F459902

General Info

Members Datasets Scaffolds Average Seq Length
530 256 530 349

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10020731|Ga0065715_100207311
Length 388
Sequence MMTTSTVVRLAGALAMVVWIDAQGTSVKAQQRGGTAETDKVQPVNSGPNPYRVIRDWAQLTLEKRPWGGSNGVAIDRDGKSVWATDRCSPGIAPGCLGTKANPIHLFDETGKEVRSFGGGMFVWPHGIHVDREGNVWVTDARVPTAEERTKFPGEDKKGSVVIKFSRDGKALMTLGKPGAKGDGDVYVAESHTNVDDPKLVGRISVFNRNGNFLRVIGRTGTGPGEFRTPHAIRFDSQRRLIVADRHNHRIQILTKEGKYLGEWREFGRVSGLAIDGNDIIYAADSESDPKRHPDWLKGIRIGSLTDGKVTIFVPPHKTDAPDGAMGEGIAIDSAGNLFTAEATIRGVTKYVKDXMRTXRKVGRACIEKDSPAGRLLRGFAGMXHMRV

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
144 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
170 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
171 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
172 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
173 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
174 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
183 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
189 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
190 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
195 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
200 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
208 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
209 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
217 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
252 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.64
Rhizosphere 97.17
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001085 3300003203 Bacteria 12771
2 Ga0065714_10087600 3300005288 Unclassified 2051
3 Ga0065712_10009208 3300005290 Bacteria 2508
4 Ga0065715_10005897 3300005293 Bacteria 5750
5 Ga0065715_10012322 3300005293 Unclassified 2597
6 Ga0065715_10020731 3300005293 Unclassified 2124
7 Ga0065715_10089355 3300005293 Bacteria 10935
8 Ga0065715_10223059 3300005293 Unclassified 1264
9 Ga0065707_10094052 3300005295 Bacteria 3538
10 Ga0065707_10126867 3300005295 Bacteria 1995
11 Ga0065707_10149666 3300005295 Unclassified 1656
12 Ga0065707_10174666 3300005295 Bacteria 1459
13 Ga0070676_10026333 3300005328 Bacteria 3292
14 Ga0070683_100022360 3300005329 Bacteria 5651
15 Ga0070690_100014612 3300005330 Bacteria 4660
16 Ga0070690_100074318 3300005330 Unclassified 2213
17 Ga0070677_10020198 3300005333 Bacteria 2423
18 Ga0070677_10099929 3300005333 Bacteria 1277
19 Ga0068869_100065251 3300005334 Unclassified 2679
20 Ga0068869_100116937 3300005334 Unclassified 2035
21 Ga0068869_100175113 3300005334 Unclassified 1678
22 Ga0068869_100222705 3300005334 Unclassified 1496
23 Ga0070666_10057936 3300005335 Bacteria 2619
24 Ga0068868_100010145 3300005338 Bacteria 6806
25 Ga0068868_100155676 3300005338 Unclassified 1885
26 Ga0068868_100228068 3300005338 Unclassified 1562
27 Ga0070660_100119489 3300005339 Unclassified 2102
28 Ga0070689_100021346 3300005340 Unclassified 4820
29 Ga0070687_100086088 3300005343 Bacteria 1726
30 Ga0070661_100039715 3300005344 Bacteria 3430
31 Ga0070669_100020283 3300005353 Unclassified 4747
32 Ga0070669_100043889 3300005353 Unclassified 3257
33 Ga0070675_100053208 3300005354 Bacteria 3329
34 Ga0070675_100064586 3300005354 Bacteria 3026
35 Ga0070675_100083966 3300005354 Unclassified 2659
36 Ga0070671_100044018 3300005355 Unclassified 3709
37 Ga0070671_100051591 3300005355 Bacteria 3421
38 Ga0070671_100054563 3300005355 Bacteria 3323
39 Ga0070671_100104840 3300005355 Bacteria 2373
40 Ga0070674_100019519 3300005356 Unclassified 4307
41 Ga0070674_100184671 3300005356 Bacteria 1600
42 Ga0070673_100003697 3300005364 Bacteria 9582
43 Ga0070673_100013605 3300005364 Bacteria 5637
44 Ga0070673_100051124 3300005364 Unclassified 3234
45 Ga0070688_100050401 3300005365 Bacteria 2593
46 Ga0070667_100016918 3300005367 Bacteria 6035
47 Ga0070667_100062416 3300005367 Unclassified 3156
48 Ga0070709_10020907 3300005434 Unclassified 3807
49 Ga0070713_100071328 3300005436 Bacteria 2935
50 Ga0070713_100188545 3300005436 Unclassified 1857
51 Ga0070713_100226462 3300005436 Unclassified 1698
52 Ga0070701_10006253 3300005438 Unclassified 4997
53 Ga0070701_10026945 3300005438 Bacteria 2809
54 Ga0070694_100075536 3300005444 Unclassified 2331
55 Ga0070694_100273182 3300005444 Unclassified 1286
56 Ga0070678_100011635 3300005456 Bacteria 5436
57 Ga0070678_100015207 3300005456 Unclassified 4884
58 Ga0070678_100054063 3300005456 Unclassified 2924
59 Ga0070678_100227331 3300005456 Bacteria 1554
60 Ga0070662_100004709 3300005457 Bacteria 8650
61 Ga0070681_10003849 3300005458 Bacteria 14117
62 Ga0070681_10039175 3300005458 Bacteria 4751
63 Ga0068867_100015031 3300005459 Bacteria 5488
64 Ga0068867_100120806 3300005459 Bacteria 2025
65 Ga0070685_10016609 3300005466 Bacteria 3925
66 Ga0070707_100139772 3300005468 Unclassified 2357
67 Ga0070707_100198431 3300005468 Bacteria 1956
68 Ga0070707_100400975 3300005468 Unclassified 1332
69 Ga0070698_100123558 3300005471 Bacteria 2546
70 Ga0070698_100129028 3300005471 Unclassified 2485
71 Ga0070699_100012959 3300005518 Bacteria 7185
72 Ga0070684_100024270 3300005535 Bacteria 5084
73 Ga0070684_100329897 3300005535 Bacteria 1402
74 Ga0068853_100082608 3300005539 Bacteria 2814
75 Ga0070672_100058506 3300005543 Bacteria 3030
76 Ga0070672_100158457 3300005543 Unclassified 1876
77 Ga0070686_100009775 3300005544 Bacteria 5390
78 Ga0070695_100018179 3300005545 Bacteria 4268
79 Ga0070665_100169811 3300005548 Unclassified 2182
80 Ga0070704_100012587 3300005549 Bacteria 5228
81 Ga0070704_100040153 3300005549 Bacteria 3219
82 Ga0070704_100116781 3300005549 Bacteria 2041
83 Ga0070704_100226383 3300005549 Bacteria 1523
84 Ga0068855_100013416 3300005563 Bacteria 9880
85 Ga0068855_100102960 3300005563 Unclassified 3285
86 Ga0070664_100008705 3300005564 Bacteria 8216
87 Ga0068857_100126564 3300005577 Bacteria 2302
88 Ga0068857_100127822 3300005577 Bacteria 2290
89 Ga0068852_100092400 3300005616 Unclassified 2710
90 Ga0068852_100178002 3300005616 Bacteria 1998
91 Ga0068859_100006551 3300005617 Bacteria 11820
92 Ga0068864_100059601 3300005618 Unclassified 3303
93 Ga0068864_100121352 3300005618 Unclassified 2337
94 Ga0068864_100468108 3300005618 Unclassified 1208
95 Ga0068861_100086284 3300005719 Bacteria 2467
96 Ga0068861_100141542 3300005719 Bacteria 1964
97 Ga0068861_100189101 3300005719 Bacteria 1720
98 Ga0068870_10002696 3300005840 Bacteria 7443
99 Ga0068870_10008107 3300005840 Unclassified 4709
100 Ga0068863_100051532 3300005841 Bacteria 3901
101 Ga0068863_100170633 3300005841 Bacteria 2086
102 Ga0068858_100001351 3300005842 Bacteria 25297
103 Ga0068858_100027619 3300005842 Bacteria 5272
104 Ga0068858_100087366 3300005842 Bacteria 2900
105 Ga0068858_100387908 3300005842 Bacteria 1341
106 Ga0068860_100004137 3300005843 Bacteria 14874
107 Ga0068860_100053410 3300005843 Bacteria 3842
108 Ga0068860_100088857 3300005843 Unclassified 2941
109 Ga0068862_100022549 3300005844 Bacteria 5268
110 Ga0068862_100075872 3300005844 Bacteria 2909
111 Ga0068862_100267313 3300005844 Unclassified 1563
112 Ga0081455_10023012 3300005937 Bacteria 5809
113 Ga0081455_10063048 3300005937 Bacteria 3112
114 Ga0081540_1015506 3300005983 Plasmid 4822
115 Ga0081539_10000010 3300005985 Bacteria 484386
116 Ga0081539_10001123 3300005985 Bacteria 48558
117 Ga0081539_10003380 3300005985 Bacteria 19763
118 Ga0097621_100017933 3300006237 Bacteria 5391
119 Ga0097621_100040603 3300006237 Bacteria 3742
120 Ga0097621_100181538 3300006237 Unclassified 1818
121 Ga0097621_100223596 3300006237 Unclassified 1641
122 Ga0068871_100005092 3300006358 Bacteria 9181
123 Ga0068871_100141282 3300006358 Bacteria 2047
124 Ga0075428_100000671 3300006844 Bacteria 35135
125 Ga0075428_100003051 3300006844 Bacteria 18264
126 Ga0075428_100098239 3300006844 Bacteria 3192
127 Ga0075430_100000342 3300006846 Bacteria 33715
128 Ga0075430_100004736 3300006846 Bacteria 11445
129 Ga0075430_100105626 3300006846 Bacteria 2350
130 Ga0075430_100176023 3300006846 Unclassified 1780
131 Ga0075431_100012528 3300006847 Bacteria 8559
132 Ga0075431_100017720 3300006847 Bacteria 7241
133 Ga0075431_100054575 3300006847 Unclassified 4121
134 Ga0075431_100154821 3300006847 Bacteria 2358
135 Ga0075431_100168997 3300006847 Unclassified 2247
136 Ga0075431_100269643 3300006847 Unclassified 1725
137 Ga0075431_100428808 3300006847 Unclassified 1321
138 Ga0075433_10001202 3300006852 Bacteria 18854
139 Ga0075433_10001870 3300006852 Bacteria 15820
140 Ga0075433_10230909 3300006852 Bacteria 1643
141 Ga0075434_100001267 3300006871 Bacteria 21044
142 Ga0075434_100007176 3300006871 Bacteria 10302
143 Ga0075434_100041547 3300006871 Bacteria 4556
144 Ga0075434_100097773 3300006871 Unclassified 2940
145 Ga0075429_100001556 3300006880 Bacteria 18839
146 Ga0075429_100011042 3300006880 Bacteria 7816
147 Ga0075429_100014050 3300006880 Bacteria 6940
148 Ga0075429_100015477 3300006880 Bacteria 6610
149 Ga0068865_100017599 3300006881 Unclassified 4599
150 Ga0068865_100027656 3300006881 Bacteria 3748
151 Ga0068865_100036402 3300006881 Bacteria 3318
152 Ga0075436_100030830 3300006914 Bacteria 3690
153 Ga0075436_100109329 3300006914 Bacteria 1929
154 Ga0097620_100006551 3300006931 Bacteria 11820
155 Ga0075435_100002821 3300007076 Bacteria 11625
156 Ga0075435_100032148 3300007076 Bacteria 4142
157 Ga0099794_10093151 3300007265 Bacteria 1497
158 Ga0099795_10012027 3300007788 Bacteria 2610
159 Ga0105240_10055728 3300009093 Bacteria 4949
160 Ga0105240_10205218 3300009093 Bacteria 2307
161 Ga0111539_10005554 3300009094 Bacteria 16306
162 Ga0111539_10011039 3300009094 Bacteria 11363
163 Ga0111539_10011138 3300009094 Bacteria 11313
164 Ga0111539_10033694 3300009094 Bacteria 6216
165 Ga0111539_10042777 3300009094 Bacteria 5436
166 Ga0111539_10112896 3300009094 Bacteria 3187
167 Ga0111539_10222987 3300009094 Unclassified 2196
168 Ga0111539_10371634 3300009094 Bacteria 1664
169 Ga0105245_10002799 3300009098 Bacteria 15690
170 Ga0105245_10015703 3300009098 Bacteria 6602
171 Ga0105245_10077017 3300009098 Unclassified 3039
172 Ga0105245_10262164 3300009098 Bacteria 1682
173 Ga0105245_10512704 3300009098 Bacteria 1217
174 Ga0105247_10151240 3300009101 Unclassified 1529
175 Ga0114129_10003741 3300009147 Bacteria 21454
176 Ga0114129_10019932 3300009147 Bacteria 9546
177 Ga0114129_10020076 3300009147 Bacteria 9511
178 Ga0114129_10029461 3300009147 Bacteria 7775
179 Ga0114129_10068758 3300009147 Bacteria 4938
180 Ga0114129_10119167 3300009147 Bacteria 3636
181 Ga0114129_10153105 3300009147 Unclassified 3155
182 Ga0105243_10206658 3300009148 Bacteria 1726
183 Ga0105242_10002798 3300009176 Bacteria 13663
184 Ga0105242_10006040 3300009176 Bacteria 9333
185 Ga0105242_10087416 3300009176 Unclassified 2617
186 Ga0105242_10140239 3300009176 Bacteria 2097
187 Ga0105242_10234856 3300009176 Unclassified 1645
188 Ga0105248_10009554 3300009177 Bacteria 10673
189 Ga0105248_10009933 3300009177 Bacteria 10475
190 Ga0105248_10028518 3300009177 Bacteria 6220
191 Ga0105248_10068038 3300009177 Bacteria 3999
192 Ga0105248_10076703 3300009177 Bacteria 3756
193 Ga0105248_10106549 3300009177 Bacteria 3160
194 Ga0105248_10242330 3300009177 Bacteria 2029
195 Ga0105248_10431387 3300009177 Bacteria 1484
196 Ga0105237_10055938 3300009545 Bacteria 3951
197 Ga0105238_10003498 3300009551 Bacteria 15635
198 Ga0105238_10007551 3300009551 Bacteria 10890
199 Ga0105238_10343246 3300009551 Unclassified 1482
200 Ga0105239_10182832 3300010375 Bacteria 2345
201 Ga0157370_10000570 3300013104 Bacteria 46011
202 Ga0157374_10080339 3300013296 Bacteria 3093
203 Ga0157374_10548694 3300013296 Unclassified 1163
204 Ga0157378_10016812 3300013297 Bacteria 6411
205 Ga0157378_10172554 3300013297 Bacteria 2029
206 Ga0163162_10006888 3300013306 Bacteria 11029
207 Ga0163162_10024011 3300013306 Bacteria 6017
208 Ga0163162_10062217 3300013306 Bacteria 3773
209 Ga0163162_10188416 3300013306 Bacteria 2190
210 Ga0163162_10226708 3300013306 Bacteria 1998
211 Ga0163162_10367235 3300013306 Bacteria 1572
212 Ga0157372_10070557 3300013307 Unclassified 3931
213 Ga0157375_10048147 3300013308 Unclassified 4168
214 Ga0157375_10062200 3300013308 Bacteria 3709
215 Ga0157375_10270911 3300013308 Unclassified 1860
216 Ga0157375_10323829 3300013308 Unclassified 1706
217 Ga0157375_10681158 3300013308 Unclassified 1183
218 Ga0163163_10011417 3300014325 Bacteria 8055
219 Ga0163163_10096972 3300014325 Unclassified 2969
220 Ga0163163_10111750 3300014325 Unclassified 2761
221 Ga0157380_10003682 3300014326 Bacteria 10546
222 Ga0157380_10012175 3300014326 Bacteria 6232
223 Ga0157380_10016294 3300014326 Bacteria 5478
224 Ga0157377_10015214 3300014745 Bacteria 3929
225 Ga0157376_10001464 3300014969 Bacteria 15555
226 Ga0157376_10015129 3300014969 Bacteria 5816
227 Ga0157376_10301862 3300014969 Unclassified 1516
228 Ga0207682_10000800 3300025893 Bacteria 14530
229 Ga0207642_10155294 3300025899 Bacteria 1223
230 Ga0207688_10024087 3300025901 Bacteria 3337
231 Ga0207699_10082670 3300025906 Bacteria 1995
232 Ga0207645_10005880 3300025907 Bacteria 8837
233 Ga0207645_10064515 3300025907 Bacteria 2340
234 Ga0207645_10086692 3300025907 Unclassified 2012
235 Ga0207643_10000941 3300025908 Bacteria 17466
236 Ga0207643_10008053 3300025908 Bacteria 5653
237 Ga0207707_10088645 3300025912 Unclassified 2703
238 Ga0207707_10334118 3300025912 Bacteria 1307
239 Ga0207695_10052420 3300025913 Bacteria 4275
240 Ga0207695_10147462 3300025913 Bacteria 2295
241 Ga0207671_10011000 3300025914 Bacteria 7409
242 Ga0207671_10290391 3300025914 Unclassified 1291
243 Ga0207662_10050444 3300025918 Bacteria 2472
244 Ga0207657_10092760 3300025919 Bacteria 2516
245 Ga0207652_10248217 3300025921 Unclassified 1605
246 Ga0207646_10154071 3300025922 Bacteria 2072
247 Ga0207646_10169102 3300025922 Bacteria 1974
248 Ga0207681_10060264 3300025923 Unclassified 2604
249 Ga0207681_10060987 3300025923 Unclassified 2591
250 Ga0207694_10002029 3300025924 Bacteria 16764
251 Ga0207694_10009724 3300025924 Bacteria 7254
252 Ga0207694_10240092 3300025924 Unclassified 1481
253 Ga0207650_10090673 3300025925 Bacteria 2335
254 Ga0207659_10061401 3300025926 Bacteria 2709
255 Ga0207687_10001360 3300025927 Bacteria 16724
256 Ga0207687_10022675 3300025927 Bacteria 4181
257 Ga0207700_10160015 3300025928 Bacteria 1869
258 Ga0207700_10179037 3300025928 Bacteria 1774
259 Ga0207644_10032666 3300025931 Unclassified 3633
260 Ga0207644_10279843 3300025931 Bacteria 1339
261 Ga0207706_10002760 3300025933 Bacteria 17077
262 Ga0207706_10065055 3300025933 Unclassified 3211
263 Ga0207686_10009873 3300025934 Bacteria 5187
264 Ga0207686_10016842 3300025934 Bacteria 4106
265 Ga0207686_10042178 3300025934 Bacteria 2787
266 Ga0207686_10089946 3300025934 Bacteria 2024
267 Ga0207686_10144282 3300025934 Unclassified 1649
268 Ga0207686_10176284 3300025934 Bacteria 1512
269 Ga0207669_10013181 3300025937 Unclassified 4095
270 Ga0207704_10023554 3300025938 Unclassified 3321
271 Ga0207704_10037376 3300025938 Bacteria 2804
272 Ga0207704_10135892 3300025938 Bacteria 1711
273 Ga0207704_10174411 3300025938 Unclassified 1546
274 Ga0207691_10026050 3300025940 Bacteria 5488
275 Ga0207691_10075850 3300025940 Bacteria 3031
276 Ga0207691_10235856 3300025940 Bacteria 1583
277 Ga0207711_10008109 3300025941 Bacteria 8792
278 Ga0207711_10095178 3300025941 Bacteria 2626
279 Ga0207711_10114005 3300025941 Bacteria 2407
280 Ga0207711_10238982 3300025941 Bacteria 1665
281 Ga0207689_10004772 3300025942 Bacteria 12226
282 Ga0207689_10060895 3300025942 Bacteria 3104
283 Ga0207689_10080083 3300025942 Bacteria 2684
284 Ga0207689_10265747 3300025942 Unclassified 1420
285 Ga0207661_10022391 3300025944 Bacteria 4759
286 Ga0207679_10042708 3300025945 Bacteria 3260
287 Ga0207667_10057303 3300025949 Unclassified 4090
288 Ga0207667_10078514 3300025949 Bacteria 3421
289 Ga0207651_10010839 3300025960 Bacteria 5072
290 Ga0207651_10021257 3300025960 Unclassified 3940
291 Ga0207651_10030552 3300025960 Unclassified 3432
292 Ga0207651_10048489 3300025960 Bacteria 2872
293 Ga0207651_10064775 3300025960 Bacteria 2560
294 Ga0207658_10006450 3300025986 Bacteria 8007
295 Ga0207658_10099215 3300025986 Bacteria 2277
296 Ga0207703_10020302 3300026035 Bacteria 5195
297 Ga0207639_10068572 3300026041 Bacteria 2764
298 Ga0207708_10042995 3300026075 Unclassified 3443
299 Ga0207702_10021413 3300026078 Bacteria 5353
300 Ga0207641_10012782 3300026088 Bacteria 6881
301 Ga0207641_10038701 3300026088 Bacteria 3987
302 Ga0207641_10141550 3300026088 Bacteria 2171
303 Ga0207648_10006379 3300026089 Bacteria 11724
304 Ga0207648_10069308 3300026089 Bacteria 3073
305 Ga0207648_10256192 3300026089 Bacteria 1561
306 Ga0207648_10258190 3300026089 Unclassified 1554
307 Ga0207676_10115916 3300026095 Unclassified 2250
308 Ga0207674_10077948 3300026116 Bacteria 3319
309 Ga0207675_100033671 3300026118 Unclassified 4774
310 Ga0207675_100364796 3300026118 Bacteria 1418
311 Ga0207683_10034303 3300026121 Unclassified 4409
312 Ga0207683_10078904 3300026121 Bacteria 2918
313 Ga0207683_10086073 3300026121 Bacteria 2794
314 Ga0207698_10065480 3300026142 Unclassified 2854
315 Ga0207698_10135106 3300026142 Bacteria 2115
316 Ga0207428_10001471 3300027907 Bacteria 24652
317 Ga0207428_10003846 3300027907 Bacteria 14398
318 Ga0268266_10105825 3300028379 Bacteria 2486
319 Ga0268266_10160844 3300028379 Unclassified 2031
320 Ga0268266_10319326 3300028379 Bacteria 1453
321 Ga0268265_10026193 3300028380 Unclassified 4146
322 Ga0268265_10088693 3300028380 Bacteria 2465
323 Ga0268265_10156003 3300028380 Unclassified 1932
324 Ga0265313_10022892 3300031595 Bacteria 3378
325 Ga0265314_10000688 3300031711 Bacteria 41004
326 Ga0307409_100017751 3300031995 Bacteria 4756
327 Ga0307411_10090262 3300032005 Bacteria 2137
328 Ga0307411_10157777 3300032005 Bacteria 1695
329 Ga0373926_0060627 3300035083 Bacteria 1379
330 Ga0373923_0011295 3300035111 Bacteria 3272
331 Ga0373936_0001992 3300035113 Bacteria 7562
332 Ga0373945_0026719 3300035116 Bacteria 2012
333 Ga0373945_0029477 3300035116 Unclassified 1929
334 Ga0373953_0001201 3300035117 Bacteria 7382
335 Ga0373953_0026047 3300035117 Bacteria 2239
336 Ga0373954_0002785 3300035118 Bacteria 7367
337 Ga0373943_0017142 3300035170 Unclassified 3313
338 Ga0373946_0001775 3300035171 Bacteria 7518
339 Ga0373946_0012588 3300035171 Bacteria 3169
340 Ga0373955_0000132 3300035172 Bacteria 29609
341 Ga0373955_0029585 3300035172 Unclassified 2850
342 Ga0373962_0064323 3300035242 Bacteria 1084
343 Ga0373935_0000291 3300035692 Bacteria 24802
344 Ga0373935_0008286 3300035692 Bacteria 6220
345 Ga0373935_0038590 3300035692 Bacteria 2991
346 Ga0373935_0166961 3300035692 Bacteria 1503
347 Ga0373927_0012906 3300035695 Bacteria 5556
348 Ga0373927_0063377 3300035695 Unclassified 2391
349 Ga0373927_0137632 3300035695 Bacteria 1596
350 Ga0373933_0026680 3300035724 Unclassified 3319
351 Ga0373947_0002232 3300035725 Bacteria 11714
352 Ga0373947_0022225 3300035725 Bacteria 3676
353 Ga0373947_0072939 3300035725 Unclassified 2109
354 Ga0373937_0000004 3300036401 Bacteria 212269
355 Ga0373937_0054617 3300036401 Bacteria 3666
356 Ga0373937_0099528 3300036401 Bacteria 2697
357 Ga0373937_0124128 3300036401 Bacteria 2408
358 Ga0373925_0000460 3300037068 Bacteria 41057
359 Ga0373925_0005039 3300037068 Bacteria 9912
360 Ga0373925_0043588 3300037068 Unclassified 3331
361 Ga0373925_0050218 3300037068 Unclassified 3111
362 Ga0373925_0053102 3300037068 Bacteria 3029
363 Ga0373925_0070111 3300037068 Bacteria 2649
364 Ga0373925_0081823 3300037068 Bacteria 2456
365 Ga0436363_0625030 3300039450 Bacteria 7567
366 Ga0439435_0010511 3300042436 Bacteria 2197
367 Ga0451576_0021989 3300045051 Bacteria 6924
368 Ga0495592_0000029 3300046454 Bacteria 131879
369 Ga0495603_0092350 3300046455 Unclassified 1769
370 Ga0495603_0155000 3300046455 Unclassified 1330
371 Ga0495629_0012909 3300046459 Bacteria 6042
372 Ga0495629_0203450 3300046459 Bacteria 1369
373 Ga0495651_0001216 3300046462 Bacteria 19890
374 Ga0495653_0000012 3300046463 Bacteria 266880
375 Ga0495580_0009761 3300046472 Bacteria 7528
376 Ga0495582_0014127 3300046473 Bacteria 4394
377 Ga0495582_0019002 3300046473 Bacteria 3761
378 Ga0495605_0124909 3300046474 Bacteria 1164
379 Ga0495639_0025722 3300046475 Bacteria 2597
380 Ga0495639_0067136 3300046475 Unclassified 1652
381 Ga0495639_0072984 3300046475 Bacteria 1588
382 Ga0495662_0000344 3300046476 Bacteria 20328
383 Ga0495664_0000004 3300046477 Bacteria 489411
384 Ga0495664_0119702 3300046477 Bacteria 1593
385 Ga0495584_0026307 3300046491 Bacteria 2947
386 Ga0495585_0068472 3300046492 Unclassified 1939
387 Ga0495594_0003464 3300046499 Bacteria 8146
388 Ga0495594_0023891 3300046499 Unclassified 3279
389 Ga0495607_0080892 3300046501 Unclassified 1785
390 Ga0495608_0000017 3300046511 Bacteria 192929
391 Ga0495616_0075489 3300046513 Bacteria 1622
392 Ga0495618_0000006 3300046514 Bacteria 229906
393 Ga0495628_0000001 3300046516 Bacteria 917742
394 Ga0495630_0008041 3300046517 Bacteria 7582
395 Ga0495630_0149318 3300046517 Bacteria 1778
396 Ga0495631_0092622 3300046518 Unclassified 1301
397 Ga0495637_0023960 3300046520 Unclassified 2764
398 Ga0495652_0000002 3300046529 Bacteria 946606
399 Ga0495665_0009488 3300046531 Bacteria 5268
400 Ga0495640_0000001 3300046533 Bacteria 853827
401 Ga0495640_0024836 3300046533 Bacteria 4354
402 Ga0495587_0000008 3300046536 Bacteria 271097
403 Ga0495598_0005223 3300046537 Bacteria 2864
404 Ga0495598_0014871 3300046537 Unclassified 1953
405 Ga0495609_0098177 3300046538 Bacteria 1270
406 Ga0495621_0014412 3300046539 Unclassified 2501
407 Ga0495645_0000002 3300046543 Bacteria 651644
408 Ga0495633_0021834 3300046558 Unclassified 3196
409 Ga0495667_0000029 3300046559 Bacteria 151568
410 Ga0495667_0064697 3300046559 Unclassified 2392
411 Ga0495656_0009620 3300046615 Bacteria 3483
412 Ga0495668_0055726 3300046616 Unclassified 2183
413 Ga0495634_0003829 3300046642 Bacteria 11950
414 Ga0495634_0038958 3300046642 Bacteria 3239
415 Ga0495634_0109967 3300046642 Bacteria 1773
416 Ga0495611_0036999 3300046648 Unclassified 2168
417 Ga0495635_0000002 3300046663 Bacteria 490490
418 Ga0495659_0011228 3300046664 Bacteria 2885
419 Ga0495657_0000459 3300046675 Bacteria 38116
420 Ga0495599_0000247 3300046678 Bacteria 34186
421 Ga0495623_0009278 3300046679 Bacteria 6387
422 Ga0495623_0126540 3300046679 Bacteria 1534
423 Ga0495646_0000064 3300046680 Bacteria 50992
424 Ga0495658_0025337 3300046683 Bacteria 3169
425 Ga0495658_0055215 3300046683 Bacteria 2262
426 Ga0495658_0121976 3300046683 Unclassified 1577
427 Ga0495658_0134671 3300046683 Bacteria 1507
428 Ga0495658_0245787 3300046683 Bacteria 1124
429 Ga0495613_0083995 3300046689 Bacteria 2312
430 Ga0495613_0129799 3300046689 Bacteria 1805
431 Ga0495624_0006416 3300046690 Bacteria 8345
432 Ga0495624_0091362 3300046690 Unclassified 1878
433 Ga0495670_0030241 3300046691 Bacteria 2690
434 Ga0495649_0084003 3300046694 Unclassified 1701
435 Ga0495589_0135468 3300046794 Unclassified 1181
436 Ga0495600_0002611 3300046809 Bacteria 10388
437 Ga0495581_0018382 3300047315 Unclassified 4059
438 Ga0495581_0055274 3300047315 Bacteria 2291
439 Ga0495581_0271406 3300047315 Bacteria 992
440 Ga0495604_0000009 3300047317 Bacteria 326341
441 Ga0495604_0184093 3300047317 Unclassified 1460
442 Ga0495674_0000002 3300047319 Bacteria 642785
443 Ga0495674_0052279 3300047319 Unclassified 3596
444 Ga0495676_0150029 3300047321 Unclassified 1660
445 Ga0495680_0000752 3300047322 Bacteria 36296
446 Ga0495683_0052146 3300047323 Bacteria 2043
447 Ga0495675_0000028 3300047444 Bacteria 105848
448 Ga0495684_0000006 3300047471 Bacteria 247568
449 Ga0495684_0186602 3300047471 Unclassified 1535
450 Ga0495593_0000268 3300047673 Bacteria 28172
451 Ga0495602_0000005 3300048088 Bacteria 325957
452 Ga0496100_0005342 3300048903 Bacteria 6908
453 Ga0496102_0169653 3300048905 Bacteria 2054
454 Ga0496104_0001072 3300048907 Bacteria 23341
455 Ga0496104_0252113 3300048907 Unclassified 1678
456 Ga0496105_0116722 3300048908 Bacteria 2202
457 Ga0496106_0019992 3300048909 Bacteria 4966
458 Ga0496109_0127136 3300048912 Bacteria 2376
459 Ga0496114_0000906 3300048917 Bacteria 22197
460 Ga0496114_0090104 3300048917 Bacteria 2603
461 Ga0496114_0127259 3300048917 Bacteria 2197
462 Ga0496114_0272009 3300048917 Unclassified 1493
463 Ga0496115_0027972 3300048918 Bacteria 4415
464 Ga0496115_0094377 3300048918 Bacteria 2447
465 Ga0496115_0191537 3300048918 Bacteria 1690
466 Ga0501039_0094842 3300049575 Unclassified 2326
467 Ga0501039_0157197 3300049575 Unclassified 1786
468 Ga0501040_0056735 3300049576 Bacteria 2688
469 Ga0501040_0068174 3300049576 Bacteria 2453
470 Ga0501040_0166142 3300049576 Unclassified 1561
471 Ga0501041_0057559 3300049577 Bacteria 2377
472 Ga0501042_0014447 3300049578 Bacteria 5390
473 Ga0501042_0024196 3300049578 Bacteria 4258
474 Ga0501048_0121909 3300049582 Unclassified 1842
475 Ga0501075_0021967 3300049591 Unclassified 4657
476 Ga0501075_0023196 3300049591 Bacteria 4541
477 Ga0501075_0031520 3300049591 Unclassified 3935
478 Ga0501076_0040571 3300049592 Unclassified 3659
479 Ga0501076_0115869 3300049592 Unclassified 2168
480 Ga0501079_0016592 3300049741 Bacteria 5624
481 Ga0501079_0055352 3300049741 Bacteria 3061
482 Ga0501081_0001316 3300049743 Bacteria 15150
483 Ga0501081_0040920 3300049743 Unclassified 3173
484 Ga0501081_0042968 3300049743 Bacteria 3099
485 Ga0501083_0112876 3300049744 Unclassified 1786
486 Ga0501035_0090365 3300049822 Unclassified 2696
487 Ga0501045_0001602 3300049824 Bacteria 15127
488 Ga0501045_0143187 3300049824 Bacteria 1778
489 nmdc:mga05p37_1455_c1 3300050507 Bacteria 27534
490 nmdc:mga05p37_8616_c2 3300050507 Bacteria 9217
491 nmdc:mga09592_10400_c1 3300050508 Bacteria 7572
492 nmdc:mga09592_168123_c1 3300050508 Bacteria 1896
493 nmdc:mga09592_19614_c1 3300050508 Bacteria 5552
494 nmdc:mga09592_56461_c1 3300050508 Unclassified 3318
495 nmdc:mga0qj67_11886_c1 3300050509 Bacteria 6539
496 nmdc:mga0qj67_124221_c1 3300050509 Bacteria 2088
497 nmdc:mga0qj67_201_c1 3300050509 Bacteria 40409
498 nmdc:mga0qj67_34039_c1 3300050509 Bacteria 3978
499 nmdc:mga06r32_12636_c1 3300050510 Bacteria 7629
500 nmdc:mga06r32_204966_c1 3300050510 Bacteria 1960
501 nmdc:mga06r32_293731_c1 3300050510 Unclassified 1612
502 nmdc:mga06r32_50936_c1 3300050510 Unclassified 3961
503 nmdc:mga06r32_8322_c1 3300050510 Bacteria 9335
504 nmdc:mga08y16_156340_c1 3300050511 Bacteria 2369
505 nmdc:mga08y16_19077_c1 3300050511 Bacteria 7226
506 nmdc:mga08y16_25884_c1 3300050511 Bacteria 6190
507 nmdc:mga08y16_33047_c1 3300050511 Bacteria 5435
508 nmdc:mga0n895_1834_c1 3300050512 Bacteria 16199
509 nmdc:mga0n895_26604_c1 3300050512 Bacteria 5482
510 nmdc:mga0n895_29204_c1 3300050512 Bacteria 5256
511 nmdc:mga0n895_29332_c1 3300050512 Bacteria 5246
512 nmdc:mga0n895_59025_c1 3300050512 Unclassified 3785
513 nmdc:mga0n895_7126_c1 3300050512 Bacteria 9558
514 nmdc:mga0rr50_30654_c1 3300050513 Bacteria 3810
515 nmdc:mga0rr50_4619_c1 3300050513 Bacteria 8113
516 nmdc:mga08x19_112961_c1 3300050514 Bacteria 1814
517 nmdc:mga0a205_11870_c1 3300050515 Bacteria 8041
518 nmdc:mga0a205_155573_c1 3300050515 Unclassified 2185
519 nmdc:mga0a205_252354_c1 3300050515 Bacteria 1643
520 nmdc:mga0a205_4063_c1 3300050515 Bacteria 13083
521 nmdc:mga0a205_87962_c1 3300050515 Unclassified 3002
522 Ga0495601_0000002 3300053077 Bacteria 528704
523 Ga0495612_0000010 3300053078 Bacteria 227618
524 Ga0495612_0029063 3300053078 Bacteria 2225
525 Ga0495595_0001122 3300053084 Bacteria 10369
526 Ga0495619_0000019 3300053085 Bacteria 209518
527 Ga0501084_0039207 3300054114 Unclassified 3962
528 Ga0501084_0186967 3300054114 Unclassified 1748
529 Ga0501082_0007369 3300060353 Bacteria 9492
530 Ga0530510_0008298 3300061734 Bacteria 7243

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047315 Ga0495581_0271406 Ga0495581_0271406_20_976 280
2 3300046474 Ga0495605_0124909 Ga0495605_0124909_97_1128 305
3 3300046475 Ga0495639_0067136 Ga0495639_0067136_600_1631 305
4 3300046501 Ga0495607_0080892 Ga0495607_0080892_38_1069 305
5 3300046794 Ga0495589_0135468 Ga0495589_0135468_112_1143 305
6 3300035692 Ga0373935_0038590 Ga0373935_0038590_781_1812 306
7 3300035695 Ga0373927_0137632 Ga0373927_0137632_373_1404 306
8 3300037068 Ga0373925_0081823 Ga0373925_0081823_1024_2055 306
9 3300046517 Ga0495630_0149318 Ga0495630_0149318_56_1087 306
10 3300046533 Ga0495640_0024836 Ga0495640_0024836_1413_2444 306
11 3300046683 Ga0495658_0134671 Ga0495658_0134671_174_1205 306
12 3300048907 Ga0496104_0001072 Ga0496104_0001072_119_1150 306
13 3300048917 Ga0496114_0272009 Ga0496114_0272009_77_1108 306
14 3300046683 Ga0495658_0055215 Ga0495658_0055215_23_979 308
15 3300009098 Ga0105245_10512704 Ga0105245_105127041 316
16 3300039450 Ga0436363_0625030 Ga0436363_0625030_3279_4364 318
17 3300049576 Ga0501040_0056735 Ga0501040_0056735_943_2022 319
18 3300049578 Ga0501042_0014447 Ga0501042_0014447_3829_4908 319
19 3300049591 Ga0501075_0023196 Ga0501075_0023196_2625_3704 319
20 3300049741 Ga0501079_0055352 Ga0501079_0055352_239_1318 319
21 3300049744 Ga0501083_0112876 Ga0501083_0112876_768_1775 319
22 3300049577 Ga0501041_0057559 Ga0501041_0057559_536_1615 320
23 3300049743 Ga0501081_0042968 Ga0501081_0042968_1292_2371 320
24 3300046459 Ga0495629_0203450 Ga0495629_0203450_155_1213 321
25 3300046679 Ga0495623_0126540 Ga0495623_0126540_192_1250 321
26 3300009148 Ga0105243_10206658 Ga0105243_102066581 323
27 3300013306 Ga0163162_10188416 Ga0163162_101884163 323
28 3300025899 Ga0207642_10155294 Ga0207642_101552942 323
29 3300035116 Ga0373945_0029477 Ga0373945_0029477_215_1300 323
30 3300035170 Ga0373943_0017142 Ga0373943_0017142_1856_2953 323
31 3300035171 Ga0373946_0012588 Ga0373946_0012588_2001_3098 323
32 3300035172 Ga0373955_0029585 Ga0373955_0029585_193_1290 323
33 3300035692 Ga0373935_0008286 Ga0373935_0008286_3269_4366 323
34 3300035725 Ga0373947_0072939 Ga0373947_0072939_790_1875 323
35 3300036401 Ga0373937_0099528 Ga0373937_0099528_507_1604 323
36 3300037068 Ga0373925_0050218 Ga0373925_0050218_193_1290 323
37 3300046491 Ga0495584_0026307 Ga0495584_0026307_998_2083 323
38 3300046492 Ga0495585_0068472 Ga0495585_0068472_306_1391 323
39 3300046513 Ga0495616_0075489 Ga0495616_0075489_448_1533 323
40 3300046518 Ga0495631_0092622 Ga0495631_0092622_166_1251 323
41 3300046520 Ga0495637_0023960 Ga0495637_0023960_1138_2223 323
42 3300046537 Ga0495598_0005223 Ga0495598_0005223_1278_2363 323
43 3300046558 Ga0495633_0021834 Ga0495633_0021834_1127_2212 323
44 3300046615 Ga0495656_0009620 Ga0495656_0009620_1209_2294 323
45 3300046616 Ga0495668_0055726 Ga0495668_0055726_261_1346 323
46 3300046648 Ga0495611_0036999 Ga0495611_0036999_715_1800 323
47 3300046690 Ga0495624_0091362 Ga0495624_0091362_758_1843 323
48 3300046691 Ga0495670_0030241 Ga0495670_0030241_1120_2205 323
49 3300046694 Ga0495649_0084003 Ga0495649_0084003_175_1260 323
50 3300047321 Ga0495676_0150029 Ga0495676_0150029_405_1490 323
51 3300047323 Ga0495683_0052146 Ga0495683_0052146_285_1370 323
52 3300048905 Ga0496102_0169653 Ga0496102_0169653_71_1156 323
53 3300048909 Ga0496106_0019992 Ga0496106_0019992_3085_4170 323
54 3300048917 Ga0496114_0090104 Ga0496114_0090104_298_1383 323
55 3300048918 Ga0496115_0094377 Ga0496115_0094377_359_1444 323
56 3300006871 Ga0075434_100041547 Ga0075434_1000415472 324
57 3300006914 Ga0075436_100109329 Ga0075436_1001093292 324
58 3300007788 Ga0099795_10012027 Ga0099795_100120272 324
59 3300009101 Ga0105247_10151240 Ga0105247_101512402 324
60 3300035113 Ga0373936_0001992 Ga0373936_0001992_3419_4504 324
61 3300035116 Ga0373945_0026719 Ga0373945_0026719_35_1120 324
62 3300035117 Ga0373953_0001201 Ga0373953_0001201_1523_2608 324
63 3300035118 Ga0373954_0002785 Ga0373954_0002785_854_1939 324
64 3300035171 Ga0373946_0001775 Ga0373946_0001775_3321_4406 324
65 3300035172 Ga0373955_0000132 Ga0373955_0000132_17860_18945 324
66 3300035692 Ga0373935_0000291 Ga0373935_0000291_18631_19716 324
67 3300035725 Ga0373947_0002232 Ga0373947_0002232_9849_10934 324
68 3300036401 Ga0373937_0000004 Ga0373937_0000004_99821_100906 324
69 3300037068 Ga0373925_0000460 Ga0373925_0000460_17171_18256 324
70 3300046454 Ga0495592_0000029 Ga0495592_0000029_113963_115048 324
71 3300046459 Ga0495629_0012909 Ga0495629_0012909_2112_3197 324
72 3300046462 Ga0495651_0001216 Ga0495651_0001216_14651_15736 324
73 3300046463 Ga0495653_0000012 Ga0495653_0000012_237605_238690 324
74 3300046476 Ga0495662_0000344 Ga0495662_0000344_3495_4580 324
75 3300046477 Ga0495664_0000004 Ga0495664_0000004_143627_144712 324
76 3300046511 Ga0495608_0000017 Ga0495608_0000017_143614_144699 324
77 3300046514 Ga0495618_0000006 Ga0495618_0000006_102720_103805 324
78 3300046516 Ga0495628_0000001 Ga0495628_0000001_143616_144701 324
79 3300046517 Ga0495630_0008041 Ga0495630_0008041_1256_2341 324
80 3300046529 Ga0495652_0000002 Ga0495652_0000002_358150_359235 324
81 3300046533 Ga0495640_0000001 Ga0495640_0000001_452154_453239 324
82 3300046536 Ga0495587_0000008 Ga0495587_0000008_143834_144919 324
83 3300046543 Ga0495645_0000002 Ga0495645_0000002_143629_144714 324
84 3300046559 Ga0495667_0000029 Ga0495667_0000029_143625_144710 324
85 3300046642 Ga0495634_0003829 Ga0495634_0003829_6892_7977 324
86 3300046663 Ga0495635_0000002 Ga0495635_0000002_342223_343308 324
87 3300046675 Ga0495657_0000459 Ga0495657_0000459_28140_29225 324
88 3300046678 Ga0495599_0000247 Ga0495599_0000247_6041_7126 324
89 3300046679 Ga0495623_0009278 Ga0495623_0009278_242_1327 324
90 3300046680 Ga0495646_0000064 Ga0495646_0000064_16548_17633 324
91 3300046683 Ga0495658_0245787 Ga0495658_0245787_11_1096 324
92 3300046689 Ga0495613_0129799 Ga0495613_0129799_463_1548 324
93 3300046690 Ga0495624_0006416 Ga0495624_0006416_3095_4180 324
94 3300046809 Ga0495600_0002611 Ga0495600_0002611_5085_6170 324
95 3300047315 Ga0495581_0018382 Ga0495581_0018382_1412_2497 324
96 3300047317 Ga0495604_0000009 Ga0495604_0000009_181591_182676 324
97 3300047319 Ga0495674_0000002 Ga0495674_0000002_143617_144702 324
98 3300047322 Ga0495680_0000752 Ga0495680_0000752_7561_8646 324
99 3300047444 Ga0495675_0000028 Ga0495675_0000028_93240_94325 324
100 3300047471 Ga0495684_0000006 Ga0495684_0000006_143576_144661 324
101 3300047673 Ga0495593_0000268 Ga0495593_0000268_17182_18267 324
102 3300048088 Ga0495602_0000005 Ga0495602_0000005_200972_202057 324
103 3300050512 nmdc:mga0n895_29332_c1 nmdc:mga0n895_29332_c1_971_2056 324
104 3300053077 Ga0495601_0000002 Ga0495601_0000002_166760_167845 324
105 3300053078 Ga0495612_0000010 Ga0495612_0000010_102648_103733 324
106 3300053084 Ga0495595_0001122 Ga0495595_0001122_5068_6153 324
107 3300053085 Ga0495619_0000019 Ga0495619_0000019_126096_127181 324
108 3300005293 Ga0065715_10223059 Ga0065715_102230591 325
109 3300009176 Ga0105242_10234856 Ga0105242_102348562 325
110 3300048917 Ga0496114_0127259 Ga0496114_0127259_322_1407 325
111 3300013297 Ga0157378_10016812 Ga0157378_100168128 326
112 3300013306 Ga0163162_10062217 Ga0163162_100622172 326
113 3300005339 Ga0070660_100119489 Ga0070660_1001194892 327
114 3300005295 Ga0065707_10149666 Ga0065707_101496661 328
115 3300005438 Ga0070701_10026945 Ga0070701_100269452 328
116 3300005456 Ga0070678_100227331 Ga0070678_1002273312 328
117 3300013296 Ga0157374_10080339 Ga0157374_100803392 328
118 3300025960 Ga0207651_10064775 Ga0207651_100647752 328
119 3300026121 Ga0207683_10078904 Ga0207683_100789042 328
120 3300035242 Ga0373962_0064323 Ga0373962_0064323_20_1039 328
121 3300035692 Ga0373935_0166961 Ga0373935_0166961_400_1476 328
122 3300035695 Ga0373927_0012906 Ga0373927_0012906_3511_4530 328
123 3300035725 Ga0373947_0022225 Ga0373947_0022225_1649_2668 328
124 3300037068 Ga0373925_0070111 Ga0373925_0070111_1292_2311 328
125 3300046683 Ga0495658_0025337 Ga0495658_0025337_1691_2710 328
126 3300047315 Ga0495581_0055274 Ga0495581_0055274_1249_2268 328
127 3300005444 Ga0070694_100273182 Ga0070694_1002731821 330
128 3300005535 Ga0070684_100329897 Ga0070684_1003298971 330
129 3300046455 Ga0495603_0092350 Ga0495603_0092350_473_1498 330
130 3300046473 Ga0495582_0014127 Ga0495582_0014127_1879_2976 330
131 3300046475 Ga0495639_0025722 Ga0495639_0025722_959_2056 330
132 3300046642 Ga0495634_0038958 Ga0495634_0038958_995_2092 330
133 3300013306 Ga0163162_10226708 Ga0163162_102267082 334
134 3300005618 Ga0068864_100121352 Ga0068864_1001213524 335
135 3300026095 Ga0207676_10115916 Ga0207676_101159161 335
136 3300046475 Ga0495639_0072984 Ga0495639_0072984_399_1508 335
137 3300050512 nmdc:mga0n895_59025_c1 nmdc:mga0n895_59025_c1_2369_3466 335
138 3300005295 Ga0065707_10174666 Ga0065707_101746661 336
139 3300005436 Ga0070713_100071328 Ga0070713_1000713284 336
140 3300005468 Ga0070707_100400975 Ga0070707_1004009751 336
141 3300009098 Ga0105245_10002799 Ga0105245_100027996 336
142 3300009098 Ga0105245_10262164 Ga0105245_102621642 336
143 3300013297 Ga0157378_10172554 Ga0157378_101725542 336
144 3300025928 Ga0207700_10160015 Ga0207700_101600152 336
145 3300026035 Ga0207703_10020302 Ga0207703_100203022 336
146 3300046664 Ga0495659_0011228 Ga0495659_0011228_697_1743 336
147 3300005444 Ga0070694_100075536 Ga0070694_1000755362 337
148 3300009094 Ga0111539_10011138 Ga0111539_1001113811 337
149 3300009147 Ga0114129_10119167 Ga0114129_101191673 337
150 3300027907 Ga0207428_10001471 Ga0207428_1000147113 337
151 3300046538 Ga0495609_0098177 Ga0495609_0098177_41_1087 337
152 3300050511 nmdc:mga08y16_19077_c1 nmdc:mga08y16_19077_c1_126_1226 337
153 3300006852 Ga0075433_10230909 Ga0075433_102309092 338
154 3300047317 Ga0495604_0184093 Ga0495604_0184093_73_1125 338
155 3300047471 Ga0495684_0186602 Ga0495684_0186602_179_1231 338
156 3300050515 nmdc:mga0a205_252354_c1 nmdc:mga0a205_252354_c1_243_1343 338
157 3300009551 Ga0105238_10007551 Ga0105238_1000755110 339
158 3300025934 Ga0207686_10144282 Ga0207686_101442821 339
159 3300035083 Ga0373926_0060627 Ga0373926_0060627_24_1133 339
160 3300046537 Ga0495598_0014871 Ga0495598_0014871_66_1175 339
161 3300048907 Ga0496104_0252113 Ga0496104_0252113_143_1267 339
162 3300050508 nmdc:mga09592_168123_c1 nmdc:mga09592_168123_c1_337_1467 339
163 3300005355 Ga0070671_100051591 Ga0070671_1000515912 340
164 3300005543 Ga0070672_100058506 Ga0070672_1000585063 340
165 3300006871 Ga0075434_100097773 Ga0075434_1000977732 340
166 3300025940 Ga0207691_10075850 Ga0207691_100758502 340
167 3300005549 Ga0070704_100226383 Ga0070704_1002263832 341
168 3300005616 Ga0068852_100178002 Ga0068852_1001780022 341
169 3300005844 Ga0068862_100075872 Ga0068862_1000758722 341
170 3300006844 Ga0075428_100003051 Ga0075428_10000305112 341
171 3300006846 Ga0075430_100176023 Ga0075430_1001760232 341
172 3300006847 Ga0075431_100012528 Ga0075431_1000125286 341
173 3300006880 Ga0075429_100011042 Ga0075429_1000110423 341
174 3300026142 Ga0207698_10135106 Ga0207698_101351062 341
175 3300046477 Ga0495664_0119702 Ga0495664_0119702_296_1411 341
176 3300050508 nmdc:mga09592_19614_c1 nmdc:mga09592_19614_c1_110_1198 341
177 3300050509 nmdc:mga0qj67_124221_c1 nmdc:mga0qj67_124221_c1_20_1108 341
178 3300050510 nmdc:mga06r32_8322_c1 nmdc:mga06r32_8322_c1_1538_2626 341
179 3300005549 Ga0070704_100040153 Ga0070704_1000401532 342
180 3300009147 Ga0114129_10020076 Ga0114129_100200764 342
181 3300031995 Ga0307409_100017751 Ga0307409_1000177512 342
182 3300032005 Ga0307411_10090262 Ga0307411_100902622 342
183 3300050507 nmdc:mga05p37_1455_c1 nmdc:mga05p37_1455_c1_26055_27167 342
184 3300005843 Ga0068860_100088857 Ga0068860_1000888573 343
185 3300006847 Ga0075431_100269643 Ga0075431_1002696432 343
186 3300013306 Ga0163162_10006888 Ga0163162_100068887 343
187 3300046683 Ga0495658_0121976 Ga0495658_0121976_68_1129 343
188 3300050512 nmdc:mga0n895_26604_c1 nmdc:mga0n895_26604_c1_57_1133 343
189 3300032005 Ga0307411_10157777 Ga0307411_101577772 344
190 3300046473 Ga0495582_0019002 Ga0495582_0019002_2220_3284 344
191 3300046531 Ga0495665_0009488 Ga0495665_0009488_424_1488 344
192 3300005290 Ga0065712_10009208 Ga0065712_100092082 345
193 3300005293 Ga0065715_10089355 Ga0065715_100893559 345
194 3300005468 Ga0070707_100198431 Ga0070707_1001984312 345
195 3300005545 Ga0070695_100018179 Ga0070695_1000181792 345
196 3300005549 Ga0070704_100012587 Ga0070704_1000125874 345
197 3300006881 Ga0068865_100036402 Ga0068865_1000364023 345
198 3300006914 Ga0075436_100030830 Ga0075436_1000308302 345
199 3300014325 Ga0163163_10096972 Ga0163163_100969722 345
200 3300025922 Ga0207646_10169102 Ga0207646_101691022 345
201 3300025938 Ga0207704_10174411 Ga0207704_101744112 345
202 3300025960 Ga0207651_10048489 Ga0207651_100484892 345
203 3300031711 Ga0265314_10000688 Ga0265314_1000068818 345
204 3300050514 nmdc:mga08x19_112961_c1 nmdc:mga08x19_112961_c1_315_1427 345
205 3300006846 Ga0075430_100000342 Ga0075430_1000003425 346
206 3300006847 Ga0075431_100154821 Ga0075431_1001548212 346
207 3300009147 Ga0114129_10019932 Ga0114129_100199322 346
208 3300050509 nmdc:mga0qj67_201_c1 nmdc:mga0qj67_201_c1_36606_37769 346
209 3300050512 nmdc:mga0n895_7126_c1 nmdc:mga0n895_7126_c1_1242_2318 346
210 3300050515 nmdc:mga0a205_87962_c1 nmdc:mga0a205_87962_c1_927_2003 346
211 3300005329 Ga0070683_100022360 Ga0070683_1000223604 347
212 3300005355 Ga0070671_100044018 Ga0070671_1000440183 347
213 3300005459 Ga0068867_100120806 Ga0068867_1001208063 347
214 3300005535 Ga0070684_100024270 Ga0070684_1000242703 347
215 3300005539 Ga0068853_100082608 Ga0068853_1000826083 347
216 3300005563 Ga0068855_100013416 Ga0068855_10001341610 347
217 3300005616 Ga0068852_100092400 Ga0068852_1000924002 347
218 3300005618 Ga0068864_100468108 Ga0068864_1004681081 347
219 3300005842 Ga0068858_100387908 Ga0068858_1003879082 347
220 3300005937 Ga0081455_10023012 Ga0081455_100230125 347
221 3300005983 Ga0081540_1015506 Ga0081540_10155062 347
222 3300006358 Ga0068871_100141282 Ga0068871_1001412822 347
223 3300009093 Ga0105240_10055728 Ga0105240_100557284 347
224 3300009176 Ga0105242_10087416 Ga0105242_100874163 347
225 3300009551 Ga0105238_10003498 Ga0105238_100034987 347
226 3300013104 Ga0157370_10000570 Ga0157370_100005705 347
227 3300013307 Ga0157372_10070557 Ga0157372_100705573 347
228 3300025919 Ga0207657_10092760 Ga0207657_100927602 347
229 3300025924 Ga0207694_10002029 Ga0207694_1000202911 347
230 3300025927 Ga0207687_10001360 Ga0207687_1000136011 347
231 3300025931 Ga0207644_10032666 Ga0207644_100326663 347
232 3300025934 Ga0207686_10089946 Ga0207686_100899462 347
233 3300025944 Ga0207661_10022391 Ga0207661_100223912 347
234 3300025949 Ga0207667_10057303 Ga0207667_100573032 347
235 3300025960 Ga0207651_10030552 Ga0207651_100305523 347
236 3300026041 Ga0207639_10068572 Ga0207639_100685722 347
237 3300026078 Ga0207702_10021413 Ga0207702_100214133 347
238 3300026089 Ga0207648_10258190 Ga0207648_102581902 347
239 3300026121 Ga0207683_10086073 Ga0207683_100860733 347
240 3300026142 Ga0207698_10065480 Ga0207698_100654802 347
241 3300046472 Ga0495580_0009761 Ga0495580_0009761_61_1134 347
242 3300048908 Ga0496105_0116722 Ga0496105_0116722_1113_2186 347
243 3300005459 Ga0068867_100015031 Ga0068867_1000150316 348
244 3300005563 Ga0068855_100102960 Ga0068855_1001029602 348
245 3300005577 Ga0068857_100126564 Ga0068857_1001265642 348
246 3300006358 Ga0068871_100005092 Ga0068871_1000050922 348
247 3300006847 Ga0075431_100054575 Ga0075431_1000545753 348
248 3300009093 Ga0105240_10205218 Ga0105240_102052183 348
249 3300009545 Ga0105237_10055938 Ga0105237_100559385 348
250 3300010375 Ga0105239_10182832 Ga0105239_101828322 348
251 3300013296 Ga0157374_10548694 Ga0157374_105486941 348
252 3300025913 Ga0207695_10147462 Ga0207695_101474622 348
253 3300025914 Ga0207671_10011000 Ga0207671_100110002 348
254 3300025934 Ga0207686_10009873 Ga0207686_100098731 348
255 3300025938 Ga0207704_10023554 Ga0207704_100235542 348
256 3300026089 Ga0207648_10006379 Ga0207648_1000637911 348
257 3300026116 Ga0207674_10077948 Ga0207674_100779484 348
258 3300035724 Ga0373933_0026680 Ga0373933_0026680_556_1650 348
259 3300046689 Ga0495613_0083995 Ga0495613_0083995_268_1362 348
260 3300048918 Ga0496115_0027972 Ga0496115_0027972_2295_3371 348
261 3300050510 nmdc:mga06r32_50936_c1 nmdc:mga06r32_50936_c1_766_1860 348
262 3300005434 Ga0070709_10020907 Ga0070709_100209073 349
263 3300005937 Ga0081455_10063048 Ga0081455_100630483 349
264 3300006844 Ga0075428_100098239 Ga0075428_1000982393 349
265 3300006847 Ga0075431_100428808 Ga0075431_1004288082 349
266 3300006880 Ga0075429_100014050 Ga0075429_1000140504 349
267 3300009094 Ga0111539_10005554 Ga0111539_100055544 349
268 3300009094 Ga0111539_10112896 Ga0111539_101128962 349
269 3300009177 Ga0105248_10068038 Ga0105248_100680382 349
270 3300025906 Ga0207699_10082670 Ga0207699_100826701 349
271 3300025941 Ga0207711_10114005 Ga0207711_101140052 349
272 3300037068 Ga0373925_0005039 Ga0373925_0005039_8468_9565 349
273 3300049575 Ga0501039_0094842 Ga0501039_0094842_300_1376 349
274 3300049576 Ga0501040_0068174 Ga0501040_0068174_28_1104 349
275 3300049578 Ga0501042_0024196 Ga0501042_0024196_2633_3709 349
276 3300049582 Ga0501048_0121909 Ga0501048_0121909_300_1376 349
277 3300049591 Ga0501075_0031520 Ga0501075_0031520_1583_2659 349
278 3300049592 Ga0501076_0115869 Ga0501076_0115869_838_1914 349
279 3300049743 Ga0501081_0040920 Ga0501081_0040920_734_1810 349
280 3300050510 nmdc:mga06r32_293731_c1 nmdc:mga06r32_293731_c1_126_1268 349
281 3300054114 Ga0501084_0186967 Ga0501084_0186967_300_1376 349
282 3300061734 Ga0530510_0008298 Ga0530510_0008298_3545_4621 349
283 3300005334 Ga0068869_100116937 Ga0068869_1001169372 350
284 3300013308 Ga0157375_10323829 Ga0157375_103238292 350
285 3300014325 Ga0163163_10011417 Ga0163163_100114177 350
286 3300025912 Ga0207707_10334118 Ga0207707_103341182 350
287 3300025942 Ga0207689_10060895 Ga0207689_100608953 350
288 3300031595 Ga0265313_10022892 Ga0265313_100228922 350
289 3300046499 Ga0495594_0003464 Ga0495594_0003464_3392_4480 350
290 3300006846 Ga0075430_100105626 Ga0075430_1001056264 351
291 3300009094 Ga0111539_10042777 Ga0111539_100427774 351
292 3300035111 Ga0373923_0011295 Ga0373923_0011295_1536_2636 351
293 3300035117 Ga0373953_0026047 Ga0373953_0026047_1083_2183 351
294 3300050511 nmdc:mga08y16_33047_c1 nmdc:mga08y16_33047_c1_1924_3024 351
295 3300005456 Ga0070678_100054063 Ga0070678_1000540634 352
296 3300005618 Ga0068864_100059601 Ga0068864_1000596012 352
297 3300006852 Ga0075433_10001870 Ga0075433_100018708 352
298 3300006871 Ga0075434_100001267 Ga0075434_1000012675 352
299 3300007076 Ga0075435_100002821 Ga0075435_10000282110 352
300 3300009176 Ga0105242_10002798 Ga0105242_100027982 352
301 3300025914 Ga0207671_10290391 Ga0207671_102903911 352
302 3300025923 Ga0207681_10060987 Ga0207681_100609873 352
303 3300025934 Ga0207686_10042178 Ga0207686_100421782 352
304 3300028379 Ga0268266_10105825 Ga0268266_101058252 352
305 3300050509 nmdc:mga0qj67_34039_c1 nmdc:mga0qj67_34039_c1_1059_2147 352
306 3300050512 nmdc:mga0n895_1834_c1 nmdc:mga0n895_1834_c1_4656_5750 352
307 3300050513 nmdc:mga0rr50_4619_c1 nmdc:mga0rr50_4619_c1_1011_2105 352
308 3300050515 nmdc:mga0a205_4063_c1 nmdc:mga0a205_4063_c1_11153_12247 352
309 3300005293 Ga0065715_10020731 Ga0065715_100207311 353
310 3300005295 Ga0065707_10126867 Ga0065707_101268672 353
311 3300005333 Ga0070677_10099929 Ga0070677_100999291 353
312 3300005356 Ga0070674_100019519 Ga0070674_1000195194 353
313 3300014326 Ga0157380_10003682 Ga0157380_100036822 353
314 3300025937 Ga0207669_10013181 Ga0207669_100131812 353
315 3300005330 Ga0070690_100014612 Ga0070690_1000146122 354
316 3300005355 Ga0070671_100104840 Ga0070671_1001048402 354
317 3300005367 Ga0070667_100016918 Ga0070667_1000169182 354
318 3300005436 Ga0070713_100188545 Ga0070713_1001885452 354
319 3300005436 Ga0070713_100226462 Ga0070713_1002264622 354
320 3300005458 Ga0070681_10003849 Ga0070681_1000384913 354
321 3300005719 Ga0068861_100189101 Ga0068861_1001891012 354
322 3300005841 Ga0068863_100051532 Ga0068863_1000515322 354
323 3300005843 Ga0068860_100004137 Ga0068860_1000041372 354
324 3300006237 Ga0097621_100017933 Ga0097621_1000179333 354
325 3300006237 Ga0097621_100040603 Ga0097621_1000406032 354
326 3300006844 Ga0075428_100000671 Ga0075428_1000006716 354
327 3300006846 Ga0075430_100004736 Ga0075430_1000047363 354
328 3300006847 Ga0075431_100017720 Ga0075431_1000177203 354
329 3300006880 Ga0075429_100001556 Ga0075429_10000155615 354
330 3300006881 Ga0068865_100027656 Ga0068865_1000276562 354
331 3300009147 Ga0114129_10153105 Ga0114129_101531053 354
332 3300009176 Ga0105242_10006040 Ga0105242_100060407 354
333 3300009177 Ga0105248_10009933 Ga0105248_100099337 354
334 3300009177 Ga0105248_10242330 Ga0105248_102423302 354
335 3300013308 Ga0157375_10062200 Ga0157375_100622002 354
336 3300013308 Ga0157375_10681158 Ga0157375_106811581 354
337 3300014969 Ga0157376_10015129 Ga0157376_100151294 354
338 3300014969 Ga0157376_10301862 Ga0157376_103018622 354
339 3300025912 Ga0207707_10088645 Ga0207707_100886452 354
340 3300025921 Ga0207652_10248217 Ga0207652_102482172 354
341 3300025924 Ga0207694_10009724 Ga0207694_100097246 354
342 3300025927 Ga0207687_10022675 Ga0207687_100226752 354
343 3300025931 Ga0207644_10279843 Ga0207644_102798432 354
344 3300025933 Ga0207706_10065055 Ga0207706_100650552 354
345 3300025934 Ga0207686_10016842 Ga0207686_100168422 354
346 3300025940 Ga0207691_10235856 Ga0207691_102358562 354
347 3300025941 Ga0207711_10008109 Ga0207711_100081093 354
348 3300025941 Ga0207711_10238982 Ga0207711_102389821 354
349 3300025960 Ga0207651_10021257 Ga0207651_100212572 354
350 3300025986 Ga0207658_10006450 Ga0207658_100064502 354
351 3300026088 Ga0207641_10038701 Ga0207641_100387012 354
352 3300026088 Ga0207641_10141550 Ga0207641_101415501 354
353 3300028379 Ga0268266_10319326 Ga0268266_103193262 354
354 3300049824 Ga0501045_0143187 Ga0501045_0143187_346_1443 354
355 3300050508 nmdc:mga09592_10400_c1 nmdc:mga09592_10400_c1_620_1723 354
356 3300050509 nmdc:mga0qj67_11886_c1 nmdc:mga0qj67_11886_c1_787_1890 354
357 3300050510 nmdc:mga06r32_12636_c1 nmdc:mga06r32_12636_c1_4817_5920 354
358 3300005335 Ga0070666_10057936 Ga0070666_100579362 355
359 3300005338 Ga0068868_100228068 Ga0068868_1002280681 355
360 3300006847 Ga0075431_100168997 Ga0075431_1001689972 355
361 3300009094 Ga0111539_10371634 Ga0111539_103716341 355
362 3300009177 Ga0105248_10009554 Ga0105248_100095546 355
363 3300009551 Ga0105238_10343246 Ga0105238_103432461 355
364 3300014325 Ga0163163_10111750 Ga0163163_101117502 355
365 3300025924 Ga0207694_10240092 Ga0207694_102400922 355
366 3300025925 Ga0207650_10090673 Ga0207650_100906732 355
367 3300042436 Ga0439435_0010511 Ga0439435_0010511_981_2138 355
368 3300046499 Ga0495594_0023891 Ga0495594_0023891_1327_2481 355
369 3300046559 Ga0495667_0064697 Ga0495667_0064697_878_1993 355
370 3300046642 Ga0495634_0109967 Ga0495634_0109967_374_1492 355
371 3300005288 Ga0065714_10087600 Ga0065714_100876002 356
372 3300005293 Ga0065715_10012322 Ga0065715_100123222 356
373 3300005334 Ga0068869_100065251 Ga0068869_1000652512 356
374 3300005353 Ga0070669_100043889 Ga0070669_1000438894 356
375 3300005354 Ga0070675_100083966 Ga0070675_1000839663 356
376 3300005364 Ga0070673_100003697 Ga0070673_1000036979 356
377 3300005364 Ga0070673_100051124 Ga0070673_1000511244 356
378 3300005456 Ga0070678_100011635 Ga0070678_1000116352 356
379 3300005458 Ga0070681_10039175 Ga0070681_100391752 356
380 3300005468 Ga0070707_100139772 Ga0070707_1001397721 356
381 3300005543 Ga0070672_100158457 Ga0070672_1001584572 356
382 3300005719 Ga0068861_100141542 Ga0068861_1001415422 356
383 3300005840 Ga0068870_10002696 Ga0068870_100026964 356
384 3300005844 Ga0068862_100267313 Ga0068862_1002673132 356
385 3300005985 Ga0081539_10001123 Ga0081539_1000112326 356
386 3300009094 Ga0111539_10222987 Ga0111539_102229872 356
387 3300009098 Ga0105245_10077017 Ga0105245_100770172 356
388 3300009147 Ga0114129_10003741 Ga0114129_1000374112 356
389 3300009147 Ga0114129_10029461 Ga0114129_100294615 356
390 3300013308 Ga0157375_10048147 Ga0157375_100481474 356
391 3300014326 Ga0157380_10016294 Ga0157380_100162942 356
392 3300025907 Ga0207645_10086692 Ga0207645_100866922 356
393 3300025908 Ga0207643_10008053 Ga0207643_100080532 356
394 3300025922 Ga0207646_10154071 Ga0207646_101540712 356
395 3300025926 Ga0207659_10061401 Ga0207659_100614012 356
396 3300025940 Ga0207691_10026050 Ga0207691_100260502 356
397 3300025960 Ga0207651_10010839 Ga0207651_100108393 356
398 3300026089 Ga0207648_10069308 Ga0207648_100693084 356
399 3300026118 Ga0207675_100364796 Ga0207675_1003647962 356
400 3300028380 Ga0268265_10088693 Ga0268265_100886933 356
401 3300028380 Ga0268265_10156003 Ga0268265_101560032 356
402 3300049575 Ga0501039_0157197 Ga0501039_0157197_473_1594 356
403 3300049576 Ga0501040_0166142 Ga0501040_0166142_182_1303 356
404 3300049591 Ga0501075_0021967 Ga0501075_0021967_762_1883 356
405 3300049592 Ga0501076_0040571 Ga0501076_0040571_2280_3401 356
406 3300049741 Ga0501079_0016592 Ga0501079_0016592_2758_3879 356
407 3300049743 Ga0501081_0001316 Ga0501081_0001316_2887_4008 356
408 3300049822 Ga0501035_0090365 Ga0501035_0090365_461_1582 356
409 3300049824 Ga0501045_0001602 Ga0501045_0001602_2812_3933 356
410 3300050507 nmdc:mga05p37_8616_c2 nmdc:mga05p37_8616_c2_6665_7783 356
411 3300050513 nmdc:mga0rr50_30654_c1 nmdc:mga0rr50_30654_c1_2262_3362 356
412 3300054114 Ga0501084_0039207 Ga0501084_0039207_1935_3056 356
413 3300060353 Ga0501082_0007369 Ga0501082_0007369_2947_4068 356
414 3300005293 Ga0065715_10005897 Ga0065715_100058972 357
415 3300005328 Ga0070676_10026333 Ga0070676_100263332 357
416 3300005333 Ga0070677_10020198 Ga0070677_100201982 357
417 3300005334 Ga0068869_100175113 Ga0068869_1001751132 357
418 3300005338 Ga0068868_100010145 Ga0068868_1000101453 357
419 3300005340 Ga0070689_100021346 Ga0070689_1000213462 357
420 3300005353 Ga0070669_100020283 Ga0070669_1000202833 357
421 3300005364 Ga0070673_100013605 Ga0070673_1000136053 357
422 3300005367 Ga0070667_100062416 Ga0070667_1000624163 357
423 3300005438 Ga0070701_10006253 Ga0070701_100062533 357
424 3300005457 Ga0070662_100004709 Ga0070662_1000047093 357
425 3300005466 Ga0070685_10016609 Ga0070685_100166094 357
426 3300005548 Ga0070665_100169811 Ga0070665_1001698113 357
427 3300005719 Ga0068861_100086284 Ga0068861_1000862842 357
428 3300005840 Ga0068870_10008107 Ga0068870_100081074 357
429 3300005842 Ga0068858_100027619 Ga0068858_1000276193 357
430 3300005843 Ga0068860_100053410 Ga0068860_1000534103 357
431 3300005844 Ga0068862_100022549 Ga0068862_1000225493 357
432 3300006237 Ga0097621_100223596 Ga0097621_1002235962 357
433 3300006880 Ga0075429_100015477 Ga0075429_1000154775 357
434 3300006881 Ga0068865_100017599 Ga0068865_1000175993 357
435 3300009094 Ga0111539_10033694 Ga0111539_100336944 357
436 3300009177 Ga0105248_10106549 Ga0105248_101065493 357
437 3300013306 Ga0163162_10024011 Ga0163162_100240113 357
438 3300014326 Ga0157380_10012175 Ga0157380_100121754 357
439 3300025893 Ga0207682_10000800 Ga0207682_100008003 357
440 3300025907 Ga0207645_10005880 Ga0207645_100058802 357
441 3300025908 Ga0207643_10000941 Ga0207643_1000094111 357
442 3300025923 Ga0207681_10060264 Ga0207681_100602643 357
443 3300025938 Ga0207704_10135892 Ga0207704_101358922 357
444 3300025942 Ga0207689_10004772 Ga0207689_100047725 357
445 3300025986 Ga0207658_10099215 Ga0207658_100992152 357
446 3300026118 Ga0207675_100033671 Ga0207675_1000336715 357
447 3300027907 Ga0207428_10003846 Ga0207428_100038469 357
448 3300028379 Ga0268266_10160844 Ga0268266_101608442 357
449 3300028380 Ga0268265_10026193 Ga0268265_100261935 357
450 3300045051 Ga0451576_0021989 Ga0451576_0021989_5657_6784 357
451 3300050508 nmdc:mga09592_56461_c1 nmdc:mga09592_56461_c1_87_1214 357
452 3300005334 Ga0068869_100222705 Ga0068869_1002227052 358
453 3300005338 Ga0068868_100155676 Ga0068868_1001556762 358
454 3300005356 Ga0070674_100184671 Ga0070674_1001846711 358
455 3300005842 Ga0068858_100087366 Ga0068858_1000873663 358
456 3300006237 Ga0097621_100181538 Ga0097621_1001815382 358
457 3300006871 Ga0075434_100007176 Ga0075434_1000071763 358
458 3300007076 Ga0075435_100032148 Ga0075435_1000321481 358
459 3300009098 Ga0105245_10015703 Ga0105245_100157037 358
460 3300009176 Ga0105242_10140239 Ga0105242_101402392 358
461 3300009177 Ga0105248_10028518 Ga0105248_100285183 358
462 3300009177 Ga0105248_10076703 Ga0105248_100767032 358
463 3300013306 Ga0163162_10367235 Ga0163162_103672351 358
464 3300013308 Ga0157375_10270911 Ga0157375_102709112 358
465 3300014969 Ga0157376_10001464 Ga0157376_100014644 358
466 3300025907 Ga0207645_10064515 Ga0207645_100645152 358
467 3300025934 Ga0207686_10176284 Ga0207686_101762842 358
468 3300025938 Ga0207704_10037376 Ga0207704_100373763 358
469 3300025941 Ga0207711_10095178 Ga0207711_100951782 358
470 3300025942 Ga0207689_10265747 Ga0207689_102657472 358
471 3300005577 Ga0068857_100127822 Ga0068857_1001278222 359
472 3300005985 Ga0081539_10003380 Ga0081539_1000338015 359
473 3300009094 Ga0111539_10011039 Ga0111539_100110392 359
474 3300009177 Ga0105248_10431387 Ga0105248_104313871 359
475 3300050511 nmdc:mga08y16_156340_c1 nmdc:mga08y16_156340_c1_725_1834 359
476 3300005354 Ga0070675_100053208 Ga0070675_1000532082 360
477 3300005842 Ga0068858_100001351 Ga0068858_10000135116 360
478 3300007265 Ga0099794_10093151 Ga0099794_100931512 360
479 3300025913 Ga0207695_10052420 Ga0207695_100524202 360
480 3300025928 Ga0207700_10179037 Ga0207700_101790372 360
481 3300025942 Ga0207689_10080083 Ga0207689_100800833 360
482 3300025949 Ga0207667_10078514 Ga0207667_100785144 360
483 3300026089 Ga0207648_10256192 Ga0207648_102561922 360
484 3300050511 nmdc:mga08y16_25884_c1 nmdc:mga08y16_25884_c1_3944_5059 360
485 3300050515 nmdc:mga0a205_155573_c1 nmdc:mga0a205_155573_c1_76_1206 360
486 3300005295 Ga0065707_10094052 Ga0065707_100940522 361
487 3300005354 Ga0070675_100064586 Ga0070675_1000645864 361
488 3300005471 Ga0070698_100129028 Ga0070698_1001290282 361
489 3300035695 Ga0373927_0063377 Ga0373927_0063377_89_1204 361
490 3300036401 Ga0373937_0054617 Ga0373937_0054617_953_2068 361
491 3300037068 Ga0373925_0043588 Ga0373925_0043588_1786_2901 361
492 3300047319 Ga0495674_0052279 Ga0495674_0052279_2453_3568 361
493 3300053078 Ga0495612_0029063 Ga0495612_0029063_741_1856 361
494 3300003203 JGI25406J46586_10001085 JGI25406J46586_100010859 362
495 3300005330 Ga0070690_100074318 Ga0070690_1000743181 362
496 3300005343 Ga0070687_100086088 Ga0070687_1000860882 362
497 3300005344 Ga0070661_100039715 Ga0070661_1000397152 362
498 3300005355 Ga0070671_100054563 Ga0070671_1000545632 362
499 3300005365 Ga0070688_100050401 Ga0070688_1000504012 362
500 3300005456 Ga0070678_100015207 Ga0070678_1000152074 362
501 3300005471 Ga0070698_100123558 Ga0070698_1001235583 362
502 3300005518 Ga0070699_100012959 Ga0070699_1000129595 362
503 3300005544 Ga0070686_100009775 Ga0070686_1000097753 362
504 3300005549 Ga0070704_100116781 Ga0070704_1001167812 362
505 3300005564 Ga0070664_100008705 Ga0070664_1000087054 362
506 3300005617 Ga0068859_100006551 Ga0068859_1000065515 362
507 3300005841 Ga0068863_100170633 Ga0068863_1001706332 362
508 3300005985 Ga0081539_10000010 Ga0081539_10000010116 362
509 3300006852 Ga0075433_10001202 Ga0075433_100012027 362
510 3300006931 Ga0097620_100006551 Ga0097620_1000065516 362
511 3300009147 Ga0114129_10068758 Ga0114129_100687582 362
512 3300014745 Ga0157377_10015214 Ga0157377_100152144 362
513 3300025901 Ga0207688_10024087 Ga0207688_100240872 362
514 3300025918 Ga0207662_10050444 Ga0207662_100504441 362
515 3300025933 Ga0207706_10002760 Ga0207706_100027605 362
516 3300025945 Ga0207679_10042708 Ga0207679_100427082 362
517 3300026075 Ga0207708_10042995 Ga0207708_100429952 362
518 3300026088 Ga0207641_10012782 Ga0207641_100127822 362
519 3300026121 Ga0207683_10034303 Ga0207683_100343035 362
520 3300036401 Ga0373937_0124128 Ga0373937_0124128_323_1441 362
521 3300037068 Ga0373925_0053102 Ga0373925_0053102_1464_2582 362
522 3300046455 Ga0495603_0155000 Ga0495603_0155000_14_1132 362
523 3300046539 Ga0495621_0014412 Ga0495621_0014412_477_1595 362
524 3300048903 Ga0496100_0005342 Ga0496100_0005342_5327_6463 362
525 3300048912 Ga0496109_0127136 Ga0496109_0127136_1101_2228 362
526 3300048917 Ga0496114_0000906 Ga0496114_0000906_5115_6251 362
527 3300048918 Ga0496115_0191537 Ga0496115_0191537_28_1164 362
528 3300050510 nmdc:mga06r32_204966_c1 nmdc:mga06r32_204966_c1_723_1841 362
529 3300050512 nmdc:mga0n895_29204_c1 nmdc:mga0n895_29204_c1_1446_2573 362
530 3300050515 nmdc:mga0a205_11870_c1 nmdc:mga0a205_11870_c1_6764_7891 362

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01436

NHL

NHL repeat

227

254

0.96

PF17170

DUF5128

6-bladed beta-propeller

187

286

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qrv-assembly2.cif.gz_B crystal structure of nhl domain of trim2 (full c-terminal) 0.7916 66 360
1npe-assembly1.cif.gz_A crystal structure of nidogen/laminin complex 0.7846 67 323
3ww8-assembly1.cif.gz_B crystal structure of the computationally designed pizza3 protein 0.7811 233 357
7qrw-assembly1.cif.gz_A crystal structure of nhl domain of trim3 0.7726 66 361
3fw0-assembly1.cif.gz_A structure of peptidyl-alpha-hydroxyglycine alpha-amidating lyase (pal) bound to alpha-hydroxyhippuric acid (non-peptidic substrate) 0.7659 43 361
ID Description Score Start End Superfamily
af_Q79FU0_283_386_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8098 236 343 2.40.10.500
af_A0A1D6E8A7_186_285_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8054 276 359 2.130.10.10
af_B7YZK8_1340_1431_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.801 226 316 2.40.10.500
af_B7YZK8_1231_1339_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.7984 223 320 2.40.10.500
af_Q9U489_879_1020_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.7966 223 357 2.40.10.500
ID Description Score Start End GO Terms
AF-A0A2V8IL83-F1-model_v4 6-bladed beta-propeller 0.982 221 361
AF-A0A2V8M559-F1-model_v4 SMP-30/Gluconolactonase/LRE-like region domain-containing protein 0.9804 238 361
AF-A0A2V8IL83-F1-model_v4 6-bladed beta-propeller 0.9751 221 361
AF-A0A2V8M559-F1-model_v4 SMP-30/Gluconolactonase/LRE-like region domain-containing protein 0.9726 238 361
AF-A0A2V8KFD0-F1-model_v4 6-bladed beta-propeller 0.9654 94 361 GO:0005576

Feature Viewer

pLDDT pTM Quality
87.48 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map