F459911

General Info

Members Datasets Scaffolds Average Seq Length
530 330 493 144

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100222915|Ga0070682_1002229152
Length 169
Sequence MAFILTNAATCHRISGFTEIAGVGFVKTFSAKPHEVSHDWFVVDAADKVLGRLAAEIAYRLRGKHKPIYTPHVDTGDYIVVINVDKLRVTGNKAENKRYYRHSGYPGGIYETTFTKMHARFPGRPLEKAVKGMLPKGPLGYAMLKKLKVYAGAAHPHAAQQPRQLEVRA

Samples

Sample ID Description Type Environment
1 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
2 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
3 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
4 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
5 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
6 2547132512 Azospira oryzae 6a3 Isolate Unclassified
7 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
8 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
9 2643221572 Leifsonia sp. Root60 Isolate Unclassified
10 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
11 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
12 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
13 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
14 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
15 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
16 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
17 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
18 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
19 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
20 2818991450 Burkholderia sp. 604 Isolate Unclassified
21 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
22 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
23 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
24 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
25 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
26 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
27 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
28 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
29 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
30 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
31 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
32 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
33 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
34 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
35 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
36 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
37 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
38 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
39 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
40 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
41 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
42 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
43 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
47 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
48 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
49 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
59 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
60 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
69 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
123 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
173 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
176 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
179 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
180 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
183 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
193 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
197 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
200 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
201 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300041454 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT Metatranscriptome Rhizoplane
211 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
212 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
213 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
214 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
215 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
216 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
217 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
218 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
219 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
220 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
221 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
222 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
223 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
224 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
225 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
226 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
227 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
228 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
229 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
230 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
231 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
232 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
233 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
234 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
235 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
236 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
237 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
238 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
239 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
240 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
241 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
242 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
243 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
258 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
259 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
260 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
265 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
266 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
267 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
291 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
294 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
295 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
296 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
297 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
298 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
299 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
300 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
301 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
302 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
303 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
304 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
305 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
306 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
309 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
310 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
311 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
312 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
313 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
314 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
315 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
316 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
317 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
318 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
319 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
320 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
326 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
327 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
328 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
329 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
330 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.6
Metatranscriptomes 6.42
Isolates 6.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.91
Nodule 1.89
Rhizoplane 5.09
Rhizosphere 81.7
Stem 0
Stem Tuber 0
Unclassified 6.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1048266 3300001904 Bacteria 655
2 Ga0006759J45824_1005431 3300003163 Bacteria 2500
3 rootH2_10010659 3300003320 Bacteria 1114
4 rootH1_10007780 3300003323 Bacteria 5607
5 Ga0007427J51700_123299 3300003559 Bacteria 627
6 Ga0007409J51694_1049228 3300003575 Bacteria 688
7 Ga0007429J51699_1049887 3300003579 Bacteria 722
8 Ga0058860_10580578 3300004801 Bacteria 770
9 Ga0065704_10553282 3300005289 Bacteria 633
10 Ga0065712_10271024 3300005290 Bacteria 916
11 Ga0065712_10576999 3300005290 Bacteria 603
12 Ga0065712_10620510 3300005290 Bacteria 581
13 Ga0070658_10188547 3300005327 Bacteria 1738
14 Ga0070658_10266221 3300005327 Bacteria 1456
15 Ga0070658_10776939 3300005327 Bacteria 832
16 Ga0070683_100091001 3300005329 Bacteria 2864
17 Ga0070690_100505707 3300005330 Bacteria 905
18 Ga0070677_10187745 3300005333 Bacteria 989
19 Ga0070680_100790945 3300005336 Bacteria 817
20 Ga0070682_100222915 3300005337 Bacteria 1343
21 Ga0068868_100025744 3300005338 Bacteria 4478
22 Ga0068868_100188507 3300005338 Bacteria 1714
23 Ga0068868_100315019 3300005338 Bacteria 1332
24 Ga0070660_100031943 3300005339 Bacteria 3959
25 Ga0070660_100281947 3300005339 Bacteria 1360
26 Ga0070660_100607076 3300005339 Bacteria 915
27 Ga0070689_100091715 3300005340 Bacteria 2395
28 Ga0070661_100098154 3300005344 Bacteria 2176
29 Ga0070675_100019434 3300005354 Bacteria 5415
30 Ga0070671_100049003 3300005355 Bacteria 3514
31 Ga0070673_100065827 3300005364 Bacteria 2892
32 Ga0070659_100077804 3300005366 Bacteria 2646
33 Ga0070659_100988714 3300005366 Unclassified 738
34 Ga0070714_100104368 3300005435 Bacteria 2501
35 Ga0070714_100256237 3300005435 Bacteria 1619
36 Ga0070710_10822712 3300005437 Bacteria 665
37 Ga0070701_10172724 3300005438 Bacteria 1260
38 Ga0070700_101717950 3300005441 Bacteria 539
39 Ga0070663_100124576 3300005455 Bacteria 1950
40 Ga0070663_100264673 3300005455 Unclassified 1365
41 Ga0070663_100542070 3300005455 Bacteria 971
42 Ga0070678_100094789 3300005456 Bacteria 2298
43 Ga0070662_100974577 3300005457 Bacteria 725
44 Ga0070662_101099244 3300005457 Bacteria 682
45 Ga0070681_10019167 3300005458 Bacteria 6847
46 Ga0070681_10422911 3300005458 Bacteria 1244
47 Ga0068867_100100840 3300005459 Bacteria 2205
48 Ga0070685_10492864 3300005466 Bacteria 866
49 Ga0070685_11426697 3300005466 Bacteria 532
50 Ga0070707_101197140 3300005468 Bacteria 726
51 Ga0070698_100576695 3300005471 Bacteria 1065
52 Ga0070679_100221040 3300005530 Bacteria 1855
53 Ga0070679_101911744 3300005530 Bacteria 542
54 Ga0070684_100040791 3300005535 Bacteria 3999
55 Ga0070684_100214510 3300005535 Bacteria 1755
56 Ga0070697_100055150 3300005536 Bacteria 3231
57 Ga0068853_100189267 3300005539 Bacteria 1869
58 Ga0070672_100034137 3300005543 Bacteria 3859
59 Ga0070696_100426396 3300005546 Bacteria 1042
60 Ga0070665_100719023 3300005548 Bacteria 1012
61 Ga0070704_100169456 3300005549 Bacteria 1735
62 Ga0070704_101292714 3300005549 Bacteria 667
63 Ga0070704_101684661 3300005549 Bacteria 586
64 Ga0070664_100024396 3300005564 Bacteria 5001
65 Ga0068854_100647553 3300005578 Bacteria 907
66 Ga0068856_100108775 3300005614 Bacteria 2768
67 Ga0068852_100001759 3300005616 Bacteria 14743
68 Ga0068852_100021983 3300005616 Bacteria 5105
69 Ga0068859_100061235 3300005617 Bacteria 3792
70 Ga0068864_100147719 3300005618 Bacteria 2126
71 Ga0068864_100433075 3300005618 Bacteria 1255
72 Ga0068866_10271242 3300005718 Bacteria 1047
73 Ga0068851_10009817 3300005834 Bacteria 4458
74 Ga0068851_10030814 3300005834 Bacteria 2662
75 Ga0068863_100966204 3300005841 Bacteria 854
76 Ga0068858_100186764 3300005842 Bacteria 1958
77 Ga0068860_101520606 3300005843 Bacteria 691
78 Ga0075368_10322754 3300006042 Bacteria 669
79 Ga0075363_100152546 3300006048 Bacteria 1305
80 Ga0075364_10118324 3300006051 Bacteria 1772
81 Ga0075364_10494932 3300006051 Bacteria 836
82 Ga0070715_10360257 3300006163 Bacteria 797
83 Ga0070716_100163095 3300006173 Bacteria 1446
84 Ga0070712_101064899 3300006175 Bacteria 701
85 Ga0070712_101067080 3300006175 Bacteria 700
86 Ga0075362_10015321 3300006177 Bacteria 3116
87 Ga0075362_10054872 3300006177 Bacteria 1792
88 Ga0075367_10164091 3300006178 Bacteria 1382
89 Ga0075369_10013586 3300006186 Bacteria 3236
90 Ga0075366_10001852 3300006195 Bacteria 10665
91 Ga0075366_10031402 3300006195 Bacteria 3125
92 Ga0075366_10071725 3300006195 Bacteria 2063
93 Ga0075366_10954697 3300006195 Bacteria 534
94 Ga0097621_100030798 3300006237 Bacteria 4251
95 Ga0097621_100048009 3300006237 Bacteria 3461
96 Ga0068871_100019547 3300006358 Bacteria 5174
97 Ga0068871_100049509 3300006358 Bacteria 3396
98 Ga0075428_101221409 3300006844 Bacteria 792
99 Ga0068865_102020607 3300006881 Bacteria 523
100 Ga0097620_100061233 3300006931 Bacteria 3792
101 Ga0105240_11163136 3300009093 Bacteria 818
102 Ga0111539_10060204 3300009094 Bacteria 4500
103 Ga0111539_10390106 3300009094 Bacteria 1621
104 Ga0111539_10587431 3300009094 Bacteria 1297
105 Ga0111539_10606705 3300009094 Bacteria 1275
106 Ga0111539_11894233 3300009094 Unclassified 691
107 Ga0105245_10754849 3300009098 Bacteria 1009
108 Ga0105247_10745125 3300009101 Bacteria 742
109 Ga0105243_10144671 3300009148 Bacteria 2033
110 Ga0105241_10519824 3300009174 Bacteria 1064
111 Ga0105241_11113792 3300009174 Bacteria 744
112 Ga0105242_10472301 3300009176 Unclassified 1187
113 Ga0105248_10184527 3300009177 Bacteria 2351
114 Ga0105248_10470167 3300009177 Bacteria 1417
115 Ga0105249_11421537 3300009553 Bacteria 766
116 Ga0105239_10442194 3300010375 Bacteria 1474
117 Ga0105239_10676179 3300010375 Bacteria 1180
118 Ga0105239_11029141 3300010375 Bacteria 947
119 Ga0157373_10055671 3300013100 Bacteria 2809
120 Ga0157370_10002935 3300013104 Bacteria 20300
121 Ga0157370_10088612 3300013104 Bacteria 2906
122 Ga0157374_10095354 3300013296 Bacteria 2845
123 Ga0157374_10125178 3300013296 Bacteria 2484
124 Ga0157374_10344407 3300013296 Bacteria 1480
125 Ga0157374_10862718 3300013296 Bacteria 922
126 Ga0157378_10238003 3300013297 Bacteria 1738
127 Ga0163162_10316061 3300013306 Bacteria 1694
128 Ga0163162_10487671 3300013306 Bacteria 1364
129 Ga0157375_10432340 3300013308 Bacteria 1482
130 Ga0157375_11287532 3300013308 Bacteria 859
131 Ga0163163_10157561 3300014325 Bacteria 2315
132 Ga0163163_11029657 3300014325 Bacteria 887
133 Ga0157376_10089491 3300014969 Unclassified 2662
134 Ga0157376_10277773 3300014969 Bacteria 1576
135 Ga0182006_1052209 3300015261 Bacteria 1571
136 Ga0209672_100038 3300025228 Bacteria 286731
137 Ga0209147_100235 3300025229 Bacteria 54699
138 Ga0209148_1001389 3300025254 Bacteria 12488
139 Ga0207697_10087497 3300025315 Bacteria 1318
140 Ga0207656_10002235 3300025321 Bacteria 6486
141 Ga0207656_10095578 3300025321 Bacteria 1355
142 Ga0207656_10150232 3300025321 Bacteria 1103
143 Ga0207682_10028984 3300025893 Bacteria 2212
144 Ga0207642_10494421 3300025899 Bacteria 748
145 Ga0207688_10288782 3300025901 Bacteria 1001
146 Ga0207647_10015145 3300025904 Bacteria 5297
147 Ga0207645_10168928 3300025907 Bacteria 1433
148 Ga0207643_10312452 3300025908 Bacteria 980
149 Ga0207705_10089853 3300025909 Bacteria 2248
150 Ga0207684_10168852 3300025910 Bacteria 1886
151 Ga0207654_10378193 3300025911 Bacteria 980
152 Ga0207695_10076578 3300025913 Bacteria 3400
153 Ga0207695_10140700 3300025913 Bacteria 2362
154 Ga0207695_10974789 3300025913 Bacteria 727
155 Ga0207671_10005622 3300025914 Bacteria 11488
156 Ga0207693_10769985 3300025915 Bacteria 743
157 Ga0207660_10969628 3300025917 Bacteria 694
158 Ga0207657_10093367 3300025919 Bacteria 2506
159 Ga0207657_10760595 3300025919 Bacteria 750
160 Ga0207649_10151955 3300025920 Bacteria 1595
161 Ga0207649_10153165 3300025920 Bacteria 1590
162 Ga0207652_10163763 3300025921 Bacteria 1994
163 Ga0207646_10743076 3300025922 Bacteria 876
164 Ga0207650_10017043 3300025925 Bacteria 5084
165 Ga0207659_10535626 3300025926 Bacteria 994
166 Ga0207659_11205512 3300025926 Bacteria 651
167 Ga0207687_10849691 3300025927 Bacteria 780
168 Ga0207687_11283682 3300025927 Bacteria 629
169 Ga0207664_10089886 3300025929 Bacteria 2516
170 Ga0207664_10169003 3300025929 Bacteria 1870
171 Ga0207664_11121405 3300025929 Bacteria 703
172 Ga0207706_10048226 3300025933 Bacteria 3767
173 Ga0207706_10286923 3300025933 Bacteria 1435
174 Ga0207706_10571062 3300025933 Bacteria 973
175 Ga0207670_10069357 3300025936 Bacteria 2432
176 Ga0207670_10217709 3300025936 Bacteria 1460
177 Ga0207669_10142792 3300025937 Bacteria 1665
178 Ga0207665_10134269 3300025939 Bacteria 1759
179 Ga0207691_10033884 3300025940 Bacteria 4754
180 Ga0207711_10845942 3300025941 Bacteria 851
181 Ga0207711_11249716 3300025941 Bacteria 684
182 Ga0207661_10358235 3300025944 Bacteria 1317
183 Ga0207679_10078695 3300025945 Bacteria 2512
184 Ga0207651_10723203 3300025960 Bacteria 878
185 Ga0207640_10111180 3300025981 Bacteria 1942
186 Ga0207640_10941404 3300025981 Bacteria 757
187 Ga0207640_12074558 3300025981 Bacteria 515
188 Ga0207677_10025794 3300026023 Bacteria 3673
189 Ga0207677_10041891 3300026023 Bacteria 3031
190 Ga0207677_11391870 3300026023 Bacteria 646
191 Ga0207703_10154047 3300026035 Bacteria 2007
192 Ga0207639_10525729 3300026041 Bacteria 1084
193 Ga0207678_10655850 3300026067 Bacteria 922
194 Ga0207708_11176110 3300026075 Bacteria 670
195 Ga0207641_10499892 3300026088 Bacteria 1181
196 Ga0207641_10888779 3300026088 Bacteria 884
197 Ga0207648_10068615 3300026089 Bacteria 3089
198 Ga0207648_10514277 3300026089 Bacteria 1096
199 Ga0207676_10147667 3300026095 Bacteria 2021
200 Ga0207675_100203901 3300026118 Bacteria 1900
201 Ga0207683_10000544 3300026121 Bacteria 34864
202 Ga0207698_10004810 3300026142 Bacteria 8271
203 Ga0207698_10070917 3300026142 Bacteria 2763
204 Ga0207698_10577228 3300026142 Bacteria 1106
205 Ga0209970_1006891 3300027614 Bacteria 1865
206 Ga0207428_10011353 3300027907 Bacteria 7877
207 Ga0265318_10020713 3300028577 Bacteria 2650
208 Ga0307517_10131378 3300028786 Bacteria 1801
209 Ga0307515_10108731 3300028794 Bacteria 3264
210 Ga0265332_10000039 3300031238 Bacteria 128373
211 Ga0265320_10019701 3300031240 Bacteria 3680
212 Ga0265320_10135680 3300031240 Bacteria 1117
213 Ga0265325_10108797 3300031241 Bacteria 1349
214 Ga0265331_10005900 3300031250 Bacteria 7326
215 Ga0265331_10092990 3300031250 Bacteria 1393
216 Ga0265331_10271866 3300031250 Bacteria 760
217 Ga0265316_10004209 3300031344 Bacteria 14381
218 Ga0265316_10421225 3300031344 Bacteria 960
219 Ga0307509_10000018 3300031507 Bacteria 258998
220 Ga0307408_100035777 3300031548 Bacteria 3486
221 Ga0307408_100220816 3300031548 Bacteria 1546
222 Ga0265314_10001425 3300031711 Bacteria 26784
223 Ga0265314_10380453 3300031711 Bacteria 768
224 Ga0307516_10001808 3300031730 Bacteria 29384
225 Ga0307405_10031395 3300031731 Bacteria 3127
226 Ga0307413_10010514 3300031824 Bacteria 4494
227 Ga0307406_10265915 3300031901 Bacteria 1300
228 Ga0307407_10085080 3300031903 Bacteria 1923
229 Ga0307412_10001034 3300031911 Bacteria 15897
230 Ga0307412_10598103 3300031911 Bacteria 934
231 Ga0307412_10830723 3300031911 Bacteria 804
232 Ga0307409_100101014 3300031995 Bacteria 2392
233 Ga0307411_10154535 3300032005 Bacteria 1710
234 Ga0307411_10173731 3300032005 Bacteria 1628
235 Ga0307411_10962352 3300032005 Bacteria 762
236 Ga0307411_11108031 3300032005 Bacteria 714
237 Ga0307415_100000825 3300032126 Bacteria 14175
238 Ga0316583_10001814 3300032133 Bacteria 7266
239 Ga0316592_1030489 3300033524 Bacteria 1172
240 Ga0316592_1044759 3300033524 Bacteria 984
241 Ga0316586_1019127 3300033527 Bacteria 1117
242 Ga0316596_1022081 3300033541 Bacteria 1625
243 Ga0316596_1023413 3300033541 Bacteria 1582
244 Ga0373944_0319052 3300035089 Bacteria 586
245 Ga0373936_0239996 3300035113 Bacteria 808
246 Ga0373943_0186266 3300035170 Bacteria 1143
247 Ga0373942_0048118 3300035207 Bacteria 1187
248 Ga0373962_0077555 3300035242 Bacteria 1004
249 Ga0316574_0161772 3300035398 Bacteria 1441
250 Ga0373931_0025385 3300035691 Bacteria 3010
251 Ga0373931_0322345 3300035691 Bacteria 960
252 Ga0373935_0799781 3300035692 Bacteria 696
253 Ga0373927_0099710 3300035695 Bacteria 1889
254 Ga0373947_0214911 3300035725 Bacteria 1262
255 Ga0373947_0357258 3300035725 Bacteria 981
256 Ga0373937_0559533 3300036401 Bacteria 1086
257 Ga0373925_0042262 3300037068 Bacteria 3381
258 Ga0395900_0099978 3300037418 Bacteria 2979
259 Ga0395900_0147341 3300037418 Bacteria 2407
260 Ga0436365_1252022 3300039437 Bacteria 2707
261 Ga0451799_25283 3300041454 Bacteria 824
262 Ga0451801_24466 3300041455 Bacteria 999
263 Ga0451800_0994459 3300041459 Bacteria 1260
264 Ga0451802_0291917 3300041460 Bacteria 1777
265 Ga0451807_0525531 3300041486 Bacteria 3443
266 Ga0451853_0792599 3300041512 Bacteria 1125
267 Ga0451853_1658291 3300041512 Bacteria 1114
268 Ga0452271_89865 3300041916 Bacteria 555
269 Ga0439431_0018450 3300041997 Bacteria 1651
270 Ga0439433_0043226 3300041999 Bacteria 1052
271 Ga0439441_153441 3300042001 Bacteria 543
272 Ga0439445_0034773 3300042004 Bacteria 1322
273 Ga0450911_039720 3300042115 Bacteria 611
274 Ga0450912_021555 3300042116 Bacteria 626
275 Ga0450920_028278 3300042122 Bacteria 1098
276 Ga0450923_014290 3300042125 Bacteria 1472
277 Ga0450897_013403 3300042128 Bacteria 818
278 Ga0450898_007714 3300042134 Bacteria 1681
279 Ga0439446_0012703 3300042156 Bacteria 2302
280 Ga0450908_003391 3300042184 Bacteria 3094
281 Ga0439434_0007600 3300042435 Bacteria 3177
282 Ga0439435_0001708 3300042436 Bacteria 4155
283 Ga0439444_0000230 3300042437 Bacteria 5448
284 Ga0439460_0030496 3300042461 Bacteria 1533
285 Ga0450918_058364 3300042531 Bacteria 710
286 Ga0451577_0005175 3300042876 Bacteria 13417
287 Ga0451577_0014500 3300042876 Bacteria 7347
288 Ga0451577_0061424 3300042876 Bacteria 3351
289 Ga0451577_0083955 3300042876 Bacteria 2842
290 Ga0451577_0089369 3300042876 Bacteria 2749
291 Ga0451577_0212094 3300042876 Bacteria 1749
292 Ga0451577_0350159 3300042876 Bacteria 1340
293 Ga0451577_0611985 3300042876 Bacteria 988
294 Ga0451577_1731530 3300042876 Bacteria 549
295 Ga0453683_0042531 3300044673 Bacteria 2852
296 Ga0453683_0147490 3300044673 Bacteria 1486
297 Ga0453683_0179591 3300044673 Bacteria 1342
298 Ga0466966_0019613 3300044684 Bacteria 4449
299 Ga0453684_0000065 3300044712 Bacteria 468481
300 Ga0453684_0000369 3300044712 Bacteria 184784
301 Ga0453684_0000677 3300044712 Bacteria 122140
302 Ga0453684_0001529 3300044712 Bacteria 64683
303 Ga0453684_0036305 3300044712 Bacteria 6793
304 Ga0453684_0057201 3300044712 Bacteria 5050
305 Ga0453684_0105896 3300044712 Bacteria 3429
306 Ga0453684_0196609 3300044712 Bacteria 2354
307 Ga0453684_0282201 3300044712 Bacteria 1893
308 Ga0453684_0609905 3300044712 Bacteria 1195
309 Ga0453684_1162688 3300044712 Bacteria 812
310 Ga0453684_1483723 3300044712 Bacteria 700
311 Ga0451576_0000591 3300045051 Bacteria 76735
312 Ga0451576_0001977 3300045051 Bacteria 32557
313 Ga0451576_0004578 3300045051 Bacteria 17867
314 Ga0451576_0005888 3300045051 Bacteria 15217
315 Ga0451576_0006277 3300045051 Bacteria 14626
316 Ga0451576_0018556 3300045051 Bacteria 7621
317 Ga0451576_0043793 3300045051 Bacteria 4721
318 Ga0451576_0078765 3300045051 Bacteria 3429
319 Ga0495650_0300434 3300046471 Bacteria 537
320 Ga0495594_0483270 3300046499 Bacteria 704
321 Ga0495643_0298253 3300046522 Bacteria 736
322 Ga0495643_0404288 3300046522 Bacteria 602
323 Ga0495621_0010478 3300046539 Bacteria 2838
324 Ga0495658_0186801 3300046683 Bacteria 1287
325 Ga0495658_0316455 3300046683 Bacteria 989
326 Ga0496100_0224265 3300048903 Bacteria 1380
327 Ga0496100_0418984 3300048903 Bacteria 1022
328 Ga0496101_0009965 3300048904 Bacteria 6260
329 Ga0496102_1808148 3300048905 Bacteria 528
330 Ga0496104_0216430 3300048907 Bacteria 1827
331 Ga0496104_0689804 3300048907 Bacteria 929
332 Ga0496105_0072507 3300048908 Bacteria 2846
333 Ga0496106_0081126 3300048909 Bacteria 2492
334 Ga0496108_0028099 3300048911 Bacteria 4653
335 Ga0496108_0228880 3300048911 Bacteria 1616
336 Ga0496108_0233949 3300048911 Unclassified 1598
337 Ga0496108_0452420 3300048911 Bacteria 1122
338 Ga0496109_0250738 3300048912 Bacteria 1667
339 Ga0496109_0319499 3300048912 Bacteria 1465
340 Ga0496110_0041351 3300048913 Bacteria 4022
341 Ga0496110_0166178 3300048913 Bacteria 2001
342 Ga0496111_0248218 3300048914 Bacteria 1321
343 Ga0496112_0195495 3300048915 Bacteria 1983
344 Ga0496114_0030275 3300048917 Bacteria 4453
345 Ga0496114_0038591 3300048917 Bacteria 3952
346 Ga0496115_0367626 3300048918 Bacteria 1171
347 Ga0496115_0512850 3300048918 Unclassified 962
348 Ga0496118_0007023 3300048921 Bacteria 12122
349 Ga0496121_0034283 3300048924 Bacteria 4571
350 Ga0496123_0107876 3300048926 Bacteria 1600
351 Ga0501306_069591 3300049127 Bacteria 592
352 Ga0501309_028468 3300049129 Bacteria 815
353 Ga0501310_027262 3300049130 Bacteria 744
354 Ga0501310_045033 3300049130 Bacteria 625
355 Ga0501305_104034 3300049161 Bacteria 531
356 Ga0501291_006509 3300049514 Bacteria 1560
357 Ga0501295_096023 3300049518 Bacteria 690
358 Ga0501298_017541 3300049521 Bacteria 1308
359 Ga0501311_019808 3300049527 Bacteria 905
360 Ga0501312_019963 3300049528 Bacteria 988
361 Ga0501313_046148 3300049529 Bacteria 594
362 Ga0501315_033004 3300049531 Bacteria 754
363 Ga0501315_077742 3300049531 Bacteria 559
364 Ga0501318_077824 3300049534 Bacteria 533
365 Ga0501318_089927 3300049534 Bacteria 507
366 Ga0501320_062401 3300049536 Bacteria 526
367 Ga0501334_03422 3300049550 Bacteria 982
368 Ga0501335_008229 3300049551 Bacteria 977
369 Ga0501335_041691 3300049551 Bacteria 542
370 Ga0501031_0006233 3300049568 Bacteria 7778
371 Ga0501031_0009246 3300049568 Bacteria 6405
372 Ga0501032_0037608 3300049569 Bacteria 3299
373 Ga0501032_0051359 3300049569 Bacteria 2780
374 Ga0501032_0195800 3300049569 Bacteria 1320
375 Ga0501033_0000709 3300049570 Bacteria 30657
376 Ga0501033_0001808 3300049570 Bacteria 18685
377 Ga0501033_0004879 3300049570 Bacteria 10682
378 Ga0501033_0016892 3300049570 Bacteria 5517
379 Ga0501033_0181983 3300049570 Bacteria 1506
380 Ga0501034_0008103 3300049571 Bacteria 11145
381 Ga0501034_0720819 3300049571 Bacteria 894
382 Ga0501036_0000268 3300049572 Bacteria 35567
383 Ga0501036_0001606 3300049572 Bacteria 17453
384 Ga0501036_0150134 3300049572 Bacteria 1965
385 Ga0501036_0396489 3300049572 Bacteria 1151
386 Ga0501037_0005074 3300049573 Bacteria 9581
387 Ga0501037_0141246 3300049573 Bacteria 1723
388 Ga0501038_0000280 3300049574 Bacteria 43290
389 Ga0501038_0004118 3300049574 Bacteria 13528
390 Ga0501038_0019910 3300049574 Bacteria 6039
391 Ga0501038_0047069 3300049574 Bacteria 3737
392 Ga0501038_0055621 3300049574 Bacteria 3399
393 Ga0501038_0128257 3300049574 Bacteria 2086
394 Ga0501038_0210873 3300049574 Bacteria 1554
395 Ga0501039_0053362 3300049575 Bacteria 3128
396 Ga0501039_0085668 3300049575 Bacteria 2454
397 Ga0501039_0099282 3300049575 Bacteria 2272
398 Ga0501039_0101811 3300049575 Bacteria 2242
399 Ga0501039_0121166 3300049575 Bacteria 2050
400 Ga0501039_0218695 3300049575 Bacteria 1498
401 Ga0501039_0470201 3300049575 Bacteria 987
402 Ga0501039_0803598 3300049575 Bacteria 734
403 Ga0501040_0001121 3300049576 Bacteria 16964
404 Ga0501040_0006758 3300049576 Bacteria 7442
405 Ga0501041_0005255 3300049577 Bacteria 7566
406 Ga0501041_0024260 3300049577 Bacteria 3640
407 Ga0501042_0008786 3300049578 Bacteria 6697
408 Ga0501042_0010832 3300049578 Bacteria 6132
409 Ga0501042_0046606 3300049578 Bacteria 3091
410 Ga0501042_0524759 3300049578 Bacteria 860
411 Ga0501043_0001507 3300049579 Bacteria 20331
412 Ga0501043_0003838 3300049579 Bacteria 12355
413 Ga0501043_0696590 3300049579 Bacteria 742
414 Ga0501046_0008472 3300049580 Bacteria 8958
415 Ga0501046_0011739 3300049580 Bacteria 7479
416 Ga0501046_0017699 3300049580 Bacteria 5944
417 Ga0501047_0002525 3300049581 Bacteria 17435
418 Ga0501047_0014502 3300049581 Bacteria 7495
419 Ga0501047_0285563 3300049581 Bacteria 1494
420 Ga0501048_0006099 3300049582 Bacteria 9181
421 Ga0501048_0044068 3300049582 Bacteria 3192
422 Ga0501048_0449558 3300049582 Bacteria 923
423 Ga0501067_0123273 3300049583 Bacteria 1442
424 Ga0501068_0013549 3300049584 Bacteria 4641
425 Ga0501068_0186570 3300049584 Bacteria 1312
426 Ga0501068_0336098 3300049584 Bacteria 970
427 Ga0501070_0435474 3300049586 Unclassified 1058
428 Ga0501071_0008818 3300049587 Bacteria 6684
429 Ga0501071_0028837 3300049587 Bacteria 3913
430 Ga0501071_0954416 3300049587 Bacteria 662
431 Ga0501072_0010795 3300049588 Bacteria 6959
432 Ga0501072_0154060 3300049588 Bacteria 1833
433 Ga0501074_0071699 3300049590 Bacteria 2490
434 Ga0501075_0003774 3300049591 Bacteria 10182
435 Ga0501075_0012522 3300049591 Bacteria 6031
436 Ga0501076_0053539 3300049592 Bacteria 3198
437 Ga0501077_0068019 3300049593 Bacteria 2258
438 Ga0501077_0088085 3300049593 Bacteria 1967
439 Ga0501077_0225113 3300049593 Bacteria 1192
440 Ga0501216_036781 3300049660 Bacteria 924
441 Ga0501259_051721 3300049688 Bacteria 836
442 Ga0501079_0016926 3300049741 Bacteria 5568
443 Ga0501079_0499757 3300049741 Bacteria 956
444 Ga0501080_0018074 3300049742 Bacteria 6527
445 Ga0501080_0059040 3300049742 Bacteria 3570
446 Ga0501081_0066788 3300049743 Bacteria 2501
447 Ga0501081_0349070 3300049743 Bacteria 1090
448 Ga0501081_0843546 3300049743 Bacteria 690
449 Ga0501280_000535 3300049776 Bacteria 8910
450 Ga0501283_013662 3300049779 Bacteria 1233
451 Ga0501035_0000270 3300049822 Bacteria 61516
452 Ga0501035_0004552 3300049822 Bacteria 13160
453 Ga0501035_0007685 3300049822 Bacteria 10073
454 Ga0501035_0058038 3300049822 Bacteria 3450
455 Ga0501035_0111503 3300049822 Bacteria 2397
456 Ga0501035_0194175 3300049822 Bacteria 1744
457 Ga0501035_0246420 3300049822 Bacteria 1518
458 Ga0501035_0596576 3300049822 Bacteria 900
459 Ga0501044_0000261 3300049823 Bacteria 66869
460 Ga0501044_0000482 3300049823 Bacteria 48412
461 Ga0501044_0004065 3300049823 Bacteria 16403
462 Ga0501044_0006513 3300049823 Bacteria 12897
463 Ga0501044_0075275 3300049823 Bacteria 3427
464 Ga0501044_0189624 3300049823 Bacteria 2019
465 Ga0501044_0860556 3300049823 Bacteria 783
466 Ga0501044_1216511 3300049823 Bacteria 621
467 Ga0501045_0000564 3300049824 Bacteria 23265
468 Ga0501045_0009535 3300049824 Bacteria 6792
469 nmdc:mga03683_90095_c1 3300050489 Bacteria 1336
470 nmdc:mga03n38_196310_c1 3300050490 Bacteria 1042
471 nmdc:mga00v17_215529_c1 3300050491 Bacteria 1243
472 nmdc:mga00v17_445188_c1 3300050491 Bacteria 841
473 nmdc:mga0k408_149591_c1 3300050493 Bacteria 1390
474 nmdc:mga0k408_74404_c1 3300050493 Bacteria 1985
475 nmdc:mga0k408_8866_c1 3300050493 Bacteria 5410
476 nmdc:mga06z11_129572_c1 3300050494 Bacteria 1415
477 nmdc:mga04h51_245422_c1 3300050495 Bacteria 716
478 nmdc:mga08y16_326210_c1 3300050511 Bacteria 1580
479 nmdc:mga08y16_409233_c1 3300050511 Bacteria 1387
480 nmdc:mga0rr50_640801_c1 3300050513 Bacteria 906
481 nmdc:mga0sz30_67780_c1 3300050516 Bacteria 1533
482 Ga0500561_0280024 3300053137 Bacteria 531
483 Ga0501084_0006071 3300054114 Bacteria 9935
484 Ga0501084_0010488 3300054114 Bacteria 7659
485 Ga0587084_097626 3300059477 Bacteria 591
486 Ga0587092_132618 3300059512 Bacteria 542
487 Ga0587076_032864 3300059645 Bacteria 930
488 Ga0587078_033317 3300059646 Bacteria 703
489 Ga0587120_004814 3300059659 Bacteria 1018
490 Ga0501082_0007272 3300060353 Bacteria 9552
491 Ga0501082_0045379 3300060353 Bacteria 3790
492 Ga0530510_0002778 3300061734 Bacteria 12037
493 Ga0530510_0033060 3300061734 Bacteria 3723

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_1252022 Ga0436365_1252022_2133_2576 133
2 3300048921 Ga0496118_0007023 Ga0496118_0007023_7424_7837 137
3 iso_pu_bacteria 2508501125 2509132347 138
4 iso_pu_bacteria 2513237151 2513963382 138
5 iso_pu_bacteria 2513237166 2514046221 138
6 iso_pu_bacteria 2526164512 2526213988 138
7 iso_pu_bacteria 2526164713 2527078615 138
8 iso_pu_bacteria 2547132512 2548848734 138
9 iso_pu_bacteria 2562617112 2563061835 138
10 iso_pu_bacteria 2574179768 2574429152 138
11 iso_pu_bacteria 2711768613 2713478330 138
12 iso_pu_bacteria 2738541296 2738821711 138
13 iso_pu_bacteria 2738541298 2738834193 138
14 iso_pu_bacteria 2738541306 2738875397 138
15 iso_pu_bacteria 2738543002 2739187350 138
16 iso_pu_bacteria 2738543008 2739221995 138
17 iso_pu_bacteria 2744054900 2746088591 138
18 iso_pu_bacteria 2744054901 2746092630 138
19 iso_pu_bacteria 2791355137 2792840607 138
20 iso_pu_bacteria 2818991450 2819623393 138
21 iso_pu_bacteria 2842324504 2842324637 138
22 iso_pu_bacteria 2842348783 2842348915 138
23 iso_pu_bacteria 2842454564 2842457379 138
24 iso_pu_bacteria 2900634093 2900637353 138
25 iso_pu_bacteria 2904483920 2904487823 138
26 iso_pu_bacteria 2919527303 2919529128 138
27 iso_pu_bacteria 2921643360 2921643812 138
28 iso_pu_bacteria 2928108538 2928113538 138
29 iso_pu_bacteria 2928135762 2928140749 138
30 iso_pu_bacteria 2928503688 2928506134 138
31 iso_pu_bacteria 2945934425 2945938097 138
32 iso_pu_bacteria 2990703756 2990705186 138
33 iso_pu_bacteria 642555113 642622928 138
34 iso_pu_bacteria 8048746797 8048748608 138
35 iso_pu_bacteria 8055266321 8055267402 138
36 iso_pu_bacteria 8055301274 8055301297 138
37 iso_pu_bacteria 2643221572 2643876417 139
38 iso_pu_bacteria 2643221669 2644383472 139
39 iso_pu_bacteria 2895660088 2895660591 139
40 3300003163 Ga0006759J45824_1005431 Ga0006759J45824_10054312 141
41 3300003320 rootH2_10010659 rootH2_100106592 141
42 3300003323 rootH1_10007780 rootH1_100077805 141
43 3300005289 Ga0065704_10553282 Ga0065704_105532821 141
44 3300049583 Ga0501067_0123273 Ga0501067_0123273_579_1031 141
45 3300001904 JGI24736J21556_1048266 JGI24736J21556_10482662 142
46 3300003559 Ga0007427J51700_123299 Ga0007427J51700_1232991 142
47 3300003575 Ga0007409J51694_1049228 Ga0007409J51694_10492281 142
48 3300003579 Ga0007429J51699_1049887 Ga0007429J51699_10498871 142
49 3300004801 Ga0058860_10580578 Ga0058860_105805781 142
50 3300005290 Ga0065712_10271024 Ga0065712_102710242 142
51 3300005290 Ga0065712_10576999 Ga0065712_105769991 142
52 3300005290 Ga0065712_10620510 Ga0065712_106205101 142
53 3300005327 Ga0070658_10188547 Ga0070658_101885471 142
54 3300005327 Ga0070658_10266221 Ga0070658_102662212 142
55 3300005327 Ga0070658_10776939 Ga0070658_107769391 142
56 3300005329 Ga0070683_100091001 Ga0070683_1000910013 142
57 3300005330 Ga0070690_100505707 Ga0070690_1005057072 142
58 3300005333 Ga0070677_10187745 Ga0070677_101877452 142
59 3300005336 Ga0070680_100790945 Ga0070680_1007909451 142
60 3300005337 Ga0070682_100222915 Ga0070682_1002229152 142
61 3300005338 Ga0068868_100025744 Ga0068868_1000257443 142
62 3300005338 Ga0068868_100188507 Ga0068868_1001885072 142
63 3300005338 Ga0068868_100315019 Ga0068868_1003150192 142
64 3300005339 Ga0070660_100031943 Ga0070660_1000319434 142
65 3300005339 Ga0070660_100281947 Ga0070660_1002819472 142
66 3300005339 Ga0070660_100607076 Ga0070660_1006070762 142
67 3300005340 Ga0070689_100091715 Ga0070689_1000917152 142
68 3300005344 Ga0070661_100098154 Ga0070661_1000981542 142
69 3300005354 Ga0070675_100019434 Ga0070675_1000194345 142
70 3300005355 Ga0070671_100049003 Ga0070671_1000490033 142
71 3300005364 Ga0070673_100065827 Ga0070673_1000658272 142
72 3300005366 Ga0070659_100077804 Ga0070659_1000778044 142
73 3300005366 Ga0070659_100988714 Ga0070659_1009887141 142
74 3300005435 Ga0070714_100104368 Ga0070714_1001043683 142
75 3300005435 Ga0070714_100256237 Ga0070714_1002562371 142
76 3300005437 Ga0070710_10822712 Ga0070710_108227121 142
77 3300005438 Ga0070701_10172724 Ga0070701_101727242 142
78 3300005441 Ga0070700_101717950 Ga0070700_1017179501 142
79 3300005455 Ga0070663_100124576 Ga0070663_1001245762 142
80 3300005455 Ga0070663_100264673 Ga0070663_1002646732 142
81 3300005455 Ga0070663_100542070 Ga0070663_1005420702 142
82 3300005456 Ga0070678_100094789 Ga0070678_1000947892 142
83 3300005457 Ga0070662_100974577 Ga0070662_1009745771 142
84 3300005457 Ga0070662_101099244 Ga0070662_1010992441 142
85 3300005458 Ga0070681_10019167 Ga0070681_100191674 142
86 3300005458 Ga0070681_10422911 Ga0070681_104229113 142
87 3300005459 Ga0068867_100100840 Ga0068867_1001008403 142
88 3300005466 Ga0070685_10492864 Ga0070685_104928642 142
89 3300005466 Ga0070685_11426697 Ga0070685_114266971 142
90 3300005468 Ga0070707_101197140 Ga0070707_1011971401 142
91 3300005471 Ga0070698_100576695 Ga0070698_1005766952 142
92 3300005530 Ga0070679_100221040 Ga0070679_1002210401 142
93 3300005530 Ga0070679_101911744 Ga0070679_1019117441 142
94 3300005535 Ga0070684_100040791 Ga0070684_1000407912 142
95 3300005535 Ga0070684_100214510 Ga0070684_1002145102 142
96 3300005536 Ga0070697_100055150 Ga0070697_1000551503 142
97 3300005539 Ga0068853_100189267 Ga0068853_1001892674 142
98 3300005543 Ga0070672_100034137 Ga0070672_1000341372 142
99 3300005546 Ga0070696_100426396 Ga0070696_1004263962 142
100 3300005548 Ga0070665_100719023 Ga0070665_1007190231 142
101 3300005549 Ga0070704_100169456 Ga0070704_1001694562 142
102 3300005549 Ga0070704_101292714 Ga0070704_1012927141 142
103 3300005549 Ga0070704_101684661 Ga0070704_1016846611 142
104 3300005564 Ga0070664_100024396 Ga0070664_1000243966 142
105 3300005578 Ga0068854_100647553 Ga0068854_1006475532 142
106 3300005614 Ga0068856_100108775 Ga0068856_1001087753 142
107 3300005616 Ga0068852_100001759 Ga0068852_1000017593 142
108 3300005616 Ga0068852_100021983 Ga0068852_1000219835 142
109 3300005617 Ga0068859_100061235 Ga0068859_1000612357 142
110 3300005618 Ga0068864_100147719 Ga0068864_1001477192 142
111 3300005618 Ga0068864_100433075 Ga0068864_1004330752 142
112 3300005718 Ga0068866_10271242 Ga0068866_102712422 142
113 3300005834 Ga0068851_10009817 Ga0068851_100098175 142
114 3300005834 Ga0068851_10030814 Ga0068851_100308143 142
115 3300005841 Ga0068863_100966204 Ga0068863_1009662042 142
116 3300005842 Ga0068858_100186764 Ga0068858_1001867643 142
117 3300005843 Ga0068860_101520606 Ga0068860_1015206061 142
118 3300006042 Ga0075368_10322754 Ga0075368_103227542 142
119 3300006048 Ga0075363_100152546 Ga0075363_1001525462 142
120 3300006051 Ga0075364_10118324 Ga0075364_101183242 142
121 3300006051 Ga0075364_10494932 Ga0075364_104949322 142
122 3300006163 Ga0070715_10360257 Ga0070715_103602572 142
123 3300006173 Ga0070716_100163095 Ga0070716_1001630952 142
124 3300006175 Ga0070712_101064899 Ga0070712_1010648991 142
125 3300006175 Ga0070712_101067080 Ga0070712_1010670801 142
126 3300006177 Ga0075362_10015321 Ga0075362_100153211 142
127 3300006177 Ga0075362_10054872 Ga0075362_100548721 142
128 3300006178 Ga0075367_10164091 Ga0075367_101640912 142
129 3300006186 Ga0075369_10013586 Ga0075369_100135862 142
130 3300006195 Ga0075366_10001852 Ga0075366_100018527 142
131 3300006195 Ga0075366_10031402 Ga0075366_100314022 142
132 3300006195 Ga0075366_10071725 Ga0075366_100717251 142
133 3300006195 Ga0075366_10954697 Ga0075366_109546971 142
134 3300006237 Ga0097621_100030798 Ga0097621_1000307987 142
135 3300006237 Ga0097621_100048009 Ga0097621_1000480093 142
136 3300006358 Ga0068871_100019547 Ga0068871_1000195474 142
137 3300006358 Ga0068871_100049509 Ga0068871_1000495093 142
138 3300006844 Ga0075428_101221409 Ga0075428_1012214091 142
139 3300006881 Ga0068865_102020607 Ga0068865_1020206071 142
140 3300006931 Ga0097620_100061233 Ga0097620_1000612331 142
141 3300009093 Ga0105240_11163136 Ga0105240_111631361 142
142 3300009094 Ga0111539_10060204 Ga0111539_100602042 142
143 3300009094 Ga0111539_10390106 Ga0111539_103901061 142
144 3300009094 Ga0111539_10587431 Ga0111539_105874313 142
145 3300009094 Ga0111539_10606705 Ga0111539_106067052 142
146 3300009094 Ga0111539_11894233 Ga0111539_118942331 142
147 3300009098 Ga0105245_10754849 Ga0105245_107548492 142
148 3300009101 Ga0105247_10745125 Ga0105247_107451251 142
149 3300009148 Ga0105243_10144671 Ga0105243_101446713 142
150 3300009174 Ga0105241_10519824 Ga0105241_105198241 142
151 3300009174 Ga0105241_11113792 Ga0105241_111137921 142
152 3300009176 Ga0105242_10472301 Ga0105242_104723012 142
153 3300009177 Ga0105248_10184527 Ga0105248_101845273 142
154 3300009177 Ga0105248_10470167 Ga0105248_104701672 142
155 3300009553 Ga0105249_11421537 Ga0105249_114215372 142
156 3300010375 Ga0105239_10442194 Ga0105239_104421941 142
157 3300010375 Ga0105239_10676179 Ga0105239_106761792 142
158 3300010375 Ga0105239_11029141 Ga0105239_110291411 142
159 3300013100 Ga0157373_10055671 Ga0157373_100556713 142
160 3300013104 Ga0157370_10002935 Ga0157370_1000293516 142
161 3300013104 Ga0157370_10088612 Ga0157370_100886122 142
162 3300013296 Ga0157374_10095354 Ga0157374_100953544 142
163 3300013296 Ga0157374_10125178 Ga0157374_101251782 142
164 3300013296 Ga0157374_10344407 Ga0157374_103444071 142
165 3300013296 Ga0157374_10862718 Ga0157374_108627181 142
166 3300013297 Ga0157378_10238003 Ga0157378_102380033 142
167 3300013306 Ga0163162_10316061 Ga0163162_103160613 142
168 3300013306 Ga0163162_10487671 Ga0163162_104876712 142
169 3300013308 Ga0157375_10432340 Ga0157375_104323403 142
170 3300013308 Ga0157375_11287532 Ga0157375_112875321 142
171 3300014325 Ga0163163_10157561 Ga0163163_101575612 142
172 3300014325 Ga0163163_11029657 Ga0163163_110296572 142
173 3300014969 Ga0157376_10089491 Ga0157376_100894912 142
174 3300014969 Ga0157376_10277773 Ga0157376_102777733 142
175 3300015261 Ga0182006_1052209 Ga0182006_10522092 142
176 3300025228 Ga0209672_100038 Ga0209672_100038214 142
177 3300025229 Ga0209147_100235 Ga0209147_10023541 142
178 3300025254 Ga0209148_1001389 Ga0209148_10013893 142
179 3300025315 Ga0207697_10087497 Ga0207697_100874972 142
180 3300025321 Ga0207656_10002235 Ga0207656_100022355 142
181 3300025321 Ga0207656_10095578 Ga0207656_100955782 142
182 3300025321 Ga0207656_10150232 Ga0207656_101502322 142
183 3300025893 Ga0207682_10028984 Ga0207682_100289842 142
184 3300025899 Ga0207642_10494421 Ga0207642_104944212 142
185 3300025901 Ga0207688_10288782 Ga0207688_102887822 142
186 3300025904 Ga0207647_10015145 Ga0207647_100151455 142
187 3300025907 Ga0207645_10168928 Ga0207645_101689283 142
188 3300025908 Ga0207643_10312452 Ga0207643_103124522 142
189 3300025909 Ga0207705_10089853 Ga0207705_100898533 142
190 3300025910 Ga0207684_10168852 Ga0207684_101688522 142
191 3300025911 Ga0207654_10378193 Ga0207654_103781931 142
192 3300025913 Ga0207695_10076578 Ga0207695_100765781 142
193 3300025913 Ga0207695_10140700 Ga0207695_101407003 142
194 3300025913 Ga0207695_10974789 Ga0207695_109747891 142
195 3300025914 Ga0207671_10005622 Ga0207671_100056223 142
196 3300025915 Ga0207693_10769985 Ga0207693_107699852 142
197 3300025917 Ga0207660_10969628 Ga0207660_109696282 142
198 3300025919 Ga0207657_10093367 Ga0207657_100933672 142
199 3300025919 Ga0207657_10760595 Ga0207657_107605952 142
200 3300025920 Ga0207649_10151955 Ga0207649_101519552 142
201 3300025920 Ga0207649_10153165 Ga0207649_101531651 142
202 3300025921 Ga0207652_10163763 Ga0207652_101637632 142
203 3300025922 Ga0207646_10743076 Ga0207646_107430762 142
204 3300025925 Ga0207650_10017043 Ga0207650_100170434 142
205 3300025926 Ga0207659_10535626 Ga0207659_105356262 142
206 3300025926 Ga0207659_11205512 Ga0207659_112055122 142
207 3300025927 Ga0207687_10849691 Ga0207687_108496912 142
208 3300025927 Ga0207687_11283682 Ga0207687_112836821 142
209 3300025929 Ga0207664_10089886 Ga0207664_100898863 142
210 3300025929 Ga0207664_10169003 Ga0207664_101690032 142
211 3300025929 Ga0207664_11121405 Ga0207664_111214052 142
212 3300025933 Ga0207706_10048226 Ga0207706_100482266 142
213 3300025933 Ga0207706_10286923 Ga0207706_102869232 142
214 3300025933 Ga0207706_10571062 Ga0207706_105710622 142
215 3300025936 Ga0207670_10069357 Ga0207670_100693573 142
216 3300025936 Ga0207670_10217709 Ga0207670_102177093 142
217 3300025937 Ga0207669_10142792 Ga0207669_101427921 142
218 3300025939 Ga0207665_10134269 Ga0207665_101342693 142
219 3300025940 Ga0207691_10033884 Ga0207691_100338846 142
220 3300025941 Ga0207711_10845942 Ga0207711_108459422 142
221 3300025941 Ga0207711_11249716 Ga0207711_112497162 142
222 3300025944 Ga0207661_10358235 Ga0207661_103582353 142
223 3300025945 Ga0207679_10078695 Ga0207679_100786953 142
224 3300025960 Ga0207651_10723203 Ga0207651_107232032 142
225 3300025981 Ga0207640_10111180 Ga0207640_101111802 142
226 3300025981 Ga0207640_10941404 Ga0207640_109414041 142
227 3300025981 Ga0207640_12074558 Ga0207640_120745581 142
228 3300026023 Ga0207677_10025794 Ga0207677_100257943 142
229 3300026023 Ga0207677_10041891 Ga0207677_100418914 142
230 3300026023 Ga0207677_11391870 Ga0207677_113918702 142
231 3300026035 Ga0207703_10154047 Ga0207703_101540473 142
232 3300026041 Ga0207639_10525729 Ga0207639_105257292 142
233 3300026067 Ga0207678_10655850 Ga0207678_106558502 142
234 3300026075 Ga0207708_11176110 Ga0207708_111761102 142
235 3300026088 Ga0207641_10499892 Ga0207641_104998922 142
236 3300026088 Ga0207641_10888779 Ga0207641_108887791 142
237 3300026089 Ga0207648_10068615 Ga0207648_100686154 142
238 3300026089 Ga0207648_10514277 Ga0207648_105142772 142
239 3300026095 Ga0207676_10147667 Ga0207676_101476672 142
240 3300026118 Ga0207675_100203901 Ga0207675_1002039012 142
241 3300026121 Ga0207683_10000544 Ga0207683_1000054435 142
242 3300026142 Ga0207698_10004810 Ga0207698_100048102 142
243 3300026142 Ga0207698_10070917 Ga0207698_100709174 142
244 3300026142 Ga0207698_10577228 Ga0207698_105772282 142
245 3300027614 Ga0209970_1006891 Ga0209970_10068912 142
246 3300027907 Ga0207428_10011353 Ga0207428_100113533 142
247 3300028577 Ga0265318_10020713 Ga0265318_100207133 142
248 3300028786 Ga0307517_10131378 Ga0307517_101313782 142
249 3300028794 Ga0307515_10108731 Ga0307515_101087312 142
250 3300031238 Ga0265332_10000039 Ga0265332_10000039125 142
251 3300031240 Ga0265320_10019701 Ga0265320_100197014 142
252 3300031240 Ga0265320_10135680 Ga0265320_101356801 142
253 3300031241 Ga0265325_10108797 Ga0265325_101087971 142
254 3300031250 Ga0265331_10005900 Ga0265331_100059008 142
255 3300031250 Ga0265331_10092990 Ga0265331_100929903 142
256 3300031250 Ga0265331_10271866 Ga0265331_102718662 142
257 3300031344 Ga0265316_10004209 Ga0265316_100042096 142
258 3300031344 Ga0265316_10421225 Ga0265316_104212251 142
259 3300031507 Ga0307509_10000018 Ga0307509_100000188 142
260 3300031548 Ga0307408_100035777 Ga0307408_1000357774 142
261 3300031548 Ga0307408_100220816 Ga0307408_1002208163 142
262 3300031711 Ga0265314_10001425 Ga0265314_1000142510 142
263 3300031711 Ga0265314_10380453 Ga0265314_103804532 142
264 3300031730 Ga0307516_10001808 Ga0307516_100018089 142
265 3300031731 Ga0307405_10031395 Ga0307405_100313952 142
266 3300031824 Ga0307413_10010514 Ga0307413_100105142 142
267 3300031901 Ga0307406_10265915 Ga0307406_102659152 142
268 3300031903 Ga0307407_10085080 Ga0307407_100850804 142
269 3300031911 Ga0307412_10001034 Ga0307412_1000103417 142
270 3300031911 Ga0307412_10598103 Ga0307412_105981032 142
271 3300031911 Ga0307412_10830723 Ga0307412_108307232 142
272 3300031995 Ga0307409_100101014 Ga0307409_1001010143 142
273 3300032005 Ga0307411_10154535 Ga0307411_101545354 142
274 3300032005 Ga0307411_10173731 Ga0307411_101737312 142
275 3300032005 Ga0307411_10962352 Ga0307411_109623521 142
276 3300032005 Ga0307411_11108031 Ga0307411_111080311 142
277 3300032126 Ga0307415_100000825 Ga0307415_10000082515 142
278 3300032133 Ga0316583_10001814 Ga0316583_100018146 142
279 3300033524 Ga0316592_1030489 Ga0316592_10304892 142
280 3300033524 Ga0316592_1044759 Ga0316592_10447592 142
281 3300033527 Ga0316586_1019127 Ga0316586_10191272 142
282 3300033541 Ga0316596_1022081 Ga0316596_10220812 142
283 3300033541 Ga0316596_1023413 Ga0316596_10234132 142
284 3300035089 Ga0373944_0319052 Ga0373944_0319052_70_498 142
285 3300035113 Ga0373936_0239996 Ga0373936_0239996_83_511 142
286 3300035170 Ga0373943_0186266 Ga0373943_0186266_690_1118 142
287 3300035207 Ga0373942_0048118 Ga0373942_0048118_722_1150 142
288 3300035242 Ga0373962_0077555 Ga0373962_0077555_365_793 142
289 3300035398 Ga0316574_0161772 Ga0316574_0161772_287_715 142
290 3300035691 Ga0373931_0025385 Ga0373931_0025385_1028_1456 142
291 3300035691 Ga0373931_0322345 Ga0373931_0322345_347_775 142
292 3300035692 Ga0373935_0799781 Ga0373935_0799781_104_586 142
293 3300035695 Ga0373927_0099710 Ga0373927_0099710_1321_1749 142
294 3300035725 Ga0373947_0214911 Ga0373947_0214911_820_1248 142
295 3300035725 Ga0373947_0357258 Ga0373947_0357258_260_688 142
296 3300036401 Ga0373937_0559533 Ga0373937_0559533_514_942 142
297 3300037068 Ga0373925_0042262 Ga0373925_0042262_1654_2082 142
298 3300037418 Ga0395900_0099978 Ga0395900_0099978_506_940 142
299 3300037418 Ga0395900_0147341 Ga0395900_0147341_1068_1574 142
300 3300041454 Ga0451799_25283 Ga0451799_25283_162_593 142
301 3300041455 Ga0451801_24466 Ga0451801_24466_157_588 142
302 3300041459 Ga0451800_0994459 Ga0451800_0994459_362_793 142
303 3300041460 Ga0451802_0291917 Ga0451802_0291917_363_794 142
304 3300041486 Ga0451807_0525531 Ga0451807_0525531_636_1067 142
305 3300041512 Ga0451853_0792599 Ga0451853_0792599_300_734 142
306 3300041512 Ga0451853_1658291 Ga0451853_1658291_199_627 142
307 3300041916 Ga0452271_89865 Ga0452271_89865_87_515 142
308 3300041997 Ga0439431_0018450 Ga0439431_0018450_299_727 142
309 3300041999 Ga0439433_0043226 Ga0439433_0043226_347_775 142
310 3300042001 Ga0439441_153441 Ga0439441_153441_62_490 142
311 3300042004 Ga0439445_0034773 Ga0439445_0034773_626_1054 142
312 3300042115 Ga0450911_039720 Ga0450911_039720_15_443 142
313 3300042116 Ga0450912_021555 Ga0450912_021555_49_477 142
314 3300042122 Ga0450920_028278 Ga0450920_028278_27_455 142
315 3300042125 Ga0450923_014290 Ga0450923_014290_549_983 142
316 3300042128 Ga0450897_013403 Ga0450897_013403_355_786 142
317 3300042134 Ga0450898_007714 Ga0450898_007714_1231_1659 142
318 3300042156 Ga0439446_0012703 Ga0439446_0012703_765_1193 142
319 3300042184 Ga0450908_003391 Ga0450908_003391_2128_2556 142
320 3300042435 Ga0439434_0007600 Ga0439434_0007600_644_1072 142
321 3300042436 Ga0439435_0001708 Ga0439435_0001708_1752_2180 142
322 3300042437 Ga0439444_0000230 Ga0439444_0000230_2054_2482 142
323 3300042461 Ga0439460_0030496 Ga0439460_0030496_682_1110 142
324 3300042531 Ga0450918_058364 Ga0450918_058364_260_691 142
325 3300042876 Ga0451577_0005175 Ga0451577_0005175_1139_1567 142
326 3300042876 Ga0451577_0014500 Ga0451577_0014500_4699_5127 142
327 3300042876 Ga0451577_0061424 Ga0451577_0061424_300_728 142
328 3300042876 Ga0451577_0083955 Ga0451577_0083955_600_1028 142
329 3300042876 Ga0451577_0089369 Ga0451577_0089369_2161_2589 142
330 3300042876 Ga0451577_0212094 Ga0451577_0212094_1237_1665 142
331 3300042876 Ga0451577_0350159 Ga0451577_0350159_89_517 142
332 3300042876 Ga0451577_0611985 Ga0451577_0611985_39_467 142
333 3300042876 Ga0451577_1731530 Ga0451577_1731530_32_460 142
334 3300044673 Ga0453683_0042531 Ga0453683_0042531_2204_2632 142
335 3300044673 Ga0453683_0147490 Ga0453683_0147490_987_1415 142
336 3300044673 Ga0453683_0179591 Ga0453683_0179591_463_891 142
337 3300044684 Ga0466966_0019613 Ga0466966_0019613_838_1266 142
338 3300044712 Ga0453684_0000065 Ga0453684_0000065_286314_286793 142
339 3300044712 Ga0453684_0000369 Ga0453684_0000369_121992_122420 142
340 3300044712 Ga0453684_0000677 Ga0453684_0000677_7821_8249 142
341 3300044712 Ga0453684_0001529 Ga0453684_0001529_59512_59940 142
342 3300044712 Ga0453684_0036305 Ga0453684_0036305_1445_1876 142
343 3300044712 Ga0453684_0057201 Ga0453684_0057201_879_1307 142
344 3300044712 Ga0453684_0105896 Ga0453684_0105896_1703_2131 142
345 3300044712 Ga0453684_0196609 Ga0453684_0196609_1417_1845 142
346 3300044712 Ga0453684_0282201 Ga0453684_0282201_846_1274 142
347 3300044712 Ga0453684_0609905 Ga0453684_0609905_33_461 142
348 3300044712 Ga0453684_1162688 Ga0453684_1162688_94_522 142
349 3300044712 Ga0453684_1483723 Ga0453684_1483723_56_484 142
350 3300045051 Ga0451576_0000591 Ga0451576_0000591_39110_39538 142
351 3300045051 Ga0451576_0001977 Ga0451576_0001977_18261_18689 142
352 3300045051 Ga0451576_0004578 Ga0451576_0004578_7348_7776 142
353 3300045051 Ga0451576_0005888 Ga0451576_0005888_9397_9825 142
354 3300045051 Ga0451576_0006277 Ga0451576_0006277_12592_13020 142
355 3300045051 Ga0451576_0018556 Ga0451576_0018556_5446_5874 142
356 3300045051 Ga0451576_0043793 Ga0451576_0043793_2405_2833 142
357 3300045051 Ga0451576_0078765 Ga0451576_0078765_1679_2107 142
358 3300046471 Ga0495650_0300434 Ga0495650_0300434_93_524 142
359 3300046499 Ga0495594_0483270 Ga0495594_0483270_40_468 142
360 3300046522 Ga0495643_0298253 Ga0495643_0298253_47_493 142
361 3300046522 Ga0495643_0404288 Ga0495643_0404288_48_494 142
362 3300046539 Ga0495621_0010478 Ga0495621_0010478_43_471 142
363 3300046683 Ga0495658_0186801 Ga0495658_0186801_670_1098 142
364 3300046683 Ga0495658_0316455 Ga0495658_0316455_108_536 142
365 3300048903 Ga0496100_0224265 Ga0496100_0224265_891_1325 142
366 3300048903 Ga0496100_0418984 Ga0496100_0418984_474_902 142
367 3300048904 Ga0496101_0009965 Ga0496101_0009965_5320_5748 142
368 3300048905 Ga0496102_1808148 Ga0496102_1808148_55_489 142
369 3300048907 Ga0496104_0216430 Ga0496104_0216430_772_1200 142
370 3300048907 Ga0496104_0689804 Ga0496104_0689804_308_742 142
371 3300048908 Ga0496105_0072507 Ga0496105_0072507_99_527 142
372 3300048909 Ga0496106_0081126 Ga0496106_0081126_57_491 142
373 3300048911 Ga0496108_0028099 Ga0496108_0028099_2348_2818 142
374 3300048911 Ga0496108_0228880 Ga0496108_0228880_936_1370 142
375 3300048911 Ga0496108_0233949 Ga0496108_0233949_912_1346 142
376 3300048911 Ga0496108_0452420 Ga0496108_0452420_337_846 142
377 3300048912 Ga0496109_0250738 Ga0496109_0250738_22_456 142
378 3300048912 Ga0496109_0319499 Ga0496109_0319499_654_1082 142
379 3300048913 Ga0496110_0041351 Ga0496110_0041351_1152_1622 142
380 3300048913 Ga0496110_0166178 Ga0496110_0166178_1128_1562 142
381 3300048914 Ga0496111_0248218 Ga0496111_0248218_359_787 142
382 3300048915 Ga0496112_0195495 Ga0496112_0195495_815_1243 142
383 3300048917 Ga0496114_0030275 Ga0496114_0030275_3826_4260 142
384 3300048917 Ga0496114_0038591 Ga0496114_0038591_2712_3182 142
385 3300048918 Ga0496115_0367626 Ga0496115_0367626_675_1145 142
386 3300048918 Ga0496115_0512850 Ga0496115_0512850_473_907 142
387 3300048924 Ga0496121_0034283 Ga0496121_0034283_3255_3683 142
388 3300048926 Ga0496123_0107876 Ga0496123_0107876_429_857 142
389 3300049127 Ga0501306_069591 Ga0501306_069591_89_517 142
390 3300049129 Ga0501309_028468 Ga0501309_028468_317_745 142
391 3300049130 Ga0501310_027262 Ga0501310_027262_17_445 142
392 3300049130 Ga0501310_045033 Ga0501310_045033_181_609 142
393 3300049161 Ga0501305_104034 Ga0501305_104034_20_448 142
394 3300049514 Ga0501291_006509 Ga0501291_006509_581_1012 142
395 3300049518 Ga0501295_096023 Ga0501295_096023_28_459 142
396 3300049521 Ga0501298_017541 Ga0501298_017541_174_602 142
397 3300049527 Ga0501311_019808 Ga0501311_019808_82_510 142
398 3300049528 Ga0501312_019963 Ga0501312_019963_548_976 142
399 3300049529 Ga0501313_046148 Ga0501313_046148_56_484 142
400 3300049531 Ga0501315_033004 Ga0501315_033004_116_544 142
401 3300049531 Ga0501315_077742 Ga0501315_077742_30_458 142
402 3300049534 Ga0501318_077824 Ga0501318_077824_63_491 142
403 3300049534 Ga0501318_089927 Ga0501318_089927_63_491 142
404 3300049536 Ga0501320_062401 Ga0501320_062401_72_500 142
405 3300049550 Ga0501334_03422 Ga0501334_03422_332_760 142
406 3300049551 Ga0501335_008229 Ga0501335_008229_173_601 142
407 3300049551 Ga0501335_041691 Ga0501335_041691_50_478 142
408 3300049568 Ga0501031_0006233 Ga0501031_0006233_2349_2783 142
409 3300049568 Ga0501031_0009246 Ga0501031_0009246_1782_2216 142
410 3300049569 Ga0501032_0037608 Ga0501032_0037608_1073_1507 142
411 3300049569 Ga0501032_0051359 Ga0501032_0051359_2075_2509 142
412 3300049569 Ga0501032_0195800 Ga0501032_0195800_566_997 142
413 3300049570 Ga0501033_0000709 Ga0501033_0000709_5974_6408 142
414 3300049570 Ga0501033_0001808 Ga0501033_0001808_5941_6375 142
415 3300049570 Ga0501033_0004879 Ga0501033_0004879_9625_10053 142
416 3300049570 Ga0501033_0016892 Ga0501033_0016892_3051_3485 142
417 3300049570 Ga0501033_0181983 Ga0501033_0181983_363_791 142
418 3300049571 Ga0501034_0008103 Ga0501034_0008103_2477_2911 142
419 3300049571 Ga0501034_0720819 Ga0501034_0720819_210_644 142
420 3300049572 Ga0501036_0000268 Ga0501036_0000268_15251_15685 142
421 3300049572 Ga0501036_0001606 Ga0501036_0001606_2798_3232 142
422 3300049572 Ga0501036_0150134 Ga0501036_0150134_1102_1533 142
423 3300049572 Ga0501036_0396489 Ga0501036_0396489_196_681 142
424 3300049573 Ga0501037_0005074 Ga0501037_0005074_9047_9481 142
425 3300049573 Ga0501037_0141246 Ga0501037_0141246_277_711 142
426 3300049574 Ga0501038_0000280 Ga0501038_0000280_5033_5467 142
427 3300049574 Ga0501038_0004118 Ga0501038_0004118_12248_12682 142
428 3300049574 Ga0501038_0019910 Ga0501038_0019910_5427_5861 142
429 3300049574 Ga0501038_0047069 Ga0501038_0047069_939_1373 142
430 3300049574 Ga0501038_0055621 Ga0501038_0055621_387_818 142
431 3300049574 Ga0501038_0128257 Ga0501038_0128257_847_1281 142
432 3300049574 Ga0501038_0210873 Ga0501038_0210873_32_460 142
433 3300049575 Ga0501039_0053362 Ga0501039_0053362_2317_2748 142
434 3300049575 Ga0501039_0085668 Ga0501039_0085668_926_1360 142
435 3300049575 Ga0501039_0099282 Ga0501039_0099282_1268_1696 142
436 3300049575 Ga0501039_0101811 Ga0501039_0101811_1493_1921 142
437 3300049575 Ga0501039_0121166 Ga0501039_0121166_1557_1985 142
438 3300049575 Ga0501039_0218695 Ga0501039_0218695_501_935 142
439 3300049575 Ga0501039_0470201 Ga0501039_0470201_468_899 142
440 3300049575 Ga0501039_0803598 Ga0501039_0803598_60_494 142
441 3300049576 Ga0501040_0001121 Ga0501040_0001121_11664_12098 142
442 3300049576 Ga0501040_0006758 Ga0501040_0006758_5836_6267 142
443 3300049577 Ga0501041_0005255 Ga0501041_0005255_5703_6131 142
444 3300049577 Ga0501041_0024260 Ga0501041_0024260_871_1302 142
445 3300049578 Ga0501042_0008786 Ga0501042_0008786_731_1165 142
446 3300049578 Ga0501042_0010832 Ga0501042_0010832_273_701 142
447 3300049578 Ga0501042_0046606 Ga0501042_0046606_2248_2679 142
448 3300049578 Ga0501042_0524759 Ga0501042_0524759_419_847 142
449 3300049579 Ga0501043_0001507 Ga0501043_0001507_13888_14322 142
450 3300049579 Ga0501043_0003838 Ga0501043_0003838_4984_5418 142
451 3300049579 Ga0501043_0696590 Ga0501043_0696590_276_707 142
452 3300049580 Ga0501046_0008472 Ga0501046_0008472_6938_7372 142
453 3300049580 Ga0501046_0011739 Ga0501046_0011739_6441_6875 142
454 3300049580 Ga0501046_0017699 Ga0501046_0017699_1918_2349 142
455 3300049581 Ga0501047_0002525 Ga0501047_0002525_6938_7372 142
456 3300049581 Ga0501047_0014502 Ga0501047_0014502_608_1036 142
457 3300049581 Ga0501047_0285563 Ga0501047_0285563_511_945 142
458 3300049582 Ga0501048_0006099 Ga0501048_0006099_1810_2244 142
459 3300049582 Ga0501048_0044068 Ga0501048_0044068_457_888 142
460 3300049582 Ga0501048_0449558 Ga0501048_0449558_100_528 142
461 3300049584 Ga0501068_0013549 Ga0501068_0013549_3049_3483 142
462 3300049584 Ga0501068_0186570 Ga0501068_0186570_843_1274 142
463 3300049584 Ga0501068_0336098 Ga0501068_0336098_531_959 142
464 3300049586 Ga0501070_0435474 Ga0501070_0435474_113_547 142
465 3300049587 Ga0501071_0008818 Ga0501071_0008818_5452_5883 142
466 3300049587 Ga0501071_0028837 Ga0501071_0028837_126_554 142
467 3300049587 Ga0501071_0954416 Ga0501071_0954416_172_600 142
468 3300049588 Ga0501072_0010795 Ga0501072_0010795_4267_4698 142
469 3300049588 Ga0501072_0154060 Ga0501072_0154060_1390_1818 142
470 3300049590 Ga0501074_0071699 Ga0501074_0071699_224_655 142
471 3300049591 Ga0501075_0003774 Ga0501075_0003774_1459_1887 142
472 3300049591 Ga0501075_0012522 Ga0501075_0012522_1262_1693 142
473 3300049592 Ga0501076_0053539 Ga0501076_0053539_814_1245 142
474 3300049593 Ga0501077_0068019 Ga0501077_0068019_82_516 142
475 3300049593 Ga0501077_0088085 Ga0501077_0088085_1443_1874 142
476 3300049593 Ga0501077_0225113 Ga0501077_0225113_622_1056 142
477 3300049660 Ga0501216_036781 Ga0501216_036781_60_491 142
478 3300049688 Ga0501259_051721 Ga0501259_051721_337_768 142
479 3300049741 Ga0501079_0016926 Ga0501079_0016926_1356_1787 142
480 3300049741 Ga0501079_0499757 Ga0501079_0499757_227_655 142
481 3300049742 Ga0501080_0018074 Ga0501080_0018074_3554_3985 142
482 3300049742 Ga0501080_0059040 Ga0501080_0059040_2841_3269 142
483 3300049743 Ga0501081_0066788 Ga0501081_0066788_32_460 142
484 3300049743 Ga0501081_0349070 Ga0501081_0349070_451_885 142
485 3300049743 Ga0501081_0843546 Ga0501081_0843546_81_512 142
486 3300049776 Ga0501280_000535 Ga0501280_000535_1549_1977 142
487 3300049779 Ga0501283_013662 Ga0501283_013662_137_568 142
488 3300049822 Ga0501035_0000270 Ga0501035_0000270_24540_24974 142
489 3300049822 Ga0501035_0004552 Ga0501035_0004552_321_755 142
490 3300049822 Ga0501035_0007685 Ga0501035_0007685_1714_2148 142
491 3300049822 Ga0501035_0058038 Ga0501035_0058038_498_929 142
492 3300049822 Ga0501035_0111503 Ga0501035_0111503_1782_2216 142
493 3300049822 Ga0501035_0194175 Ga0501035_0194175_917_1402 142
494 3300049822 Ga0501035_0246420 Ga0501035_0246420_607_1035 142
495 3300049822 Ga0501035_0596576 Ga0501035_0596576_330_764 142
496 3300049823 Ga0501044_0000261 Ga0501044_0000261_33373_33807 142
497 3300049823 Ga0501044_0000482 Ga0501044_0000482_36781_37215 142
498 3300049823 Ga0501044_0004065 Ga0501044_0004065_11922_12356 142
499 3300049823 Ga0501044_0006513 Ga0501044_0006513_11878_12306 142
500 3300049823 Ga0501044_0075275 Ga0501044_0075275_484_918 142
501 3300049823 Ga0501044_0189624 Ga0501044_0189624_276_710 142
502 3300049823 Ga0501044_0860556 Ga0501044_0860556_213_641 142
503 3300049823 Ga0501044_1216511 Ga0501044_1216511_62_496 142
504 3300049824 Ga0501045_0000564 Ga0501045_0000564_9883_10317 142
505 3300049824 Ga0501045_0009535 Ga0501045_0009535_2109_2540 142
506 3300050489 nmdc:mga03683_90095_c1 nmdc:mga03683_90095_c1_860_1288 142
507 3300050490 nmdc:mga03n38_196310_c1 nmdc:mga03n38_196310_c1_411_842 142
508 3300050491 nmdc:mga00v17_215529_c1 nmdc:mga00v17_215529_c1_503_937 142
509 3300050491 nmdc:mga00v17_445188_c1 nmdc:mga00v17_445188_c1_182_610 142
510 3300050493 nmdc:mga0k408_149591_c1 nmdc:mga0k408_149591_c1_150_578 142
511 3300050493 nmdc:mga0k408_74404_c1 nmdc:mga0k408_74404_c1_188_622 142
512 3300050493 nmdc:mga0k408_8866_c1 nmdc:mga0k408_8866_c1_355_783 142
513 3300050494 nmdc:mga06z11_129572_c1 nmdc:mga06z11_129572_c1_636_1070 142
514 3300050495 nmdc:mga04h51_245422_c1 nmdc:mga04h51_245422_c1_18_452 142
515 3300050511 nmdc:mga08y16_326210_c1 nmdc:mga08y16_326210_c1_312_782 142
516 3300050511 nmdc:mga08y16_409233_c1 nmdc:mga08y16_409233_c1_440_886 142
517 3300050513 nmdc:mga0rr50_640801_c1 nmdc:mga0rr50_640801_c1_233_664 142
518 3300050516 nmdc:mga0sz30_67780_c1 nmdc:mga0sz30_67780_c1_464_898 142
519 3300053137 Ga0500561_0280024 Ga0500561_0280024_31_462 142
520 3300054114 Ga0501084_0006071 Ga0501084_0006071_7888_8316 142
521 3300054114 Ga0501084_0010488 Ga0501084_0010488_4940_5371 142
522 3300059477 Ga0587084_097626 Ga0587084_097626_128_556 142
523 3300059512 Ga0587092_132618 Ga0587092_132618_22_450 142
524 3300059645 Ga0587076_032864 Ga0587076_032864_346_774 142
525 3300059646 Ga0587078_033317 Ga0587078_033317_29_457 142
526 3300059659 Ga0587120_004814 Ga0587120_004814_316_744 142
527 3300060353 Ga0501082_0007272 Ga0501082_0007272_5745_6176 142
528 3300060353 Ga0501082_0045379 Ga0501082_0045379_510_938 142
529 3300061734 Ga0530510_0002778 Ga0530510_0002778_9224_9655 142
530 3300061734 Ga0530510_0033060 Ga0530510_0033060_1886_2314 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00572

Ribosomal_L13

Ribosomal protein L13

38

156

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6spb-assembly1.cif.gz_J pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 0.9788 2 142
6ysi-assembly1.cif.gz_F acinetobacter baumannii ribosome-tigecycline complex - 50s subunit 0.9764 1 142
5xym-assembly1.cif.gz_J large subunit of mycobacterium smegmatis 0.974 3 142
6spb-assembly1.cif.gz_J pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 0.972 2 142
7mt7-assembly1.cif.gz_J mtb 70s with p and e site trnas 0.9709 3 142
ID Description Score Start End Superfamily
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9627 1 142 3.90.1180.10
af_Q4CZX3_36_177_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9614 10 140 3.90.1180.10
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.956 1 142 3.90.1180.10
af_A0A0R0E7H3_25_163_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9524 12 142 3.90.1180.10
af_C6SWN9_25_183_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9516 12 142 3.90.1180.10
ID Description Score Start End GO Terms
AF-A0A3D2V084-F1-model_v4 50S ribosomal protein L13 0.9928 15 142 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A1I8ACL4-F1-model_v4 Semialdhyde_dh domain-containing protein 0.9916 1 127 GO:0003735
GO:0003942
GO:0005840
GO:0006412
GO:0006526
GO:0051287
GO:0070401
GO:1990904
AF-A0A357TH06-F1-model_v4 50S ribosomal protein L13 0.9915 13 142 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A5E4W4W0-F1-model_v4 Large ribosomal subunit protein uL13 0.9913 1 142 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A7K1DJB2-F1-model_v4 50S ribosomal protein L13 0.9913 15 142 GO:0003729
GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0017148
GO:1990904

Feature Viewer

pLDDT pTM Quality
86.68 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map