bacteria | 1435 |
| 174 | Ga0207706_10571062 | 3300025933 | Bacteria | 973 |
| 175 | Ga0207670_10069357 | 3300025936 | Bacteria | 2432 |
| 176 | Ga0207670_10217709 | 3300025936 | Bacteria | 1460 |
| 177 | Ga0207669_10142792 | 3300025937 | Bacteria | 1665 |
| 178 | Ga0207665_10134269 | 3300025939 | Bacteria | 1759 |
| 179 | Ga0207691_10033884 | 3300025940 | Bacteria | 4754 |
| 180 | Ga0207711_10845942 | 3300025941 | Bacteria | 851 |
| 181 | Ga0207711_11249716 | 3300025941 | Bacteria | 684 |
| 182 | Ga0207661_10358235 | 3300025944 | Bacteria | 1317 |
| 183 | Ga0207679_10078695 | 3300025945 | Bacteria | 2512 |
| 184 | Ga0207651_10723203 | 3300025960 | Bacteria | 878 |
| 185 | Ga0207640_10111180 | 3300025981 | Bacteria | 1942 |
| 186 | Ga0207640_10941404 | 3300025981 | Bacteria | 757 |
| 187 | Ga0207640_12074558 | 3300025981 | Bacteria | 515 |
| 188 | Ga0207677_10025794 | 3300026023 | Bacteria | 3673 |
| 189 | Ga0207677_10041891 | 3300026023 | Bacteria | 3031 |
| 190 | Ga0207677_11391870 | 3300026023 | Bacteria | 646 |
| 191 | Ga0207703_10154047 | 3300026035 | Bacteria | 2007 |
| 192 | Ga0207639_10525729 | 3300026041 | Bacteria | 1084 |
| 193 | Ga0207678_10655850 | 3300026067 | Bacteria | 922 |
| 194 | Ga0207708_11176110 | 3300026075 | Bacteria | 670 |
| 195 | Ga0207641_10499892 | 3300026088 | Bacteria | 1181 |
| 196 | Ga0207641_10888779 | 3300026088 | Bacteria | 884 |
| 197 | Ga0207648_10068615 | 3300026089 | Bacteria | 3089 |
| 198 | Ga0207648_10514277 | 3300026089 | Bacteria | 1096 |
| 199 | Ga0207676_10147667 | 3300026095 | Bacteria | 2021 |
| 200 | Ga0207675_100203901 | 3300026118 | Bacteria | 1900 |
| 201 | Ga0207683_10000544 | 3300026121 | Bacteria | 34864 |
| 202 | Ga0207698_10004810 | 3300026142 | Bacteria | 8271 |
| 203 | Ga0207698_10070917 | 3300026142 | Bacteria | 2763 |
| 204 | Ga0207698_10577228 | 3300026142 | Bacteria | 1106 |
| 205 | Ga0209970_1006891 | 3300027614 | Bacteria | 1865 |
| 206 | Ga0207428_10011353 | 3300027907 | Bacteria | 7877 |
| 207 | Ga0265318_10020713 | 3300028577 | Bacteria | 2650 |
| 208 | Ga0307517_10131378 | 3300028786 | Bacteria | 1801 |
| 209 | Ga0307515_10108731 | 3300028794 | Bacteria | 3264 |
| 210 | Ga0265332_10000039 | 3300031238 | Bacteria | 128373 |
| 211 | Ga0265320_10019701 | 3300031240 | Bacteria | 3680 |
| 212 | Ga0265320_10135680 | 3300031240 | Bacteria | 1117 |
| 213 | Ga0265325_10108797 | 3300031241 | Bacteria | 1349 |
| 214 | Ga0265331_10005900 | 3300031250 | Bacteria | 7326 |
| 215 | Ga0265331_10092990 | 3300031250 | Bacteria | 1393 |
| 216 | Ga0265331_10271866 | 3300031250 | Bacteria | 760 |
| 217 | Ga0265316_10004209 | 3300031344 | Bacteria | 14381 |
| 218 | Ga0265316_10421225 | 3300031344 | Bacteria | 960 |
| 219 | Ga0307509_10000018 | 3300031507 | Bacteria | 258998 |
| 220 | Ga0307408_100035777 | 3300031548 | Bacteria | 3486 |
| 221 | Ga0307408_100220816 | 3300031548 | Bacteria | 1546 |
| 222 | Ga0265314_10001425 | 3300031711 | Bacteria | 26784 |
| 223 | Ga0265314_10380453 | 3300031711 | Bacteria | 768 |
| 224 | Ga0307516_10001808 | 3300031730 | Bacteria | 29384 |
| 225 | Ga0307405_10031395 | 3300031731 | Bacteria | 3127 |
| 226 | Ga0307413_10010514 | 3300031824 | Bacteria | 4494 |
| 227 | Ga0307406_10265915 | 3300031901 | Bacteria | 1300 |
| 228 | Ga0307407_10085080 | 3300031903 | Bacteria | 1923 |
| 229 | Ga0307412_10001034 | 3300031911 | Bacteria | 15897 |
| 230 | Ga0307412_10598103 | 3300031911 | Bacteria | 934 |
| 231 | Ga0307412_10830723 | 3300031911 | Bacteria | 804 |
| 232 | Ga0307409_100101014 | 3300031995 | Bacteria | 2392 |
| 233 | Ga0307411_10154535 | 3300032005 | Bacteria | 1710 |
| 234 | Ga0307411_10173731 | 3300032005 | Bacteria | 1628 |
| 235 | Ga0307411_10962352 | 3300032005 | Bacteria | 762 |
| 236 | Ga0307411_11108031 | 3300032005 | Bacteria | 714 |
| 237 | Ga0307415_100000825 | 3300032126 | Bacteria | 14175 |
| 238 | Ga0316583_10001814 | 3300032133 | Bacteria | 7266 |
| 239 | Ga0316592_1030489 | 3300033524 | Bacteria | 1172 |
| 240 | Ga0316592_1044759 | 3300033524 | Bacteria | 984 |
| 241 | Ga0316586_1019127 | 3300033527 | Bacteria | 1117 |
| 242 | Ga0316596_1022081 | 3300033541 | Bacteria | 1625 |
| 243 | Ga0316596_1023413 | 3300033541 | Bacteria | 1582 |
| 244 | Ga0373944_0319052 | 3300035089 | Bacteria | 586 |
| 245 | Ga0373936_0239996 | 3300035113 | Bacteria | 808 |
| 246 | Ga0373943_0186266 | 3300035170 | Bacteria | 1143 |
| 247 | Ga0373942_0048118 | 3300035207 | Bacteria | 1187 |
| 248 | Ga0373962_0077555 | 3300035242 | Bacteria | 1004 |
| 249 | Ga0316574_0161772 | 3300035398 | Bacteria | 1441 |
| 250 | Ga0373931_0025385 | 3300035691 | Bacteria | 3010 |
| 251 | Ga0373931_0322345 | 3300035691 | Bacteria | 960 |
| 252 | Ga0373935_0799781 | 3300035692 | Bacteria | 696 |
| 253 | Ga0373927_0099710 | 3300035695 | Bacteria | 1889 |
| 254 | Ga0373947_0214911 | 3300035725 | Bacteria | 1262 |
| 255 | Ga0373947_0357258 | 3300035725 | Bacteria | 981 |
| 256 | Ga0373937_0559533 | 3300036401 | Bacteria | 1086 |
| 257 | Ga0373925_0042262 | 3300037068 | Bacteria | 3381 |
| 258 | Ga0395900_0099978 | 3300037418 | Bacteria | 2979 |
| 259 | Ga0395900_0147341 | 3300037418 | Bacteria | 2407 |
| 260 | Ga0436365_1252022 | 3300039437 | Bacteria | 2707 |
| 261 | Ga0451799_25283 | 3300041454 | Bacteria | 824 |
| 262 | Ga0451801_24466 | 3300041455 | Bacteria | 999 |
| 263 | Ga0451800_0994459 | 3300041459 | Bacteria | 1260 |
| 264 | Ga0451802_0291917 | 3300041460 | Bacteria | 1777 |
| 265 | Ga0451807_0525531 | 3300041486 | Bacteria | 3443 |
| 266 | Ga0451853_0792599 | 3300041512 | Bacteria | 1125 |
| 267 | Ga0451853_1658291 | 3300041512 | Bacteria | 1114 |
| 268 | Ga0452271_89865 | 3300041916 | Bacteria | 555 |
| 269 | Ga0439431_0018450 | 3300041997 | Bacteria | 1651 |
| 270 | Ga0439433_0043226 | 3300041999 | Bacteria | 1052 |
| 271 | Ga0439441_153441 | 3300042001 | Bacteria | 543 |
| 272 | Ga0439445_0034773 | 3300042004 | Bacteria | 1322 |
| 273 | Ga0450911_039720 | 3300042115 | Bacteria | 611 |
| 274 | Ga0450912_021555 | 3300042116 | Bacteria | 626 |
| 275 | Ga0450920_028278 | 3300042122 | Bacteria | 1098 |
| 276 | Ga0450923_014290 | 3300042125 | Bacteria | 1472 |
| 277 | Ga0450897_013403 | 3300042128 | Bacteria | 818 |
| 278 | Ga0450898_007714 | 3300042134 | Bacteria | 1681 |
| 279 | Ga0439446_0012703 | 3300042156 | Bacteria | 2302 |
| 280 | Ga0450908_003391 | 3300042184 | Bacteria | 3094 |
| 281 | Ga0439434_0007600 | 3300042435 | Bacteria | 3177 |
| 282 | Ga0439435_0001708 | 3300042436 | Bacteria | 4155 |
| 283 | Ga0439444_0000230 | 3300042437 | Bacteria | 5448 |
| 284 | Ga0439460_0030496 | 3300042461 | Bacteria | 1533 |
| 285 | Ga0450918_058364 | 3300042531 | Bacteria | 710 |
| 286 | Ga0451577_0005175 | 3300042876 | Bacteria | 13417 |
| 287 | Ga0451577_0014500 | 3300042876 | Bacteria | 7347 |
| 288 | Ga0451577_0061424 | 3300042876 | Bacteria | 3351 |
| 289 | Ga0451577_0083955 | 3300042876 | Bacteria | 2842 |
| 290 | Ga0451577_0089369 | 3300042876 | Bacteria | 2749 |
| 291 | Ga0451577_0212094 | 3300042876 | Bacteria | 1749 |
| 292 | Ga0451577_0350159 | 3300042876 | Bacteria | 1340 |
| 293 | Ga0451577_0611985 | 3300042876 | Bacteria | 988 |
| 294 | Ga0451577_1731530 | 3300042876 | Bacteria | 549 |
| 295 | Ga0453683_0042531 | 3300044673 | Bacteria | 2852 |
| 296 | Ga0453683_0147490 | 3300044673 | Bacteria | 1486 |
| 297 | Ga0453683_0179591 | 3300044673 | Bacteria | 1342 |
| 298 | Ga0466966_0019613 | 3300044684 | Bacteria | 4449 |
| 299 | Ga0453684_0000065 | 3300044712 | Bacteria | 468481 |
| 300 | Ga0453684_0000369 | 3300044712 | Bacteria | 184784 |
| 301 | Ga0453684_0000677 | 3300044712 | Bacteria | 122140 |
| 302 | Ga0453684_0001529 | 3300044712 | Bacteria | 64683 |
| 303 | Ga0453684_0036305 | 3300044712 | Bacteria | 6793 |
| 304 | Ga0453684_0057201 | 3300044712 | Bacteria | 5050 |
| 305 | Ga0453684_0105896 | 3300044712 | Bacteria | 3429 |
| 306 | Ga0453684_0196609 | 3300044712 | Bacteria | 2354 |
| 307 | Ga0453684_0282201 | 3300044712 | Bacteria | 1893 |
| 308 | Ga0453684_0609905 | 3300044712 | Bacteria | 1195 |
| 309 | Ga0453684_1162688 | 3300044712 | Bacteria | 812 |
| 310 | Ga0453684_1483723 | 3300044712 | Bacteria | 700 |
| 311 | Ga0451576_0000591 | 3300045051 | Bacteria | 76735 |
| 312 | Ga0451576_0001977 | 3300045051 | Bacteria | 32557 |
| 313 | Ga0451576_0004578 | 3300045051 | Bacteria | 17867 |
| 314 | Ga0451576_0005888 | 3300045051 | Bacteria | 15217 |
| 315 | Ga0451576_0006277 | 3300045051 | Bacteria | 14626 |
| 316 | Ga0451576_0018556 | 3300045051 | Bacteria | 7621 |
| 317 | Ga0451576_0043793 | 3300045051 | Bacteria | 4721 |
| 318 | Ga0451576_0078765 | 3300045051 | Bacteria | 3429 |
| 319 | Ga0495650_0300434 | 3300046471 | Bacteria | 537 |
| 320 | Ga0495594_0483270 | 3300046499 | Bacteria | 704 |
| 321 | Ga0495643_0298253 | 3300046522 | Bacteria | 736 |
| 322 | Ga0495643_0404288 | 3300046522 | Bacteria | 602 |
| 323 | Ga0495621_0010478 | 3300046539 | Bacteria | 2838 |
| 324 | Ga0495658_0186801 | 3300046683 | Bacteria | 1287 |
| 325 | Ga0495658_0316455 | 3300046683 | Bacteria | 989 |
| 326 | Ga0496100_0224265 | 3300048903 | Bacteria | 1380 |
| 327 | Ga0496100_0418984 | 3300048903 | Bacteria | 1022 |
| 328 | Ga0496101_0009965 | 3300048904 | Bacteria | 6260 |
| 329 | Ga0496102_1808148 | 3300048905 | Bacteria | 528 |
| 330 | Ga0496104_0216430 | 3300048907 | Bacteria | 1827 |
| 331 | Ga0496104_0689804 | 3300048907 | Bacteria | 929 |
| 332 | Ga0496105_0072507 | 3300048908 | Bacteria | 2846 |
| 333 | Ga0496106_0081126 | 3300048909 | Bacteria | 2492 |
| 334 | Ga0496108_0028099 | 3300048911 | Bacteria | 4653 |
| 335 | Ga0496108_0228880 | 3300048911 | Bacteria | 1616 |
| 336 | Ga0496108_0233949 | 3300048911 | Unclassified | 1598 |
| 337 | Ga0496108_0452420 | 3300048911 | Bacteria | 1122 |
| 338 | Ga0496109_0250738 | 3300048912 | Bacteria | 1667 |
| 339 | Ga0496109_0319499 | 3300048912 | Bacteria | 1465 |
| 340 | Ga0496110_0041351 | 3300048913 | Bacteria | 4022 |
| 341 | Ga0496110_0166178 | 3300048913 | Bacteria | 2001 |
| 342 | Ga0496111_0248218 | 3300048914 | Bacteria | 1321 |
| 343 | Ga0496112_0195495 | 3300048915 | Bacteria | 1983 |
| 344 | Ga0496114_0030275 | 3300048917 | Bacteria | 4453 |
| 345 | Ga0496114_0038591 | 3300048917 | Bacteria | 3952 |
| 346 | Ga0496115_0367626 | 3300048918 | Bacteria | 1171 |
| 347 | Ga0496115_0512850 | 3300048918 | Unclassified | 962 |
| 348 | Ga0496118_0007023 | 3300048921 | Bacteria | 12122 |
| 349 | Ga0496121_0034283 | 3300048924 | Bacteria | 4571 |
| 350 | Ga0496123_0107876 | 3300048926 | Bacteria | 1600 |
| 351 | Ga0501306_069591 | 3300049127 | Bacteria | 592 |
| 352 | Ga0501309_028468 | 3300049129 | Bacteria | 815 |
| 353 | Ga0501310_027262 | 3300049130 | Bacteria | 744 |
| 354 | Ga0501310_045033 | 3300049130 | Bacteria | 625 |
| 355 | Ga0501305_104034 | 3300049161 | Bacteria | 531 |
| 356 | Ga0501291_006509 | 3300049514 | Bacteria | 1560 |
| 357 | Ga0501295_096023 | 3300049518 | Bacteria | 690 |
| 358 | Ga0501298_017541 | 3300049521 | Bacteria | 1308 |
| 359 | Ga0501311_019808 | 3300049527 | Bacteria | 905 |
| 360 | Ga0501312_019963 | 3300049528 | Bacteria | 988 |
| 361 | Ga0501313_046148 | 3300049529 | Bacteria | 594 |
| 362 | Ga0501315_033004 | 3300049531 | Bacteria | 754 |
| 363 | Ga0501315_077742 | 3300049531 | Bacteria | 559 |
| 364 | Ga0501318_077824 | 3300049534 | Bacteria | 533 |
| 365 | Ga0501318_089927 | 3300049534 | Bacteria | 507 |
| 366 | Ga0501320_062401 | 3300049536 | Bacteria | 526 |
| 367 | Ga0501334_03422 | 3300049550 | Bacteria | 982 |
| 368 | Ga0501335_008229 | 3300049551 | Bacteria | 977 |
| 369 | Ga0501335_041691 | 3300049551 | Bacteria | 542 |
| 370 | Ga0501031_0006233 | 3300049568 | Bacteria | 7778 |
| 371 | Ga0501031_0009246 | 3300049568 | Bacteria | 6405 |
| 372 | Ga0501032_0037608 | 3300049569 | Bacteria | 3299 |
| 373 | Ga0501032_0051359 | 3300049569 | Bacteria | 2780 |
| 374 | Ga0501032_0195800 | 3300049569 | Bacteria | 1320 |
| 375 | Ga0501033_0000709 | 3300049570 | Bacteria | 30657 |
| 376 | Ga0501033_0001808 | 3300049570 | Bacteria | 18685 |
| 377 | Ga0501033_0004879 | 3300049570 | Bacteria | 10682 |
| 378 | Ga0501033_0016892 | 3300049570 | Bacteria | 5517 |
| 379 | Ga0501033_0181983 | 3300049570 | Bacteria | 1506 |
| 380 | Ga0501034_0008103 | 3300049571 | Bacteria | 11145 |
| 381 | Ga0501034_0720819 | 3300049571 | Bacteria | 894 |
| 382 | Ga0501036_0000268 | 3300049572 | Bacteria | 35567 |
| 383 | Ga0501036_0001606 | 3300049572 | Bacteria | 17453 |
| 384 | Ga0501036_0150134 | 3300049572 | Bacteria | 1965 |
| 385 | Ga0501036_0396489 | 3300049572 | Bacteria | 1151 |
| 386 | Ga0501037_0005074 | 3300049573 | Bacteria | 9581 |
| 387 | Ga0501037_0141246 | 3300049573 | Bacteria | 1723 |
| 388 | Ga0501038_0000280 | 3300049574 | Bacteria | 43290 |
| 389 | Ga0501038_0004118 | 3300049574 | Bacteria | 13528 |
| 390 | Ga0501038_0019910 | 3300049574 | Bacteria | 6039 |
| 391 | Ga0501038_0047069 | 3300049574 | Bacteria | 3737 |
| 392 | Ga0501038_0055621 | 3300049574 | Bacteria | 3399 |
| 393 | Ga0501038_0128257 | 3300049574 | Bacteria | 2086 |
| 394 | Ga0501038_0210873 | 3300049574 | Bacteria | 1554 |
| 395 | Ga0501039_0053362 | 3300049575 | Bacteria | 3128 |
| 396 | Ga0501039_0085668 | 3300049575 | Bacteria | 2454 |
| 397 | Ga0501039_0099282 | 3300049575 | Bacteria | 2272 |
| 398 | Ga0501039_0101811 | 3300049575 | Bacteria | 2242 |
| 399 | Ga0501039_0121166 | 3300049575 | Bacteria | 2050 |
| 400 | Ga0501039_0218695 | 3300049575 | Bacteria | 1498 |
| 401 | Ga0501039_0470201 | 3300049575 | Bacteria | 987 |
| 402 | Ga0501039_0803598 | 3300049575 | Bacteria | 734 |
| 403 | Ga0501040_0001121 | 3300049576 | Bacteria | 16964 |
| 404 | Ga0501040_0006758 | 3300049576 | Bacteria | 7442 |
| 405 | Ga0501041_0005255 | 3300049577 | Bacteria | 7566 |
| 406 | Ga0501041_0024260 | 3300049577 | Bacteria | 3640 |
| 407 | Ga0501042_0008786 | 3300049578 | Bacteria | 6697 |
| 408 | Ga0501042_0010832 | 3300049578 | Bacteria | 6132 |
| 409 | Ga0501042_0046606 | 3300049578 | Bacteria | 3091 |
| 410 | Ga0501042_0524759 | 3300049578 | Bacteria | 860 |
| 411 | Ga0501043_0001507 | 3300049579 | Bacteria | 20331 |
| 412 | Ga0501043_0003838 | 3300049579 | Bacteria | 12355 |
| 413 | Ga0501043_0696590 | 3300049579 | Bacteria | 742 |
| 414 | Ga0501046_0008472 | 3300049580 | Bacteria | 8958 |
| 415 | Ga0501046_0011739 | 3300049580 | Bacteria | 7479 |
| 416 | Ga0501046_0017699 | 3300049580 | Bacteria | 5944 |
| 417 | Ga0501047_0002525 | 3300049581 | Bacteria | 17435 |
| 418 | Ga0501047_0014502 | 3300049581 | Bacteria | 7495 |
| 419 | Ga0501047_0285563 | 3300049581 | Bacteria | 1494 |
| 420 | Ga0501048_0006099 | 3300049582 | Bacteria | 9181 |
| 421 | Ga0501048_0044068 | 3300049582 | Bacteria | 3192 |
| 422 | Ga0501048_0449558 | 3300049582 | Bacteria | 923 |
| 423 | Ga0501067_0123273 | 3300049583 | Bacteria | 1442 |
| 424 | Ga0501068_0013549 | 3300049584 | Bacteria | 4641 |
| 425 | Ga0501068_0186570 | 3300049584 | Bacteria | 1312 |
| 426 | Ga0501068_0336098 | 3300049584 | Bacteria | 970 |
| 427 | Ga0501070_0435474 | 3300049586 | Unclassified | 1058 |
| 428 | Ga0501071_0008818 | 3300049587 | Bacteria | 6684 |
| 429 | Ga0501071_0028837 | 3300049587 | Bacteria | 3913 |
| 430 | Ga0501071_0954416 | 3300049587 | Bacteria | 662 |
| 431 | Ga0501072_0010795 | 3300049588 | Bacteria | 6959 |
| 432 | Ga0501072_0154060 | 3300049588 | Bacteria | 1833 |
| 433 | Ga0501074_0071699 | 3300049590 | Bacteria | 2490 |
| 434 | Ga0501075_0003774 | 3300049591 | Bacteria | 10182 |
| 435 | Ga0501075_0012522 | 3300049591 | Bacteria | 6031 |
| 436 | Ga0501076_0053539 | 3300049592 | Bacteria | 3198 |
| 437 | Ga0501077_0068019 | 3300049593 | Bacteria | 2258 |
| 438 | Ga0501077_0088085 | 3300049593 | Bacteria | 1967 |
| 439 | Ga0501077_0225113 | 3300049593 | Bacteria | 1192 |
| 440 | Ga0501216_036781 | 3300049660 | Bacteria | 924 |
| 441 | Ga0501259_051721 | 3300049688 | Bacteria | 836 |
| 442 | Ga0501079_0016926 | 3300049741 | Bacteria | 5568 |
| 443 | Ga0501079_0499757 | 3300049741 | Bacteria | 956 |
| 444 | Ga0501080_0018074 | 3300049742 | Bacteria | 6527 |
| 445 | Ga0501080_0059040 | 3300049742 | Bacteria | 3570 |
| 446 | Ga0501081_0066788 | 3300049743 | Bacteria | 2501 |
| 447 | Ga0501081_0349070 | 3300049743 | Bacteria | 1090 |
| 448 | Ga0501081_0843546 | 3300049743 | Bacteria | 690 |
| 449 | Ga0501280_000535 | 3300049776 | Bacteria | 8910 |
| 450 | Ga0501283_013662 | 3300049779 | Bacteria | 1233 |
| 451 | Ga0501035_0000270 | 3300049822 | Bacteria | 61516 |
| 452 | Ga0501035_0004552 | 3300049822 | Bacteria | 13160 |
| 453 | Ga0501035_0007685 | 3300049822 | Bacteria | 10073 |
| 454 | Ga0501035_0058038 | 3300049822 | Bacteria | 3450 |
| 455 | Ga0501035_0111503 | 3300049822 | Bacteria | 2397 |
| 456 | Ga0501035_0194175 | 3300049822 | Bacteria | 1744 |
| 457 | Ga0501035_0246420 | 3300049822 | Bacteria | 1518 |
| 458 | Ga0501035_0596576 | 3300049822 | Bacteria | 900 |
| 459 | Ga0501044_0000261 | 3300049823 | Bacteria | 66869 |
| 460 | Ga0501044_0000482 | 3300049823 | Bacteria | 48412 |
| 461 | Ga0501044_0004065 | 3300049823 | Bacteria | 16403 |
| 462 | Ga0501044_0006513 | 3300049823 | Bacteria | 12897 |
| 463 | Ga0501044_0075275 | 3300049823 | Bacteria | 3427 |
| 464 | Ga0501044_0189624 | 3300049823 | Bacteria | 2019 |
| 465 | Ga0501044_0860556 | 3300049823 | Bacteria | 783 |
| 466 | Ga0501044_1216511 | 3300049823 | Bacteria | 621 |
| 467 | Ga0501045_0000564 | 3300049824 | Bacteria | 23265 |
| 468 | Ga0501045_0009535 | 3300049824 | Bacteria | 6792 |
| 469 | nmdc:mga03683_90095_c1 | 3300050489 | Bacteria | 1336 |
| 470 | nmdc:mga03n38_196310_c1 | 3300050490 | Bacteria | 1042 |
| 471 | nmdc:mga00v17_215529_c1 | 3300050491 | Bacteria | 1243 |
| 472 | nmdc:mga00v17_445188_c1 | 3300050491 | Bacteria | 841 |
| 473 | nmdc:mga0k408_149591_c1 | 3300050493 | Bacteria | 1390 |
| 474 | nmdc:mga0k408_74404_c1 | 3300050493 | Bacteria | 1985 |
| 475 | nmdc:mga0k408_8866_c1 | 3300050493 | Bacteria | 5410 |
| 476 | nmdc:mga06z11_129572_c1 | 3300050494 | Bacteria | 1415 |
| 477 | nmdc:mga04h51_245422_c1 | 3300050495 | Bacteria | 716 |
| 478 | nmdc:mga08y16_326210_c1 | 3300050511 | Bacteria | 1580 |
| 479 | nmdc:mga08y16_409233_c1 | 3300050511 | Bacteria | 1387 |
| 480 | nmdc:mga0rr50_640801_c1 | 3300050513 | Bacteria | 906 |
| 481 | nmdc:mga0sz30_67780_c1 | 3300050516 | Bacteria | 1533 |
| 482 | Ga0500561_0280024 | 3300053137 | Bacteria | 531 |
| 483 | Ga0501084_0006071 | 3300054114 | Bacteria | 9935 |
| 484 | Ga0501084_0010488 | 3300054114 | Bacteria | 7659 |
| 485 | Ga0587084_097626 | 3300059477 | Bacteria | 591 |
| 486 | Ga0587092_132618 | 3300059512 | Bacteria | 542 |
| 487 | Ga0587076_032864 | 3300059645 | Bacteria | 930 |
| 488 | Ga0587078_033317 | 3300059646 | Bacteria | 703 |
| 489 | Ga0587120_004814 | 3300059659 | Bacteria | 1018 |
| 490 | Ga0501082_0007272 | 3300060353 | Bacteria | 9552 |
| 491 | Ga0501082_0045379 | 3300060353 | Bacteria | 3790 |
| 492 | Ga0530510_0002778 | 3300061734 | Bacteria | 12037 |
| 493 | Ga0530510_0033060 | 3300061734 | Bacteria | 3723 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039437 | Ga0436365_1252022 | Ga0436365_1252022_2133_2576 | 133 |
| 2 | 3300048921 | Ga0496118_0007023 | Ga0496118_0007023_7424_7837 | 137 |
| 3 | iso_pu_bacteria | 2508501125 | 2509132347 | 138 |
| 4 | iso_pu_bacteria | 2513237151 | 2513963382 | 138 |
| 5 | iso_pu_bacteria | 2513237166 | 2514046221 | 138 |
| 6 | iso_pu_bacteria | 2526164512 | 2526213988 | 138 |
| 7 | iso_pu_bacteria | 2526164713 | 2527078615 | 138 |
| 8 | iso_pu_bacteria | 2547132512 | 2548848734 | 138 |
| 9 | iso_pu_bacteria | 2562617112 | 2563061835 | 138 |
| 10 | iso_pu_bacteria | 2574179768 | 2574429152 | 138 |
| 11 | iso_pu_bacteria | 2711768613 | 2713478330 | 138 |
| 12 | iso_pu_bacteria | 2738541296 | 2738821711 | 138 |
| 13 | iso_pu_bacteria | 2738541298 | 2738834193 | 138 |
| 14 | iso_pu_bacteria | 2738541306 | 2738875397 | 138 |
| 15 | iso_pu_bacteria | 2738543002 | 2739187350 | 138 |
| 16 | iso_pu_bacteria | 2738543008 | 2739221995 | 138 |
| 17 | iso_pu_bacteria | 2744054900 | 2746088591 | 138 |
| 18 | iso_pu_bacteria | 2744054901 | 2746092630 | 138 |
| 19 | iso_pu_bacteria | 2791355137 | 2792840607 | 138 |
| 20 | iso_pu_bacteria | 2818991450 | 2819623393 | 138 |
| 21 | iso_pu_bacteria | 2842324504 | 2842324637 | 138 |
| 22 | iso_pu_bacteria | 2842348783 | 2842348915 | 138 |
| 23 | iso_pu_bacteria | 2842454564 | 2842457379 | 138 |
| 24 | iso_pu_bacteria | 2900634093 | 2900637353 | 138 |
| 25 | iso_pu_bacteria | 2904483920 | 2904487823 | 138 |
| 26 | iso_pu_bacteria | 2919527303 | 2919529128 | 138 |
| 27 | iso_pu_bacteria | 2921643360 | 2921643812 | 138 |
| 28 | iso_pu_bacteria | 2928108538 | 2928113538 | 138 |
| 29 | iso_pu_bacteria | 2928135762 | 2928140749 | 138 |
| 30 | iso_pu_bacteria | 2928503688 | 2928506134 | 138 |
| 31 | iso_pu_bacteria | 2945934425 | 2945938097 | 138 |
| 32 | iso_pu_bacteria | 2990703756 | 2990705186 | 138 |
| 33 | iso_pu_bacteria | 642555113 | 642622928 | 138 |
| 34 | iso_pu_bacteria | 8048746797 | 8048748608 | 138 |
| 35 | iso_pu_bacteria | 8055266321 | 8055267402 | 138 |
| 36 | iso_pu_bacteria | 8055301274 | 8055301297 | 138 |
| 37 | iso_pu_bacteria | 2643221572 | 2643876417 | 139 |
| 38 | iso_pu_bacteria | 2643221669 | 2644383472 | 139 |
| 39 | iso_pu_bacteria | 2895660088 | 2895660591 | 139 |
| 40 | 3300003163 | Ga0006759J45824_1005431 | Ga0006759J45824_10054312 | 141 |
| 41 | 3300003320 | rootH2_10010659 | rootH2_100106592 | 141 |
| 42 | 3300003323 | rootH1_10007780 | rootH1_100077805 | 141 |
| 43 | 3300005289 | Ga0065704_10553282 | Ga0065704_105532821 | 141 |
| 44 | 3300049583 | Ga0501067_0123273 | Ga0501067_0123273_579_1031 | 141 |
| 45 | 3300001904 | JGI24736J21556_1048266 | JGI24736J21556_10482662 | 142 |
| 46 | 3300003559 | Ga0007427J51700_123299 | Ga0007427J51700_1232991 | 142 |
| 47 | 3300003575 | Ga0007409J51694_1049228 | Ga0007409J51694_10492281 | 142 |
| 48 | 3300003579 | Ga0007429J51699_1049887 | Ga0007429J51699_10498871 | 142 |
| 49 | 3300004801 | Ga0058860_10580578 | Ga0058860_105805781 | 142 |
| 50 | 3300005290 | Ga0065712_10271024 | Ga0065712_102710242 | 142 |
| 51 | 3300005290 | Ga0065712_10576999 | Ga0065712_105769991 | 142 |
| 52 | 3300005290 | Ga0065712_10620510 | Ga0065712_106205101 | 142 |
| 53 | 3300005327 | Ga0070658_10188547 | Ga0070658_101885471 | 142 |
| 54 | 3300005327 | Ga0070658_10266221 | Ga0070658_102662212 | 142 |
| 55 | 3300005327 | Ga0070658_10776939 | Ga0070658_107769391 | 142 |
| 56 | 3300005329 | Ga0070683_100091001 | Ga0070683_1000910013 | 142 |
| 57 | 3300005330 | Ga0070690_100505707 | Ga0070690_1005057072 | 142 |
| 58 | 3300005333 | Ga0070677_10187745 | Ga0070677_101877452 | 142 |
| 59 | 3300005336 | Ga0070680_100790945 | Ga0070680_1007909451 | 142 |
| 60 | 3300005337 | Ga0070682_100222915 | Ga0070682_1002229152 | 142 |
| 61 | 3300005338 | Ga0068868_100025744 | Ga0068868_1000257443 | 142 |
| 62 | 3300005338 | Ga0068868_100188507 | Ga0068868_1001885072 | 142 |
| 63 | 3300005338 | Ga0068868_100315019 | Ga0068868_1003150192 | 142 |
| 64 | 3300005339 | Ga0070660_100031943 | Ga0070660_1000319434 | 142 |
| 65 | 3300005339 | Ga0070660_100281947 | Ga0070660_1002819472 | 142 |
| 66 | 3300005339 | Ga0070660_100607076 | Ga0070660_1006070762 | 142 |
| 67 | 3300005340 | Ga0070689_100091715 | Ga0070689_1000917152 | 142 |
| 68 | 3300005344 | Ga0070661_100098154 | Ga0070661_1000981542 | 142 |
| 69 | 3300005354 | Ga0070675_100019434 | Ga0070675_1000194345 | 142 |
| 70 | 3300005355 | Ga0070671_100049003 | Ga0070671_1000490033 | 142 |
| 71 | 3300005364 | Ga0070673_100065827 | Ga0070673_1000658272 | 142 |
| 72 | 3300005366 | Ga0070659_100077804 | Ga0070659_1000778044 | 142 |
| 73 | 3300005366 | Ga0070659_100988714 | Ga0070659_1009887141 | 142 |
| 74 | 3300005435 | Ga0070714_100104368 | Ga0070714_1001043683 | 142 |
| 75 | 3300005435 | Ga0070714_100256237 | Ga0070714_1002562371 | 142 |
| 76 | 3300005437 | Ga0070710_10822712 | Ga0070710_108227121 | 142 |
| 77 | 3300005438 | Ga0070701_10172724 | Ga0070701_101727242 | 142 |
| 78 | 3300005441 | Ga0070700_101717950 | Ga0070700_1017179501 | 142 |
| 79 | 3300005455 | Ga0070663_100124576 | Ga0070663_1001245762 | 142 |
| 80 | 3300005455 | Ga0070663_100264673 | Ga0070663_1002646732 | 142 |
| 81 | 3300005455 | Ga0070663_100542070 | Ga0070663_1005420702 | 142 |
| 82 | 3300005456 | Ga0070678_100094789 | Ga0070678_1000947892 | 142 |
| 83 | 3300005457 | Ga0070662_100974577 | Ga0070662_1009745771 | 142 |
| 84 | 3300005457 | Ga0070662_101099244 | Ga0070662_1010992441 | 142 |
| 85 | 3300005458 | Ga0070681_10019167 | Ga0070681_100191674 | 142 |
| 86 | 3300005458 | Ga0070681_10422911 | Ga0070681_104229113 | 142 |
| 87 | 3300005459 | Ga0068867_100100840 | Ga0068867_1001008403 | 142 |
| 88 | 3300005466 | Ga0070685_10492864 | Ga0070685_104928642 | 142 |
| 89 | 3300005466 | Ga0070685_11426697 | Ga0070685_114266971 | 142 |
| 90 | 3300005468 | Ga0070707_101197140 | Ga0070707_1011971401 | 142 |
| 91 | 3300005471 | Ga0070698_100576695 | Ga0070698_1005766952 | 142 |
| 92 | 3300005530 | Ga0070679_100221040 | Ga0070679_1002210401 | 142 |
| 93 | 3300005530 | Ga0070679_101911744 | Ga0070679_1019117441 | 142 |
| 94 | 3300005535 | Ga0070684_100040791 | Ga0070684_1000407912 | 142 |
| 95 | 3300005535 | Ga0070684_100214510 | Ga0070684_1002145102 | 142 |
| 96 | 3300005536 | Ga0070697_100055150 | Ga0070697_1000551503 | 142 |
| 97 | 3300005539 | Ga0068853_100189267 | Ga0068853_1001892674 | 142 |
| 98 | 3300005543 | Ga0070672_100034137 | Ga0070672_1000341372 | 142 |
| 99 | 3300005546 | Ga0070696_100426396 | Ga0070696_1004263962 | 142 |
| 100 | 3300005548 | Ga0070665_100719023 | Ga0070665_1007190231 | 142 |
| 101 | 3300005549 | Ga0070704_100169456 | Ga0070704_1001694562 | 142 |
| 102 | 3300005549 | Ga0070704_101292714 | Ga0070704_1012927141 | 142 |
| 103 | 3300005549 | Ga0070704_101684661 | Ga0070704_1016846611 | 142 |
| 104 | 3300005564 | Ga0070664_100024396 | Ga0070664_1000243966 | 142 |
| 105 | 3300005578 | Ga0068854_100647553 | Ga0068854_1006475532 | 142 |
| 106 | 3300005614 | Ga0068856_100108775 | Ga0068856_1001087753 | 142 |
| 107 | 3300005616 | Ga0068852_100001759 | Ga0068852_1000017593 | 142 |
| 108 | 3300005616 | Ga0068852_100021983 | Ga0068852_1000219835 | 142 |
| 109 | 3300005617 | Ga0068859_100061235 | Ga0068859_1000612357 | 142 |
| 110 | 3300005618 | Ga0068864_100147719 | Ga0068864_1001477192 | 142 |
| 111 | 3300005618 | Ga0068864_100433075 | Ga0068864_1004330752 | 142 |
| 112 | 3300005718 | Ga0068866_10271242 | Ga0068866_102712422 | 142 |
| 113 | 3300005834 | Ga0068851_10009817 | Ga0068851_100098175 | 142 |
| 114 | 3300005834 | Ga0068851_10030814 | Ga0068851_100308143 | 142 |
| 115 | 3300005841 | Ga0068863_100966204 | Ga0068863_1009662042 | 142 |
| 116 | 3300005842 | Ga0068858_100186764 | Ga0068858_1001867643 | 142 |
| 117 | 3300005843 | Ga0068860_101520606 | Ga0068860_1015206061 | 142 |
| 118 | 3300006042 | Ga0075368_10322754 | Ga0075368_103227542 | 142 |
| 119 | 3300006048 | Ga0075363_100152546 | Ga0075363_1001525462 | 142 |
| 120 | 3300006051 | Ga0075364_10118324 | Ga0075364_101183242 | 142 |
| 121 | 3300006051 | Ga0075364_10494932 | Ga0075364_104949322 | 142 |
| 122 | 3300006163 | Ga0070715_10360257 | Ga0070715_103602572 | 142 |
| 123 | 3300006173 | Ga0070716_100163095 | Ga0070716_1001630952 | 142 |
| 124 | 3300006175 | Ga0070712_101064899 | Ga0070712_1010648991 | 142 |
| 125 | 3300006175 | Ga0070712_101067080 | Ga0070712_1010670801 | 142 |
| 126 | 3300006177 | Ga0075362_10015321 | Ga0075362_100153211 | 142 |
| 127 | 3300006177 | Ga0075362_10054872 | Ga0075362_100548721 | 142 |
| 128 | 3300006178 | Ga0075367_10164091 | Ga0075367_101640912 | 142 |
| 129 | 3300006186 | Ga0075369_10013586 | Ga0075369_100135862 | 142 |
| 130 | 3300006195 | Ga0075366_10001852 | Ga0075366_100018527 | 142 |
| 131 | 3300006195 | Ga0075366_10031402 | Ga0075366_100314022 | 142 |
| 132 | 3300006195 | Ga0075366_10071725 | Ga0075366_100717251 | 142 |
| 133 | 3300006195 | Ga0075366_10954697 | Ga0075366_109546971 | 142 |
| 134 | 3300006237 | Ga0097621_100030798 | Ga0097621_1000307987 | 142 |
| 135 | 3300006237 | Ga0097621_100048009 | Ga0097621_1000480093 | 142 |
| 136 | 3300006358 | Ga0068871_100019547 | Ga0068871_1000195474 | 142 |
| 137 | 3300006358 | Ga0068871_100049509 | Ga0068871_1000495093 | 142 |
| 138 | 3300006844 | Ga0075428_101221409 | Ga0075428_1012214091 | 142 |
| 139 | 3300006881 | Ga0068865_102020607 | Ga0068865_1020206071 | 142 |
| 140 | 3300006931 | Ga0097620_100061233 | Ga0097620_1000612331 | 142 |
| 141 | 3300009093 | Ga0105240_11163136 | Ga0105240_111631361 | 142 |
| 142 | 3300009094 | Ga0111539_10060204 | Ga0111539_100602042 | 142 |
| 143 | 3300009094 | Ga0111539_10390106 | Ga0111539_103901061 | 142 |
| 144 | 3300009094 | Ga0111539_10587431 | Ga0111539_105874313 | 142 |
| 145 | 3300009094 | Ga0111539_10606705 | Ga0111539_106067052 | 142 |
| 146 | 3300009094 | Ga0111539_11894233 | Ga0111539_118942331 | 142 |
| 147 | 3300009098 | Ga0105245_10754849 | Ga0105245_107548492 | 142 |
| 148 | 3300009101 | Ga0105247_10745125 | Ga0105247_107451251 | 142 |
| 149 | 3300009148 | Ga0105243_10144671 | Ga0105243_101446713 | 142 |
| 150 | 3300009174 | Ga0105241_10519824 | Ga0105241_105198241 | 142 |
| 151 | 3300009174 | Ga0105241_11113792 | Ga0105241_111137921 | 142 |
| 152 | 3300009176 | Ga0105242_10472301 | Ga0105242_104723012 | 142 |
| 153 | 3300009177 | Ga0105248_10184527 | Ga0105248_101845273 | 142 |
| 154 | 3300009177 | Ga0105248_10470167 | Ga0105248_104701672 | 142 |
| 155 | 3300009553 | Ga0105249_11421537 | Ga0105249_114215372 | 142 |
| 156 | 3300010375 | Ga0105239_10442194 | Ga0105239_104421941 | 142 |
| 157 | 3300010375 | Ga0105239_10676179 | Ga0105239_106761792 | 142 |
| 158 | 3300010375 | Ga0105239_11029141 | Ga0105239_110291411 | 142 |
| 159 | 3300013100 | Ga0157373_10055671 | Ga0157373_100556713 | 142 |
| 160 | 3300013104 | Ga0157370_10002935 | Ga0157370_1000293516 | 142 |
| 161 | 3300013104 | Ga0157370_10088612 | Ga0157370_100886122 | 142 |
| 162 | 3300013296 | Ga0157374_10095354 | Ga0157374_100953544 | 142 |
| 163 | 3300013296 | Ga0157374_10125178 | Ga0157374_101251782 | 142 |
| 164 | 3300013296 | Ga0157374_10344407 | Ga0157374_103444071 | 142 |
| 165 | 3300013296 | Ga0157374_10862718 | Ga0157374_108627181 | 142 |
| 166 | 3300013297 | Ga0157378_10238003 | Ga0157378_102380033 | 142 |
| 167 | 3300013306 | Ga0163162_10316061 | Ga0163162_103160613 | 142 |
| 168 | 3300013306 | Ga0163162_10487671 | Ga0163162_104876712 | 142 |
| 169 | 3300013308 | Ga0157375_10432340 | Ga0157375_104323403 | 142 |
| 170 | 3300013308 | Ga0157375_11287532 | Ga0157375_112875321 | 142 |
| 171 | 3300014325 | Ga0163163_10157561 | Ga0163163_101575612 | 142 |
| 172 | 3300014325 | Ga0163163_11029657 | Ga0163163_110296572 | 142 |
| 173 | 3300014969 | Ga0157376_10089491 | Ga0157376_100894912 | 142 |
| 174 | 3300014969 | Ga0157376_10277773 | Ga0157376_102777733 | 142 |
| 175 | 3300015261 | Ga0182006_1052209 | Ga0182006_10522092 | 142 |
| 176 | 3300025228 | Ga0209672_100038 | Ga0209672_100038214 | 142 |
| 177 | 3300025229 | Ga0209147_100235 | Ga0209147_10023541 | 142 |
| 178 | 3300025254 | Ga0209148_1001389 | Ga0209148_10013893 | 142 |
| 179 | 3300025315 | Ga0207697_10087497 | Ga0207697_100874972 | 142 |
| 180 | 3300025321 | Ga0207656_10002235 | Ga0207656_100022355 | 142 |
| 181 | 3300025321 | Ga0207656_10095578 | Ga0207656_100955782 | 142 |
| 182 | 3300025321 | Ga0207656_10150232 | Ga0207656_101502322 | 142 |
| 183 | 3300025893 | Ga0207682_10028984 | Ga0207682_100289842 | 142 |
| 184 | 3300025899 | Ga0207642_10494421 | Ga0207642_104944212 | 142 |
| 185 | 3300025901 | Ga0207688_10288782 | Ga0207688_102887822 | 142 |
| 186 | 3300025904 | Ga0207647_10015145 | Ga0207647_100151455 | 142 |
| 187 | 3300025907 | Ga0207645_10168928 | Ga0207645_101689283 | 142 |
| 188 | 3300025908 | Ga0207643_10312452 | Ga0207643_103124522 | 142 |
| 189 | 3300025909 | Ga0207705_10089853 | Ga0207705_100898533 | 142 |
| 190 | 3300025910 | Ga0207684_10168852 | Ga0207684_101688522 | 142 |
| 191 | 3300025911 | Ga0207654_10378193 | Ga0207654_103781931 | 142 |
| 192 | 3300025913 | Ga0207695_10076578 | Ga0207695_100765781 | 142 |
| 193 | 3300025913 | Ga0207695_10140700 | Ga0207695_101407003 | 142 |
| 194 | 3300025913 | Ga0207695_10974789 | Ga0207695_109747891 | 142 |
| 195 | 3300025914 | Ga0207671_10005622 | Ga0207671_100056223 | 142 |
| 196 | 3300025915 | Ga0207693_10769985 | Ga0207693_107699852 | 142 |
| 197 | 3300025917 | Ga0207660_10969628 | Ga0207660_109696282 | 142 |
| 198 | 3300025919 | Ga0207657_10093367 | Ga0207657_100933672 | 142 |
| 199 | 3300025919 | Ga0207657_10760595 | Ga0207657_107605952 | 142 |
| 200 | 3300025920 | Ga0207649_10151955 | Ga0207649_101519552 | 142 |
| 201 | 3300025920 | Ga0207649_10153165 | Ga0207649_101531651 | 142 |
| 202 | 3300025921 | Ga0207652_10163763 | Ga0207652_101637632 | 142 |
| 203 | 3300025922 | Ga0207646_10743076 | Ga0207646_107430762 | 142 |
| 204 | 3300025925 | Ga0207650_10017043 | Ga0207650_100170434 | 142 |
| 205 | 3300025926 | Ga0207659_10535626 | Ga0207659_105356262 | 142 |
| 206 | 3300025926 | Ga0207659_11205512 | Ga0207659_112055122 | 142 |
| 207 | 3300025927 | Ga0207687_10849691 | Ga0207687_108496912 | 142 |
| 208 | 3300025927 | Ga0207687_11283682 | Ga0207687_112836821 | 142 |
| 209 | 3300025929 | Ga0207664_10089886 | Ga0207664_100898863 | 142 |
| 210 | 3300025929 | Ga0207664_10169003 | Ga0207664_101690032 | 142 |
| 211 | 3300025929 | Ga0207664_11121405 | Ga0207664_111214052 | 142 |
| 212 | 3300025933 | Ga0207706_10048226 | Ga0207706_100482266 | 142 |
| 213 | 3300025933 | Ga0207706_10286923 | Ga0207706_102869232 | 142 |
| 214 | 3300025933 | Ga0207706_10571062 | Ga0207706_105710622 | 142 |
| 215 | 3300025936 | Ga0207670_10069357 | Ga0207670_100693573 | 142 |
| 216 | 3300025936 | Ga0207670_10217709 | Ga0207670_102177093 | 142 |
| 217 | 3300025937 | Ga0207669_10142792 | Ga0207669_101427921 | 142 |
| 218 | 3300025939 | Ga0207665_10134269 | Ga0207665_101342693 | 142 |
| 219 | 3300025940 | Ga0207691_10033884 | Ga0207691_100338846 | 142 |
| 220 | 3300025941 | Ga0207711_10845942 | Ga0207711_108459422 | 142 |
| 221 | 3300025941 | Ga0207711_11249716 | Ga0207711_112497162 | 142 |
| 222 | 3300025944 | Ga0207661_10358235 | Ga0207661_103582353 | 142 |
| 223 | 3300025945 | Ga0207679_10078695 | Ga0207679_100786953 | 142 |
| 224 | 3300025960 | Ga0207651_10723203 | Ga0207651_107232032 | 142 |
| 225 | 3300025981 | Ga0207640_10111180 | Ga0207640_101111802 | 142 |
| 226 | 3300025981 | Ga0207640_10941404 | Ga0207640_109414041 | 142 |
| 227 | 3300025981 | Ga0207640_12074558 | Ga0207640_120745581 | 142 |
| 228 | 3300026023 | Ga0207677_10025794 | Ga0207677_100257943 | 142 |
| 229 | 3300026023 | Ga0207677_10041891 | Ga0207677_100418914 | 142 |
| 230 | 3300026023 | Ga0207677_11391870 | Ga0207677_113918702 | 142 |
| 231 | 3300026035 | Ga0207703_10154047 | Ga0207703_101540473 | 142 |
| 232 | 3300026041 | Ga0207639_10525729 | Ga0207639_105257292 | 142 |
| 233 | 3300026067 | Ga0207678_10655850 | Ga0207678_106558502 | 142 |
| 234 | 3300026075 | Ga0207708_11176110 | Ga0207708_111761102 | 142 |
| 235 | 3300026088 | Ga0207641_10499892 | Ga0207641_104998922 | 142 |
| 236 | 3300026088 | Ga0207641_10888779 | Ga0207641_108887791 | 142 |
| 237 | 3300026089 | Ga0207648_10068615 | Ga0207648_100686154 | 142 |
| 238 | 3300026089 | Ga0207648_10514277 | Ga0207648_105142772 | 142 |
| 239 | 3300026095 | Ga0207676_10147667 | Ga0207676_101476672 | 142 |
| 240 | 3300026118 | Ga0207675_100203901 | Ga0207675_1002039012 | 142 |
| 241 | 3300026121 | Ga0207683_10000544 | Ga0207683_1000054435 | 142 |
| 242 | 3300026142 | Ga0207698_10004810 | Ga0207698_100048102 | 142 |
| 243 | 3300026142 | Ga0207698_10070917 | Ga0207698_100709174 | 142 |
| 244 | 3300026142 | Ga0207698_10577228 | Ga0207698_105772282 | 142 |
| 245 | 3300027614 | Ga0209970_1006891 | Ga0209970_10068912 | 142 |
| 246 | 3300027907 | Ga0207428_10011353 | Ga0207428_100113533 | 142 |
| 247 | 3300028577 | Ga0265318_10020713 | Ga0265318_100207133 | 142 |
| 248 | 3300028786 | Ga0307517_10131378 | Ga0307517_101313782 | 142 |
| 249 | 3300028794 | Ga0307515_10108731 | Ga0307515_101087312 | 142 |
| 250 | 3300031238 | Ga0265332_10000039 | Ga0265332_10000039125 | 142 |
| 251 | 3300031240 | Ga0265320_10019701 | Ga0265320_100197014 | 142 |
| 252 | 3300031240 | Ga0265320_10135680 | Ga0265320_101356801 | 142 |
| 253 | 3300031241 | Ga0265325_10108797 | Ga0265325_101087971 | 142 |
| 254 | 3300031250 | Ga0265331_10005900 | Ga0265331_100059008 | 142 |
| 255 | 3300031250 | Ga0265331_10092990 | Ga0265331_100929903 | 142 |
| 256 | 3300031250 | Ga0265331_10271866 | Ga0265331_102718662 | 142 |
| 257 | 3300031344 | Ga0265316_10004209 | Ga0265316_100042096 | 142 |
| 258 | 3300031344 | Ga0265316_10421225 | Ga0265316_104212251 | 142 |
| 259 | 3300031507 | Ga0307509_10000018 | Ga0307509_100000188 | 142 |
| 260 | 3300031548 | Ga0307408_100035777 | Ga0307408_1000357774 | 142 |
| 261 | 3300031548 | Ga0307408_100220816 | Ga0307408_1002208163 | 142 |
| 262 | 3300031711 | Ga0265314_10001425 | Ga0265314_1000142510 | 142 |
| 263 | 3300031711 | Ga0265314_10380453 | Ga0265314_103804532 | 142 |
| 264 | 3300031730 | Ga0307516_10001808 | Ga0307516_100018089 | 142 |
| 265 | 3300031731 | Ga0307405_10031395 | Ga0307405_100313952 | 142 |
| 266 | 3300031824 | Ga0307413_10010514 | Ga0307413_100105142 | 142 |
| 267 | 3300031901 | Ga0307406_10265915 | Ga0307406_102659152 | 142 |
| 268 | 3300031903 | Ga0307407_10085080 | Ga0307407_100850804 | 142 |
| 269 | 3300031911 | Ga0307412_10001034 | Ga0307412_1000103417 | 142 |
| 270 | 3300031911 | Ga0307412_10598103 | Ga0307412_105981032 | 142 |
| 271 | 3300031911 | Ga0307412_10830723 | Ga0307412_108307232 | 142 |
| 272 | 3300031995 | Ga0307409_100101014 | Ga0307409_1001010143 | 142 |
| 273 | 3300032005 | Ga0307411_10154535 | Ga0307411_101545354 | 142 |
| 274 | 3300032005 | Ga0307411_10173731 | Ga0307411_101737312 | 142 |
| 275 | 3300032005 | Ga0307411_10962352 | Ga0307411_109623521 | 142 |
| 276 | 3300032005 | Ga0307411_11108031 | Ga0307411_111080311 | 142 |
| 277 | 3300032126 | Ga0307415_100000825 | Ga0307415_10000082515 | 142 |
| 278 | 3300032133 | Ga0316583_10001814 | Ga0316583_100018146 | 142 |
| 279 | 3300033524 | Ga0316592_1030489 | Ga0316592_10304892 | 142 |
| 280 | 3300033524 | Ga0316592_1044759 | Ga0316592_10447592 | 142 |
| 281 | 3300033527 | Ga0316586_1019127 | Ga0316586_10191272 | 142 |
| 282 | 3300033541 | Ga0316596_1022081 | Ga0316596_10220812 | 142 |
| 283 | 3300033541 | Ga0316596_1023413 | Ga0316596_10234132 | 142 |
| 284 | 3300035089 | Ga0373944_0319052 | Ga0373944_0319052_70_498 | 142 |
| 285 | 3300035113 | Ga0373936_0239996 | Ga0373936_0239996_83_511 | 142 |
| 286 | 3300035170 | Ga0373943_0186266 | Ga0373943_0186266_690_1118 | 142 |
| 287 | 3300035207 | Ga0373942_0048118 | Ga0373942_0048118_722_1150 | 142 |
| 288 | 3300035242 | Ga0373962_0077555 | Ga0373962_0077555_365_793 | 142 |
| 289 | 3300035398 | Ga0316574_0161772 | Ga0316574_0161772_287_715 | 142 |
| 290 | 3300035691 | Ga0373931_0025385 | Ga0373931_0025385_1028_1456 | 142 |
| 291 | 3300035691 | Ga0373931_0322345 | Ga0373931_0322345_347_775 | 142 |
| 292 | 3300035692 | Ga0373935_0799781 | Ga0373935_0799781_104_586 | 142 |
| 293 | 3300035695 | Ga0373927_0099710 | Ga0373927_0099710_1321_1749 | 142 |
| 294 | 3300035725 | Ga0373947_0214911 | Ga0373947_0214911_820_1248 | 142 |
| 295 | 3300035725 | Ga0373947_0357258 | Ga0373947_0357258_260_688 | 142 |
| 296 | 3300036401 | Ga0373937_0559533 | Ga0373937_0559533_514_942 | 142 |
| 297 | 3300037068 | Ga0373925_0042262 | Ga0373925_0042262_1654_2082 | 142 |
| 298 | 3300037418 | Ga0395900_0099978 | Ga0395900_0099978_506_940 | 142 |
| 299 | 3300037418 | Ga0395900_0147341 | Ga0395900_0147341_1068_1574 | 142 |
| 300 | 3300041454 | Ga0451799_25283 | Ga0451799_25283_162_593 | 142 |
| 301 | 3300041455 | Ga0451801_24466 | Ga0451801_24466_157_588 | 142 |
| 302 | 3300041459 | Ga0451800_0994459 | Ga0451800_0994459_362_793 | 142 |
| 303 | 3300041460 | Ga0451802_0291917 | Ga0451802_0291917_363_794 | 142 |
| 304 | 3300041486 | Ga0451807_0525531 | Ga0451807_0525531_636_1067 | 142 |
| 305 | 3300041512 | Ga0451853_0792599 | Ga0451853_0792599_300_734 | 142 |
| 306 | 3300041512 | Ga0451853_1658291 | Ga0451853_1658291_199_627 | 142 |
| 307 | 3300041916 | Ga0452271_89865 | Ga0452271_89865_87_515 | 142 |
| 308 | 3300041997 | Ga0439431_0018450 | Ga0439431_0018450_299_727 | 142 |
| 309 | 3300041999 | Ga0439433_0043226 | Ga0439433_0043226_347_775 | 142 |
| 310 | 3300042001 | Ga0439441_153441 | Ga0439441_153441_62_490 | 142 |
| 311 | 3300042004 | Ga0439445_0034773 | Ga0439445_0034773_626_1054 | 142 |
| 312 | 3300042115 | Ga0450911_039720 | Ga0450911_039720_15_443 | 142 |
| 313 | 3300042116 | Ga0450912_021555 | Ga0450912_021555_49_477 | 142 |
| 314 | 3300042122 | Ga0450920_028278 | Ga0450920_028278_27_455 | 142 |
| 315 | 3300042125 | Ga0450923_014290 | Ga0450923_014290_549_983 | 142 |
| 316 | 3300042128 | Ga0450897_013403 | Ga0450897_013403_355_786 | 142 |
| 317 | 3300042134 | Ga0450898_007714 | Ga0450898_007714_1231_1659 | 142 |
| 318 | 3300042156 | Ga0439446_0012703 | Ga0439446_0012703_765_1193 | 142 |
| 319 | 3300042184 | Ga0450908_003391 | Ga0450908_003391_2128_2556 | 142 |
| 320 | 3300042435 | Ga0439434_0007600 | Ga0439434_0007600_644_1072 | 142 |
| 321 | 3300042436 | Ga0439435_0001708 | Ga0439435_0001708_1752_2180 | 142 |
| 322 | 3300042437 | Ga0439444_0000230 | Ga0439444_0000230_2054_2482 | 142 |
| 323 | 3300042461 | Ga0439460_0030496 | Ga0439460_0030496_682_1110 | 142 |
| 324 | 3300042531 | Ga0450918_058364 | Ga0450918_058364_260_691 | 142 |
| 325 | 3300042876 | Ga0451577_0005175 | Ga0451577_0005175_1139_1567 | 142 |
| 326 | 3300042876 | Ga0451577_0014500 | Ga0451577_0014500_4699_5127 | 142 |
| 327 | 3300042876 | Ga0451577_0061424 | Ga0451577_0061424_300_728 | 142 |
| 328 | 3300042876 | Ga0451577_0083955 | Ga0451577_0083955_600_1028 | 142 |
| 329 | 3300042876 | Ga0451577_0089369 | Ga0451577_0089369_2161_2589 | 142 |
| 330 | 3300042876 | Ga0451577_0212094 | Ga0451577_0212094_1237_1665 | 142 |
| 331 | 3300042876 | Ga0451577_0350159 | Ga0451577_0350159_89_517 | 142 |
| 332 | 3300042876 | Ga0451577_0611985 | Ga0451577_0611985_39_467 | 142 |
| 333 | 3300042876 | Ga0451577_1731530 | Ga0451577_1731530_32_460 | 142 |
| 334 | 3300044673 | Ga0453683_0042531 | Ga0453683_0042531_2204_2632 | 142 |
| 335 | 3300044673 | Ga0453683_0147490 | Ga0453683_0147490_987_1415 | 142 |
| 336 | 3300044673 | Ga0453683_0179591 | Ga0453683_0179591_463_891 | 142 |
| 337 | 3300044684 | Ga0466966_0019613 | Ga0466966_0019613_838_1266 | 142 |
| 338 | 3300044712 | Ga0453684_0000065 | Ga0453684_0000065_286314_286793 | 142 |
| 339 | 3300044712 | Ga0453684_0000369 | Ga0453684_0000369_121992_122420 | 142 |
| 340 | 3300044712 | Ga0453684_0000677 | Ga0453684_0000677_7821_8249 | 142 |
| 341 | 3300044712 | Ga0453684_0001529 | Ga0453684_0001529_59512_59940 | 142 |
| 342 | 3300044712 | Ga0453684_0036305 | Ga0453684_0036305_1445_1876 | 142 |
| 343 | 3300044712 | Ga0453684_0057201 | Ga0453684_0057201_879_1307 | 142 |
| 344 | 3300044712 | Ga0453684_0105896 | Ga0453684_0105896_1703_2131 | 142 |
| 345 | 3300044712 | Ga0453684_0196609 | Ga0453684_0196609_1417_1845 | 142 |
| 346 | 3300044712 | Ga0453684_0282201 | Ga0453684_0282201_846_1274 | 142 |
| 347 | 3300044712 | Ga0453684_0609905 | Ga0453684_0609905_33_461 | 142 |
| 348 | 3300044712 | Ga0453684_1162688 | Ga0453684_1162688_94_522 | 142 |
| 349 | 3300044712 | Ga0453684_1483723 | Ga0453684_1483723_56_484 | 142 |
| 350 | 3300045051 | Ga0451576_0000591 | Ga0451576_0000591_39110_39538 | 142 |
| 351 | 3300045051 | Ga0451576_0001977 | Ga0451576_0001977_18261_18689 | 142 |
| 352 | 3300045051 | Ga0451576_0004578 | Ga0451576_0004578_7348_7776 | 142 |
| 353 | 3300045051 | Ga0451576_0005888 | Ga0451576_0005888_9397_9825 | 142 |
| 354 | 3300045051 | Ga0451576_0006277 | Ga0451576_0006277_12592_13020 | 142 |
| 355 | 3300045051 | Ga0451576_0018556 | Ga0451576_0018556_5446_5874 | 142 |
| 356 | 3300045051 | Ga0451576_0043793 | Ga0451576_0043793_2405_2833 | 142 |
| 357 | 3300045051 | Ga0451576_0078765 | Ga0451576_0078765_1679_2107 | 142 |
| 358 | 3300046471 | Ga0495650_0300434 | Ga0495650_0300434_93_524 | 142 |
| 359 | 3300046499 | Ga0495594_0483270 | Ga0495594_0483270_40_468 | 142 |
| 360 | 3300046522 | Ga0495643_0298253 | Ga0495643_0298253_47_493 | 142 |
| 361 | 3300046522 | Ga0495643_0404288 | Ga0495643_0404288_48_494 | 142 |
| 362 | 3300046539 | Ga0495621_0010478 | Ga0495621_0010478_43_471 | 142 |
| 363 | 3300046683 | Ga0495658_0186801 | Ga0495658_0186801_670_1098 | 142 |
| 364 | 3300046683 | Ga0495658_0316455 | Ga0495658_0316455_108_536 | 142 |
| 365 | 3300048903 | Ga0496100_0224265 | Ga0496100_0224265_891_1325 | 142 |
| 366 | 3300048903 | Ga0496100_0418984 | Ga0496100_0418984_474_902 | 142 |
| 367 | 3300048904 | Ga0496101_0009965 | Ga0496101_0009965_5320_5748 | 142 |
| 368 | 3300048905 | Ga0496102_1808148 | Ga0496102_1808148_55_489 | 142 |
| 369 | 3300048907 | Ga0496104_0216430 | Ga0496104_0216430_772_1200 | 142 |
| 370 | 3300048907 | Ga0496104_0689804 | Ga0496104_0689804_308_742 | 142 |
| 371 | 3300048908 | Ga0496105_0072507 | Ga0496105_0072507_99_527 | 142 |
| 372 | 3300048909 | Ga0496106_0081126 | Ga0496106_0081126_57_491 | 142 |
| 373 | 3300048911 | Ga0496108_0028099 | Ga0496108_0028099_2348_2818 | 142 |
| 374 | 3300048911 | Ga0496108_0228880 | Ga0496108_0228880_936_1370 | 142 |
| 375 | 3300048911 | Ga0496108_0233949 | Ga0496108_0233949_912_1346 | 142 |
| 376 | 3300048911 | Ga0496108_0452420 | Ga0496108_0452420_337_846 | 142 |
| 377 | 3300048912 | Ga0496109_0250738 | Ga0496109_0250738_22_456 | 142 |
| 378 | 3300048912 | Ga0496109_0319499 | Ga0496109_0319499_654_1082 | 142 |
| 379 | 3300048913 | Ga0496110_0041351 | Ga0496110_0041351_1152_1622 | 142 |
| 380 | 3300048913 | Ga0496110_0166178 | Ga0496110_0166178_1128_1562 | 142 |
| 381 | 3300048914 | Ga0496111_0248218 | Ga0496111_0248218_359_787 | 142 |
| 382 | 3300048915 | Ga0496112_0195495 | Ga0496112_0195495_815_1243 | 142 |
| 383 | 3300048917 | Ga0496114_0030275 | Ga0496114_0030275_3826_4260 | 142 |
| 384 | 3300048917 | Ga0496114_0038591 | Ga0496114_0038591_2712_3182 | 142 |
| 385 | 3300048918 | Ga0496115_0367626 | Ga0496115_0367626_675_1145 | 142 |
| 386 | 3300048918 | Ga0496115_0512850 | Ga0496115_0512850_473_907 | 142 |
| 387 | 3300048924 | Ga0496121_0034283 | Ga0496121_0034283_3255_3683 | 142 |
| 388 | 3300048926 | Ga0496123_0107876 | Ga0496123_0107876_429_857 | 142 |
| 389 | 3300049127 | Ga0501306_069591 | Ga0501306_069591_89_517 | 142 |
| 390 | 3300049129 | Ga0501309_028468 | Ga0501309_028468_317_745 | 142 |
| 391 | 3300049130 | Ga0501310_027262 | Ga0501310_027262_17_445 | 142 |
| 392 | 3300049130 | Ga0501310_045033 | Ga0501310_045033_181_609 | 142 |
| 393 | 3300049161 | Ga0501305_104034 | Ga0501305_104034_20_448 | 142 |
| 394 | 3300049514 | Ga0501291_006509 | Ga0501291_006509_581_1012 | 142 |
| 395 | 3300049518 | Ga0501295_096023 | Ga0501295_096023_28_459 | 142 |
| 396 | 3300049521 | Ga0501298_017541 | Ga0501298_017541_174_602 | 142 |
| 397 | 3300049527 | Ga0501311_019808 | Ga0501311_019808_82_510 | 142 |
| 398 | 3300049528 | Ga0501312_019963 | Ga0501312_019963_548_976 | 142 |
| 399 | 3300049529 | Ga0501313_046148 | Ga0501313_046148_56_484 | 142 |
| 400 | 3300049531 | Ga0501315_033004 | Ga0501315_033004_116_544 | 142 |
| 401 | 3300049531 | Ga0501315_077742 | Ga0501315_077742_30_458 | 142 |
| 402 | 3300049534 | Ga0501318_077824 | Ga0501318_077824_63_491 | 142 |
| 403 | 3300049534 | Ga0501318_089927 | Ga0501318_089927_63_491 | 142 |
| 404 | 3300049536 | Ga0501320_062401 | Ga0501320_062401_72_500 | 142 |
| 405 | 3300049550 | Ga0501334_03422 | Ga0501334_03422_332_760 | 142 |
| 406 | 3300049551 | Ga0501335_008229 | Ga0501335_008229_173_601 | 142 |
| 407 | 3300049551 | Ga0501335_041691 | Ga0501335_041691_50_478 | 142 |
| 408 | 3300049568 | Ga0501031_0006233 | Ga0501031_0006233_2349_2783 | 142 |
| 409 | 3300049568 | Ga0501031_0009246 | Ga0501031_0009246_1782_2216 | 142 |
| 410 | 3300049569 | Ga0501032_0037608 | Ga0501032_0037608_1073_1507 | 142 |
| 411 | 3300049569 | Ga0501032_0051359 | Ga0501032_0051359_2075_2509 | 142 |
| 412 | 3300049569 | Ga0501032_0195800 | Ga0501032_0195800_566_997 | 142 |
| 413 | 3300049570 | Ga0501033_0000709 | Ga0501033_0000709_5974_6408 | 142 |
| 414 | 3300049570 | Ga0501033_0001808 | Ga0501033_0001808_5941_6375 | 142 |
| 415 | 3300049570 | Ga0501033_0004879 | Ga0501033_0004879_9625_10053 | 142 |
| 416 | 3300049570 | Ga0501033_0016892 | Ga0501033_0016892_3051_3485 | 142 |
| 417 | 3300049570 | Ga0501033_0181983 | Ga0501033_0181983_363_791 | 142 |
| 418 | 3300049571 | Ga0501034_0008103 | Ga0501034_0008103_2477_2911 | 142 |
| 419 | 3300049571 | Ga0501034_0720819 | Ga0501034_0720819_210_644 | 142 |
| 420 | 3300049572 | Ga0501036_0000268 | Ga0501036_0000268_15251_15685 | 142 |
| 421 | 3300049572 | Ga0501036_0001606 | Ga0501036_0001606_2798_3232 | 142 |
| 422 | 3300049572 | Ga0501036_0150134 | Ga0501036_0150134_1102_1533 | 142 |
| 423 | 3300049572 | Ga0501036_0396489 | Ga0501036_0396489_196_681 | 142 |
| 424 | 3300049573 | Ga0501037_0005074 | Ga0501037_0005074_9047_9481 | 142 |
| 425 | 3300049573 | Ga0501037_0141246 | Ga0501037_0141246_277_711 | 142 |
| 426 | 3300049574 | Ga0501038_0000280 | Ga0501038_0000280_5033_5467 | 142 |
| 427 | 3300049574 | Ga0501038_0004118 | Ga0501038_0004118_12248_12682 | 142 |
| 428 | 3300049574 | Ga0501038_0019910 | Ga0501038_0019910_5427_5861 | 142 |
| 429 | 3300049574 | Ga0501038_0047069 | Ga0501038_0047069_939_1373 | 142 |
| 430 | 3300049574 | Ga0501038_0055621 | Ga0501038_0055621_387_818 | 142 |
| 431 | 3300049574 | Ga0501038_0128257 | Ga0501038_0128257_847_1281 | 142 |
| 432 | 3300049574 | Ga0501038_0210873 | Ga0501038_0210873_32_460 | 142 |
| 433 | 3300049575 | Ga0501039_0053362 | Ga0501039_0053362_2317_2748 | 142 |
| 434 | 3300049575 | Ga0501039_0085668 | Ga0501039_0085668_926_1360 | 142 |
| 435 | 3300049575 | Ga0501039_0099282 | Ga0501039_0099282_1268_1696 | 142 |
| 436 | 3300049575 | Ga0501039_0101811 | Ga0501039_0101811_1493_1921 | 142 |
| 437 | 3300049575 | Ga0501039_0121166 | Ga0501039_0121166_1557_1985 | 142 |
| 438 | 3300049575 | Ga0501039_0218695 | Ga0501039_0218695_501_935 | 142 |
| 439 | 3300049575 | Ga0501039_0470201 | Ga0501039_0470201_468_899 | 142 |
| 440 | 3300049575 | Ga0501039_0803598 | Ga0501039_0803598_60_494 | 142 |
| 441 | 3300049576 | Ga0501040_0001121 | Ga0501040_0001121_11664_12098 | 142 |
| 442 | 3300049576 | Ga0501040_0006758 | Ga0501040_0006758_5836_6267 | 142 |
| 443 | 3300049577 | Ga0501041_0005255 | Ga0501041_0005255_5703_6131 | 142 |
| 444 | 3300049577 | Ga0501041_0024260 | Ga0501041_0024260_871_1302 | 142 |
| 445 | 3300049578 | Ga0501042_0008786 | Ga0501042_0008786_731_1165 | 142 |
| 446 | 3300049578 | Ga0501042_0010832 | Ga0501042_0010832_273_701 | 142 |
| 447 | 3300049578 | Ga0501042_0046606 | Ga0501042_0046606_2248_2679 | 142 |
| 448 | 3300049578 | Ga0501042_0524759 | Ga0501042_0524759_419_847 | 142 |
| 449 | 3300049579 | Ga0501043_0001507 | Ga0501043_0001507_13888_14322 | 142 |
| 450 | 3300049579 | Ga0501043_0003838 | Ga0501043_0003838_4984_5418 | 142 |
| 451 | 3300049579 | Ga0501043_0696590 | Ga0501043_0696590_276_707 | 142 |
| 452 | 3300049580 | Ga0501046_0008472 | Ga0501046_0008472_6938_7372 | 142 |
| 453 | 3300049580 | Ga0501046_0011739 | Ga0501046_0011739_6441_6875 | 142 |
| 454 | 3300049580 | Ga0501046_0017699 | Ga0501046_0017699_1918_2349 | 142 |
| 455 | 3300049581 | Ga0501047_0002525 | Ga0501047_0002525_6938_7372 | 142 |
| 456 | 3300049581 | Ga0501047_0014502 | Ga0501047_0014502_608_1036 | 142 |
| 457 | 3300049581 | Ga0501047_0285563 | Ga0501047_0285563_511_945 | 142 |
| 458 | 3300049582 | Ga0501048_0006099 | Ga0501048_0006099_1810_2244 | 142 |
| 459 | 3300049582 | Ga0501048_0044068 | Ga0501048_0044068_457_888 | 142 |
| 460 | 3300049582 | Ga0501048_0449558 | Ga0501048_0449558_100_528 | 142 |
| 461 | 3300049584 | Ga0501068_0013549 | Ga0501068_0013549_3049_3483 | 142 |
| 462 | 3300049584 | Ga0501068_0186570 | Ga0501068_0186570_843_1274 | 142 |
| 463 | 3300049584 | Ga0501068_0336098 | Ga0501068_0336098_531_959 | 142 |
| 464 | 3300049586 | Ga0501070_0435474 | Ga0501070_0435474_113_547 | 142 |
| 465 | 3300049587 | Ga0501071_0008818 | Ga0501071_0008818_5452_5883 | 142 |
| 466 | 3300049587 | Ga0501071_0028837 | Ga0501071_0028837_126_554 | 142 |
| 467 | 3300049587 | Ga0501071_0954416 | Ga0501071_0954416_172_600 | 142 |
| 468 | 3300049588 | Ga0501072_0010795 | Ga0501072_0010795_4267_4698 | 142 |
| 469 | 3300049588 | Ga0501072_0154060 | Ga0501072_0154060_1390_1818 | 142 |
| 470 | 3300049590 | Ga0501074_0071699 | Ga0501074_0071699_224_655 | 142 |
| 471 | 3300049591 | Ga0501075_0003774 | Ga0501075_0003774_1459_1887 | 142 |
| 472 | 3300049591 | Ga0501075_0012522 | Ga0501075_0012522_1262_1693 | 142 |
| 473 | 3300049592 | Ga0501076_0053539 | Ga0501076_0053539_814_1245 | 142 |
| 474 | 3300049593 | Ga0501077_0068019 | Ga0501077_0068019_82_516 | 142 |
| 475 | 3300049593 | Ga0501077_0088085 | Ga0501077_0088085_1443_1874 | 142 |
| 476 | 3300049593 | Ga0501077_0225113 | Ga0501077_0225113_622_1056 | 142 |
| 477 | 3300049660 | Ga0501216_036781 | Ga0501216_036781_60_491 | 142 |
| 478 | 3300049688 | Ga0501259_051721 | Ga0501259_051721_337_768 | 142 |
| 479 | 3300049741 | Ga0501079_0016926 | Ga0501079_0016926_1356_1787 | 142 |
| 480 | 3300049741 | Ga0501079_0499757 | Ga0501079_0499757_227_655 | 142 |
| 481 | 3300049742 | Ga0501080_0018074 | Ga0501080_0018074_3554_3985 | 142 |
| 482 | 3300049742 | Ga0501080_0059040 | Ga0501080_0059040_2841_3269 | 142 |
| 483 | 3300049743 | Ga0501081_0066788 | Ga0501081_0066788_32_460 | 142 |
| 484 | 3300049743 | Ga0501081_0349070 | Ga0501081_0349070_451_885 | 142 |
| 485 | 3300049743 | Ga0501081_0843546 | Ga0501081_0843546_81_512 | 142 |
| 486 | 3300049776 | Ga0501280_000535 | Ga0501280_000535_1549_1977 | 142 |
| 487 | 3300049779 | Ga0501283_013662 | Ga0501283_013662_137_568 | 142 |
| 488 | 3300049822 | Ga0501035_0000270 | Ga0501035_0000270_24540_24974 | 142 |
| 489 | 3300049822 | Ga0501035_0004552 | Ga0501035_0004552_321_755 | 142 |
| 490 | 3300049822 | Ga0501035_0007685 | Ga0501035_0007685_1714_2148 | 142 |
| 491 | 3300049822 | Ga0501035_0058038 | Ga0501035_0058038_498_929 | 142 |
| 492 | 3300049822 | Ga0501035_0111503 | Ga0501035_0111503_1782_2216 | 142 |
| 493 | 3300049822 | Ga0501035_0194175 | Ga0501035_0194175_917_1402 | 142 |
| 494 | 3300049822 | Ga0501035_0246420 | Ga0501035_0246420_607_1035 | 142 |
| 495 | 3300049822 | Ga0501035_0596576 | Ga0501035_0596576_330_764 | 142 |
| 496 | 3300049823 | Ga0501044_0000261 | Ga0501044_0000261_33373_33807 | 142 |
| 497 | 3300049823 | Ga0501044_0000482 | Ga0501044_0000482_36781_37215 | 142 |
| 498 | 3300049823 | Ga0501044_0004065 | Ga0501044_0004065_11922_12356 | 142 |
| 499 | 3300049823 | Ga0501044_0006513 | Ga0501044_0006513_11878_12306 | 142 |
| 500 | 3300049823 | Ga0501044_0075275 | Ga0501044_0075275_484_918 | 142 |
| 501 | 3300049823 | Ga0501044_0189624 | Ga0501044_0189624_276_710 | 142 |
| 502 | 3300049823 | Ga0501044_0860556 | Ga0501044_0860556_213_641 | 142 |
| 503 | 3300049823 | Ga0501044_1216511 | Ga0501044_1216511_62_496 | 142 |
| 504 | 3300049824 | Ga0501045_0000564 | Ga0501045_0000564_9883_10317 | 142 |
| 505 | 3300049824 | Ga0501045_0009535 | Ga0501045_0009535_2109_2540 | 142 |
| 506 | 3300050489 | nmdc:mga03683_90095_c1 | nmdc:mga03683_90095_c1_860_1288 | 142 |
| 507 | 3300050490 | nmdc:mga03n38_196310_c1 | nmdc:mga03n38_196310_c1_411_842 | 142 |
| 508 | 3300050491 | nmdc:mga00v17_215529_c1 | nmdc:mga00v17_215529_c1_503_937 | 142 |
| 509 | 3300050491 | nmdc:mga00v17_445188_c1 | nmdc:mga00v17_445188_c1_182_610 | 142 |
| 510 | 3300050493 | nmdc:mga0k408_149591_c1 | nmdc:mga0k408_149591_c1_150_578 | 142 |
| 511 | 3300050493 | nmdc:mga0k408_74404_c1 | nmdc:mga0k408_74404_c1_188_622 | 142 |
| 512 | 3300050493 | nmdc:mga0k408_8866_c1 | nmdc:mga0k408_8866_c1_355_783 | 142 |
| 513 | 3300050494 | nmdc:mga06z11_129572_c1 | nmdc:mga06z11_129572_c1_636_1070 | 142 |
| 514 | 3300050495 | nmdc:mga04h51_245422_c1 | nmdc:mga04h51_245422_c1_18_452 | 142 |
| 515 | 3300050511 | nmdc:mga08y16_326210_c1 | nmdc:mga08y16_326210_c1_312_782 | 142 |
| 516 | 3300050511 | nmdc:mga08y16_409233_c1 | nmdc:mga08y16_409233_c1_440_886 | 142 |
| 517 | 3300050513 | nmdc:mga0rr50_640801_c1 | nmdc:mga0rr50_640801_c1_233_664 | 142 |
| 518 | 3300050516 | nmdc:mga0sz30_67780_c1 | nmdc:mga0sz30_67780_c1_464_898 | 142 |
| 519 | 3300053137 | Ga0500561_0280024 | Ga0500561_0280024_31_462 | 142 |
| 520 | 3300054114 | Ga0501084_0006071 | Ga0501084_0006071_7888_8316 | 142 |
| 521 | 3300054114 | Ga0501084_0010488 | Ga0501084_0010488_4940_5371 | 142 |
| 522 | 3300059477 | Ga0587084_097626 | Ga0587084_097626_128_556 | 142 |
| 523 | 3300059512 | Ga0587092_132618 | Ga0587092_132618_22_450 | 142 |
| 524 | 3300059645 | Ga0587076_032864 | Ga0587076_032864_346_774 | 142 |
| 525 | 3300059646 | Ga0587078_033317 | Ga0587078_033317_29_457 | 142 |
| 526 | 3300059659 | Ga0587120_004814 | Ga0587120_004814_316_744 | 142 |
| 527 | 3300060353 | Ga0501082_0007272 | Ga0501082_0007272_5745_6176 | 142 |
| 528 | 3300060353 | Ga0501082_0045379 | Ga0501082_0045379_510_938 | 142 |
| 529 | 3300061734 | Ga0530510_0002778 | Ga0530510_0002778_9224_9655 | 142 |
| 530 | 3300061734 | Ga0530510_0033060 | Ga0530510_0033060_1886_2314 | 142 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6spb-assembly1.cif.gz_J | pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 | 0.9788 | 2 | 142 |
| 6ysi-assembly1.cif.gz_F | acinetobacter baumannii ribosome-tigecycline complex - 50s subunit | 0.9764 | 1 | 142 |
| 5xym-assembly1.cif.gz_J | large subunit of mycobacterium smegmatis | 0.974 | 3 | 142 |
| 6spb-assembly1.cif.gz_J | pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 | 0.972 | 2 | 142 |
| 7mt7-assembly1.cif.gz_J | mtb 70s with p and e site trnas | 0.9709 | 3 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4dhcN00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9627 | 1 | 142 | 3.90.1180.10 |
| af_Q4CZX3_36_177_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9614 | 10 | 140 | 3.90.1180.10 |
| 4dhcN00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.956 | 1 | 142 | 3.90.1180.10 |
| af_A0A0R0E7H3_25_163_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9524 | 12 | 142 | 3.90.1180.10 |
| af_C6SWN9_25_183_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9516 | 12 | 142 | 3.90.1180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2V084-F1-model_v4 | 50S ribosomal protein L13 | 0.9928 | 15 | 142 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A1I8ACL4-F1-model_v4 | Semialdhyde_dh domain-containing protein | 0.9916 | 1 | 127 |
GO:0003735
GO:0003942 GO:0005840 GO:0006412 GO:0006526 GO:0051287 GO:0070401 GO:1990904 |
| AF-A0A357TH06-F1-model_v4 | 50S ribosomal protein L13 | 0.9915 | 13 | 142 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A5E4W4W0-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9913 | 1 | 142 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A7K1DJB2-F1-model_v4 | 50S ribosomal protein L13 | 0.9913 | 15 | 142 |
GO:0003729
GO:0003735 GO:0005737 GO:0005840 GO:0006412 GO:0017148 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar