F459902
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 530 | 256 | 530 | 349 |
Family's Representative Sequence
| Representative Sequence | 3300005293|Ga0065715_10020731|Ga0065715_100207311 |
| Length | 388 |
| Sequence | MMTTSTVVRLAGALAMVVWIDAQGTSVKAQQRGGTAETDKVQPVNSGPNPYRVIRDWAQLTLEKRPWGGSNGVAIDRDGKSVWATDRCSPGIAPGCLGTKANPIHLFDETGKEVRSFGGGMFVWPHGIHVDREGNVWVTDARVPTAEERTKFPGEDKKGSVVIKFSRDGKALMTLGKPGAKGDGDVYVAESHTNVDDPKLVGRISVFNRNGNFLRVIGRTGTGPGEFRTPHAIRFDSQRRLIVADRHNHRIQILTKEGKYLGEWREFGRVSGLAIDGNDIIYAADSESDPKRHPDWLKGIRIGSLTDGKVTIFVPPHKTDAPDGAMGEGIAIDSAGNLFTAEATIRGVTKYVKDXMRTXRKVGRACIEKDSPAGRLLRGFAGMXHMRV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 62 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 63 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 64 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 70 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 71 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 137 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 140 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 141 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 142 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 143 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 144 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 145 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 146 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 147 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 148 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 149 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 150 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 151 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 152 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 153 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 154 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 155 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 156 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 157 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 160 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 161 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 162 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 223 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 224 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 225 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 226 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 228 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 229 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.64 |
| Rhizosphere | 97.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10001085 | 3300003203 | Bacteria | 12771 |
| 2 | Ga0065714_10087600 | 3300005288 | Unclassified | 2051 |
| 3 | Ga0065712_10009208 | 3300005290 | Bacteria | 2508 |
| 4 | Ga0065715_10005897 | 3300005293 | Bacteria | 5750 |
| 5 | Ga0065715_10012322 | 3300005293 | Unclassified | 2597 |
| 6 | Ga0065715_10020731 | 3300005293 | Unclassified | 2124 |
| 7 | Ga0065715_10089355 | 3300005293 | Bacteria | 10935 |
| 8 | Ga0065715_10223059 | 3300005293 | Unclassified | 1264 |
| 9 | Ga0065707_10094052 | 3300005295 | Bacteria | 3538 |
| 10 | Ga0065707_10126867 | 3300005295 | Bacteria | 1995 |
| 11 | Ga0065707_10149666 | 3300005295 | Unclassified | 1656 |
| 12 | Ga0065707_10174666 | 3300005295 | Bacteria | 1459 |
| 13 | Ga0070676_10026333 | 3300005328 | Bacteria | 3292 |
| 14 | Ga0070683_100022360 | 3300005329 | Bacteria | 5651 |
| 15 | Ga0070690_100014612 | 3300005330 | Bacteria | 4660 |
| 16 | Ga0070690_100074318 | 3300005330 | Unclassified | 2213 |
| 17 | Ga0070677_10020198 | 3300005333 | Bacteria | 2423 |
| 18 | Ga0070677_10099929 | 3300005333 | Bacteria | 1277 |
| 19 | Ga0068869_100065251 | 3300005334 | Unclassified | 2679 |
| 20 | Ga0068869_100116937 | 3300005334 | Unclassified | 2035 |
| 21 | Ga0068869_100175113 | 3300005334 | Unclassified | 1678 |
| 22 | Ga0068869_100222705 | 3300005334 | Unclassified | 1496 |
| 23 | Ga0070666_10057936 | 3300005335 | Bacteria | 2619 |
| 24 | Ga0068868_100010145 | 3300005338 | Bacteria | 6806 |
| 25 | Ga0068868_100155676 | 3300005338 | Unclassified | 1885 |
| 26 | Ga0068868_100228068 | 3300005338 | Unclassified | 1562 |
| 27 | Ga0070660_100119489 | 3300005339 | Unclassified | 2102 |
| 28 | Ga0070689_100021346 | 3300005340 | Unclassified | 4820 |
| 29 | Ga0070687_100086088 | 3300005343 | Bacteria | 1726 |
| 30 | Ga0070661_100039715 | 3300005344 | Bacteria | 3430 |
| 31 | Ga0070669_100020283 | 3300005353 | Unclassified | 4747 |
| 32 | Ga0070669_100043889 | 3300005353 | Unclassified | 3257 |
| 33 | Ga0070675_100053208 | 3300005354 | Bacteria | 3329 |
| 34 | Ga0070675_100064586 | 3300005354 | Bacteria | 3026 |
| 35 | Ga0070675_100083966 | 3300005354 | Unclassified | 2659 |
| 36 | Ga0070671_100044018 | 3300005355 | Unclassified | 3709 |
| 37 | Ga0070671_100051591 | 3300005355 | Bacteria | 3421 |
| 38 | Ga0070671_100054563 | 3300005355 | Bacteria | 3323 |
| 39 | Ga0070671_100104840 | 3300005355 | Bacteria | 2373 |
| 40 | Ga0070674_100019519 | 3300005356 | Unclassified | 4307 |
| 41 | Ga0070674_100184671 | 3300005356 | Bacteria | 1600 |
| 42 | Ga0070673_100003697 | 3300005364 | Bacteria | 9582 |
| 43 | Ga0070673_100013605 | 3300005364 | Bacteria | 5637 |
| 44 | Ga0070673_100051124 | 3300005364 | Unclassified | 3234 |
| 45 | Ga0070688_100050401 | 3300005365 | Bacteria | 2593 |
| 46 | Ga0070667_100016918 | 3300005367 | Bacteria | 6035 |
| 47 | Ga0070667_100062416 | 3300005367 | Unclassified | 3156 |
| 48 | Ga0070709_10020907 | 3300005434 | Unclassified | 3807 |
| 49 | Ga0070713_100071328 | 3300005436 | Bacteria | 2935 |
| 50 | Ga0070713_100188545 | 3300005436 | Unclassified | 1857 |
| 51 | Ga0070713_100226462 | 3300005436 | Unclassified | 1698 |
| 52 | Ga0070701_10006253 | 3300005438 | Unclassified | 4997 |
| 53 | Ga0070701_10026945 | 3300005438 | Bacteria | 2809 |
| 54 | Ga0070694_100075536 | 3300005444 | Unclassified | 2331 |
| 55 | Ga0070694_100273182 | 3300005444 | Unclassified | 1286 |
| 56 | Ga0070678_100011635 | 3300005456 | Bacteria | 5436 |
| 57 | Ga0070678_100015207 | 3300005456 | Unclassified | 4884 |
| 58 | Ga0070678_100054063 | 3300005456 | Unclassified | 2924 |
| 59 | Ga0070678_100227331 | 3300005456 | Bacteria | 1554 |
| 60 | Ga0070662_100004709 | 3300005457 | Bacteria | 8650 |
| 61 | Ga0070681_10003849 | 3300005458 | Bacteria | 14117 |
| 62 | Ga0070681_10039175 | 3300005458 | Bacteria | 4751 |
| 63 | Ga0068867_100015031 | 3300005459 | Bacteria | 5488 |
| 64 | Ga0068867_100120806 | 3300005459 | Bacteria | 2025 |
| 65 | Ga0070685_10016609 | 3300005466 | Bacteria | 3925 |
| 66 | Ga0070707_100139772 | 3300005468 | Unclassified | 2357 |
| 67 | Ga0070707_100198431 | 3300005468 | Bacteria | 1956 |
| 68 | Ga0070707_100400975 | 3300005468 | Unclassified | 1332 |
| 69 | Ga0070698_100123558 | 3300005471 | Bacteria | 2546 |
| 70 | Ga0070698_100129028 | 3300005471 | Unclassified | 2485 |
| 71 | Ga0070699_100012959 | 3300005518 | Bacteria | 7185 |
| 72 | Ga0070684_100024270 | 3300005535 | Bacteria | 5084 |
| 73 | Ga0070684_100329897 | 3300005535 | Bacteria | 1402 |
| 74 | Ga0068853_100082608 | 3300005539 | Bacteria | 2814 |
| 75 | Ga0070672_100058506 | 3300005543 | Bacteria | 3030 |
| 76 | Ga0070672_100158457 | 3300005543 | Unclassified | 1876 |
| 77 | Ga0070686_100009775 | 3300005544 | Bacteria | 5390 |
| 78 | Ga0070695_100018179 | 3300005545 | Bacteria | 4268 |
| 79 | Ga0070665_100169811 | 3300005548 | Unclassified | 2182 |
| 80 | Ga0070704_100012587 | 3300005549 | Bacteria | 5228 |
| 81 | Ga0070704_100040153 | 3300005549 | Bacteria | 3219 |
| 82 | Ga0070704_100116781 | 3300005549 | Bacteria | 2041 |
| 83 | Ga0070704_100226383 | 3300005549 | Bacteria | 1523 |
| 84 | Ga0068855_100013416 | 3300005563 | Bacteria | 9880 |
| 85 | Ga0068855_100102960 | 3300005563 | Unclassified | 3285 |
| 86 | Ga0070664_100008705 | 3300005564 | Bacteria | 8216 |
| 87 | Ga0068857_100126564 | 3300005577 | Bacteria | 2302 |
| 88 | Ga0068857_100127822 | 3300005577 | Bacteria | 2290 |
| 89 | Ga0068852_100092400 | 3300005616 | Unclassified | 2710 |
| 90 | Ga0068852_100178002 | 3300005616 | Bacteria | 1998 |
| 91 | Ga0068859_100006551 | 3300005617 | Bacteria | 11820 |
| 92 | Ga0068864_100059601 | 3300005618 | Unclassified | 3303 |
| 93 | Ga0068864_100121352 | 3300005618 | Unclassified | 2337 |
| 94 | Ga0068864_100468108 | 3300005618 | Unclassified | 1208 |
| 95 | Ga0068861_100086284 | 3300005719 | Bacteria | 2467 |
| 96 | Ga0068861_100141542 | 3300005719 | Bacteria | 1964 |
| 97 | Ga0068861_100189101 | 3300005719 | Bacteria | 1720 |
| 98 | Ga0068870_10002696 | 3300005840 | Bacteria | 7443 |
| 99 | Ga0068870_10008107 | 3300005840 | Unclassified | 4709 |
| 100 | Ga0068863_100051532 | 3300005841 | Bacteria | 3901 |
| 101 | Ga0068863_100170633 | 3300005841 | Bacteria | 2086 |
| 102 | Ga0068858_100001351 | 3300005842 | Bacteria | 25297 |
| 103 | Ga0068858_100027619 | 3300005842 | Bacteria | 5272 |
| 104 | Ga0068858_100087366 | 3300005842 | Bacteria | 2900 |
| 105 | Ga0068858_100387908 | 3300005842 | Bacteria | 1341 |
| 106 | Ga0068860_100004137 | 3300005843 | Bacteria | 14874 |
| 107 | Ga0068860_100053410 | 3300005843 | Bacteria | 3842 |
| 108 | Ga0068860_100088857 | 3300005843 | Unclassified | 2941 |
| 109 | Ga0068862_100022549 | 3300005844 | Bacteria | 5268 |
| 110 | Ga0068862_100075872 | 3300005844 | Bacteria | 2909 |
| 111 | Ga0068862_100267313 | 3300005844 | Unclassified | 1563 |
| 112 | Ga0081455_10023012 | 3300005937 | Bacteria | 5809 |
| 113 | Ga0081455_10063048 | 3300005937 | Bacteria | 3112 |
| 114 | Ga0081540_1015506 | 3300005983 | Plasmid | 4822 |
| 115 | Ga0081539_10000010 | 3300005985 | Bacteria | 484386 |
| 116 | Ga0081539_10001123 | 3300005985 | Bacteria | 48558 |
| 117 | Ga0081539_10003380 | 3300005985 | Bacteria | 19763 |
| 118 | Ga0097621_100017933 | 3300006237 | Bacteria | 5391 |
| 119 | Ga0097621_100040603 | 3300006237 | Bacteria | 3742 |
| 120 | Ga0097621_100181538 | 3300006237 | Unclassified | 1818 |
| 121 | Ga0097621_100223596 | 3300006237 | Unclassified | 1641 |
| 122 | Ga0068871_100005092 | 3300006358 | Bacteria | 9181 |
| 123 | Ga0068871_100141282 | 3300006358 | Bacteria | 2047 |
| 124 | Ga0075428_100000671 | 3300006844 | Bacteria | 35135 |
| 125 | Ga0075428_100003051 | 3300006844 | Bacteria | 18264 |
| 126 | Ga0075428_100098239 | 3300006844 | Bacteria | 3192 |
| 127 | Ga0075430_100000342 | 3300006846 | Bacteria | 33715 |
| 128 | Ga0075430_100004736 | 3300006846 | Bacteria | 11445 |
| 129 | Ga0075430_100105626 | 3300006846 | Bacteria | 2350 |
| 130 | Ga0075430_100176023 | 3300006846 | Unclassified | 1780 |
| 131 | Ga0075431_100012528 | 3300006847 | Bacteria | 8559 |
| 132 | Ga0075431_100017720 | 3300006847 | Bacteria | 7241 |
| 133 | Ga0075431_100054575 | 3300006847 | Unclassified | 4121 |
| 134 | Ga0075431_100154821 | 3300006847 | Bacteria | 2358 |
| 135 | Ga0075431_100168997 | 3300006847 | Unclassified | 2247 |
| 136 | Ga0075431_100269643 | 3300006847 | Unclassified | 1725 |
| 137 | Ga0075431_100428808 | 3300006847 | Unclassified | 1321 |
| 138 | Ga0075433_10001202 | 3300006852 | Bacteria | 18854 |
| 139 | Ga0075433_10001870 | 3300006852 | Bacteria | 15820 |
| 140 | Ga0075433_10230909 | 3300006852 | Bacteria | 1643 |
| 141 | Ga0075434_100001267 | 3300006871 | Bacteria | 21044 |
| 142 | Ga0075434_100007176 | 3300006871 | Bacteria | 10302 |
| 143 | Ga0075434_100041547 | 3300006871 | Bacteria | 4556 |
| 144 | Ga0075434_100097773 | 3300006871 | Unclassified | 2940 |
| 145 | Ga0075429_100001556 | 3300006880 | Bacteria | 18839 |
| 146 | Ga0075429_100011042 | 3300006880 | Bacteria | 7816 |
| 147 | Ga0075429_100014050 | 3300006880 | Bacteria | 6940 |
| 148 | Ga0075429_100015477 | 3300006880 | Bacteria | 6610 |
| 149 | Ga0068865_100017599 | 3300006881 | Unclassified | 4599 |
| 150 | Ga0068865_100027656 | 3300006881 | Bacteria | 3748 |
| 151 | Ga0068865_100036402 | 3300006881 | Bacteria | 3318 |
| 152 | Ga0075436_100030830 | 3300006914 | Bacteria | 3690 |
| 153 | Ga0075436_100109329 | 3300006914 | Bacteria | 1929 |
| 154 | Ga0097620_100006551 | 3300006931 | Bacteria | 11820 |
| 155 | Ga0075435_100002821 | 3300007076 | Bacteria | 11625 |
| 156 | Ga0075435_100032148 | 3300007076 | Bacteria | 4142 |
| 157 | Ga0099794_10093151 | 3300007265 | Bacteria | 1497 |
| 158 | Ga0099795_10012027 | 3300007788 | Bacteria | 2610 |
| 159 | Ga0105240_10055728 | 3300009093 | Bacteria | 4949 |
| 160 | Ga0105240_10205218 | 3300009093 | Bacteria | 2307 |
| 161 | Ga0111539_10005554 | 3300009094 | Bacteria | 16306 |
| 162 | Ga0111539_10011039 | 3300009094 | Bacteria | 11363 |
| 163 | Ga0111539_10011138 | 3300009094 | Bacteria | 11313 |
| 164 | Ga0111539_10033694 | 3300009094 | Bacteria | 6216 |
| 165 | Ga0111539_10042777 | 3300009094 | Bacteria | 5436 |
| 166 | Ga0111539_10112896 | 3300009094 | Bacteria | 3187 |
| 167 | Ga0111539_10222987 | 3300009094 | Unclassified | 2196 |
| 168 | Ga0111539_10371634 | 3300009094 | Bacteria | 1664 |
| 169 | Ga0105245_10002799 | 3300009098 | Bacteria | 15690 |
| 170 | Ga0105245_10015703 | 3300009098 | Bacteria | 6602 |
| 171 | Ga0105245_10077017 | 3300009098 | Unclassified | 3039 |
| 172 | Ga0105245_10262164 | 3300009098 | Bacteria | 1682 |
| 173 | Ga0105245_10512704 | 3300009098 | Bacteria | 1217 |
| 174 | Ga0105247_10151240 | 3300009101 | Unclassified | 1529 |
| 175 | Ga0114129_10003741 | 3300009147 | Bacteria | 21454 |
| 176 | Ga0114129_10019932 | 3300009147 | Bacteria | 9546 |
| 177 | Ga0114129_10020076 | 3300009147 | Bacteria | 9511 |
| 178 | Ga0114129_10029461 | 3300009147 | Bacteria | 7775 |
| 179 | Ga0114129_10068758 | 3300009147 | Bacteria | 4938 |
| 180 | Ga0114129_10119167 | 3300009147 | Bacteria | 3636 |
| 181 | Ga0114129_10153105 | 3300009147 | Unclassified | 3155 |
| 182 | Ga0105243_10206658 | 3300009148 | Bacteria | 1726 |
| 183 | Ga0105242_10002798 | 3300009176 | Bacteria | 13663 |
| 184 | Ga0105242_10006040 | 3300009176 | Bacteria | 9333 |
| 185 | Ga0105242_10087416 | 3300009176 | Unclassified | 2617 |
| 186 | Ga0105242_10140239 | 3300009176 | Bacteria | 2097 |
| 187 | Ga0105242_10234856 | 3300009176 | Unclassified | 1645 |
| 188 | Ga0105248_10009554 | 3300009177 | Bacteria | 10673 |
| 189 | Ga0105248_10009933 | 3300009177 | Bacteria | 10475 |
| 190 | Ga0105248_10028518 | 3300009177 | Bacteria | 6220 |
| 191 | Ga0105248_10068038 | 3300009177 | Bacteria | 3999 |
| 192 | Ga0105248_10076703 | 3300009177 | Bacteria | 3756 |
| 193 | Ga0105248_10106549 | 3300009177 | Bacteria | 3160 |
| 194 | Ga0105248_10242330 | 3300009177 | Bacteria | 2029 |
| 195 | Ga0105248_10431387 | 3300009177 | Bacteria | 1484 |
| 196 | Ga0105237_10055938 | 3300009545 | Bacteria | 3951 |
| 197 | Ga0105238_10003498 | 3300009551 | Bacteria | 15635 |
| 198 | Ga0105238_10007551 | 3300009551 | Bacteria | 10890 |
| 199 | Ga0105238_10343246 | 3300009551 | Unclassified | 1482 |
| 200 | Ga0105239_10182832 | 3300010375 | Bacteria | 2345 |
| 201 | Ga0157370_10000570 | 3300013104 | Bacteria | 46011 |
| 202 | Ga0157374_10080339 | 3300013296 | Bacteria | 3093 |
| 203 | Ga0157374_10548694 | 3300013296 | Unclassified | 1163 |
| 204 | Ga0157378_10016812 | 3300013297 | Bacteria | 6411 |
| 205 | Ga0157378_10172554 | 3300013297 | Bacteria | 2029 |
| 206 | Ga0163162_10006888 | 3300013306 | Bacteria | 11029 |
| 207 | Ga0163162_10024011 | 3300013306 | Bacteria | 6017 |
| 208 | Ga0163162_10062217 | 3300013306 | Bacteria | 3773 |
| 209 | Ga0163162_10188416 | 3300013306 | Bacteria | 2190 |
| 210 | Ga0163162_10226708 | 3300013306 | Bacteria | 1998 |
| 211 | Ga0163162_10367235 | 3300013306 | Bacteria | 1572 |
| 212 | Ga0157372_10070557 | 3300013307 | Unclassified | 3931 |
| 213 | Ga0157375_10048147 | 3300013308 | Unclassified | 4168 |
| 214 | Ga0157375_10062200 | 3300013308 | Bacteria | 3709 |
| 215 | Ga0157375_10270911 | 3300013308 | Unclassified | 1860 |
| 216 | Ga0157375_10323829 | 3300013308 | Unclassified | 1706 |
| 217 | Ga0157375_10681158 | 3300013308 | Unclassified | 1183 |
| 218 | Ga0163163_10011417 | 3300014325 | Bacteria | 8055 |
| 219 | Ga0163163_10096972 | 3300014325 | Unclassified | 2969 |
| 220 | Ga0163163_10111750 | 3300014325 | Unclassified | 2761 |
| 221 | Ga0157380_10003682 | 3300014326 | Bacteria | 10546 |
| 222 | Ga0157380_10012175 | 3300014326 | Bacteria | 6232 |
| 223 | Ga0157380_10016294 | 3300014326 | Bacteria | 5478 |
| 224 | Ga0157377_10015214 | 3300014745 | Bacteria | 3929 |
| 225 | Ga0157376_10001464 | 3300014969 | Bacteria | 15555 |
| 226 | Ga0157376_10015129 | 3300014969 | Bacteria | 5816 |
| 227 | Ga0157376_10301862 | 3300014969 | Unclassified | 1516 |
| 228 | Ga0207682_10000800 | 3300025893 | Bacteria | 14530 |
| 229 | Ga0207642_10155294 | 3300025899 | Bacteria | 1223 |
| 230 | Ga0207688_10024087 | 3300025901 | Bacteria | 3337 |
| 231 | Ga0207699_10082670 | 3300025906 | Bacteria | 1995 |
| 232 | Ga0207645_10005880 | 3300025907 | Bacteria | 8837 |
| 233 | Ga0207645_10064515 | 3300025907 | Bacteria | 2340 |
| 234 | Ga0207645_10086692 | 3300025907 | Unclassified | 2012 |
| 235 | Ga0207643_10000941 | 3300025908 | Bacteria | 17466 |
| 236 | Ga0207643_10008053 | 3300025908 | Bacteria | 5653 |
| 237 | Ga0207707_10088645 | 3300025912 | Unclassified | 2703 |
| 238 | Ga0207707_10334118 | 3300025912 | Bacteria | 1307 |
| 239 | Ga0207695_10052420 | 3300025913 | Bacteria | 4275 |
| 240 | Ga0207695_10147462 | 3300025913 | Bacteria | 2295 |
| 241 | Ga0207671_10011000 | 3300025914 | Bacteria | 7409 |
| 242 | Ga0207671_10290391 | 3300025914 | Unclassified | 1291 |
| 243 | Ga0207662_10050444 | 3300025918 | Bacteria | 2472 |
| 244 | Ga0207657_10092760 | 3300025919 | Bacteria | 2516 |
| 245 | Ga0207652_10248217 | 3300025921 | Unclassified | 1605 |
| 246 | Ga0207646_10154071 | 3300025922 | Bacteria | 2072 |
| 247 | Ga0207646_10169102 | 3300025922 | Bacteria | 1974 |
| 248 | Ga0207681_10060264 | 3300025923 | Unclassified | 2604 |
| 249 | Ga0207681_10060987 | 3300025923 | Unclassified | 2591 |
| 250 | Ga0207694_10002029 | 3300025924 | Bacteria | 16764 |
| 251 | Ga0207694_10009724 | 3300025924 | Bacteria | 7254 |
| 252 | Ga0207694_10240092 | 3300025924 | Unclassified | 1481 |
| 253 | Ga0207650_10090673 | 3300025925 | Bacteria | 2335 |
| 254 | Ga0207659_10061401 | 3300025926 | Bacteria | 2709 |
| 255 | Ga0207687_10001360 | 3300025927 | Bacteria | 16724 |
| 256 | Ga0207687_10022675 | 3300025927 | Bacteria | 4181 |
| 257 | Ga0207700_10160015 | 3300025928 | Bacteria | 1869 |
| 258 | Ga0207700_10179037 | 3300025928 | Bacteria | 1774 |
| 259 | Ga0207644_10032666 | 3300025931 | Unclassified | 3633 |
| 260 | Ga0207644_10279843 | 3300025931 | Bacteria | 1339 |
| 261 | Ga0207706_10002760 | 3300025933 | Bacteria | 17077 |
| 262 | Ga0207706_10065055 | 3300025933 | Unclassified | 3211 |
| 263 | Ga0207686_10009873 | 3300025934 | Bacteria | 5187 |
| 264 | Ga0207686_10016842 | 3300025934 | Bacteria | 4106 |
| 265 | Ga0207686_10042178 | 3300025934 | Bacteria | 2787 |
| 266 | Ga0207686_10089946 | 3300025934 | Bacteria | 2024 |
| 267 | Ga0207686_10144282 | 3300025934 | Unclassified | 1649 |
| 268 | Ga0207686_10176284 | 3300025934 | Bacteria | 1512 |
| 269 | Ga0207669_10013181 | 3300025937 | Unclassified | 4095 |
| 270 | Ga0207704_10023554 | 3300025938 | Unclassified | 3321 |
| 271 | Ga0207704_10037376 | 3300025938 | Bacteria | 2804 |
| 272 | Ga0207704_10135892 | 3300025938 | Bacteria | 1711 |
| 273 | Ga0207704_10174411 | 3300025938 | Unclassified | 1546 |
| 274 | Ga0207691_10026050 | 3300025940 | Bacteria | 5488 |
| 275 | Ga0207691_10075850 | 3300025940 | Bacteria | 3031 |
| 276 | Ga0207691_10235856 | 3300025940 | Bacteria | 1583 |
| 277 | Ga0207711_10008109 | 3300025941 | Bacteria | 8792 |
| 278 | Ga0207711_10095178 | 3300025941 | Bacteria | 2626 |
| 279 | Ga0207711_10114005 | 3300025941 | Bacteria | 2407 |
| 280 | Ga0207711_10238982 | 3300025941 | Bacteria | 1665 |
| 281 | Ga0207689_10004772 | 3300025942 | Bacteria | 12226 |
| 282 | Ga0207689_10060895 | 3300025942 | Bacteria | 3104 |
| 283 | Ga0207689_10080083 | 3300025942 | Bacteria | 2684 |
| 284 | Ga0207689_10265747 | 3300025942 | Unclassified | 1420 |
| 285 | Ga0207661_10022391 | 3300025944 | Bacteria | 4759 |
| 286 | Ga0207679_10042708 | 3300025945 | Bacteria | 3260 |
| 287 | Ga0207667_10057303 | 3300025949 | Unclassified | 4090 |
| 288 | Ga0207667_10078514 | 3300025949 | Bacteria | 3421 |
| 289 | Ga0207651_10010839 | 3300025960 | Bacteria | 5072 |
| 290 | Ga0207651_10021257 | 3300025960 | Unclassified | 3940 |
| 291 | Ga0207651_10030552 | 3300025960 | Unclassified | 3432 |
| 292 | Ga0207651_10048489 | 3300025960 | Bacteria | 2872 |
| 293 | Ga0207651_10064775 | 3300025960 | Bacteria | 2560 |
| 294 | Ga0207658_10006450 | 3300025986 | Bacteria | 8007 |
| 295 | Ga0207658_10099215 | 3300025986 | Bacteria | 2277 |
| 296 | Ga0207703_10020302 | 3300026035 | Bacteria | 5195 |
| 297 | Ga0207639_10068572 | 3300026041 | Bacteria | 2764 |
| 298 | Ga0207708_10042995 | 3300026075 | Unclassified | 3443 |
| 299 | Ga0207702_10021413 | 3300026078 | Bacteria | 5353 |
| 300 | Ga0207641_10012782 | 3300026088 | Bacteria | 6881 |
| 301 | Ga0207641_10038701 | 3300026088 | Bacteria | 3987 |
| 302 | Ga0207641_10141550 | 3300026088 | Bacteria | 2171 |
| 303 | Ga0207648_10006379 | 3300026089 | Bacteria | 11724 |
| 304 | Ga0207648_10069308 | 3300026089 | Bacteria | 3073 |
| 305 | Ga0207648_10256192 | 3300026089 | Bacteria | 1561 |
| 306 | Ga0207648_10258190 | 3300026089 | Unclassified | 1554 |
| 307 | Ga0207676_10115916 | 3300026095 | Unclassified | 2250 |
| 308 | Ga0207674_10077948 | 3300026116 | Bacteria | 3319 |
| 309 | Ga0207675_100033671 | 3300026118 | Unclassified | 4774 |
| 310 | Ga0207675_100364796 | 3300026118 | Bacteria | 1418 |
| 311 | Ga0207683_10034303 | 3300026121 | Unclassified | 4409 |
| 312 | Ga0207683_10078904 | 3300026121 | Bacteria | 2918 |
| 313 | Ga0207683_10086073 | 3300026121 | Bacteria | 2794 |
| 314 | Ga0207698_10065480 | 3300026142 | Unclassified | 2854 |
| 315 | Ga0207698_10135106 | 3300026142 | Bacteria | 2115 |
| 316 | Ga0207428_10001471 | 3300027907 | Bacteria | 24652 |
| 317 | Ga0207428_10003846 | 3300027907 | Bacteria | 14398 |
| 318 | Ga0268266_10105825 | 3300028379 | Bacteria | 2486 |
| 319 | Ga0268266_10160844 | 3300028379 | Unclassified | 2031 |
| 320 | Ga0268266_10319326 | 3300028379 | Bacteria | 1453 |
| 321 | Ga0268265_10026193 | 3300028380 | Unclassified | 4146 |
| 322 | Ga0268265_10088693 | 3300028380 | Bacteria | 2465 |
| 323 | Ga0268265_10156003 | 3300028380 | Unclassified | 1932 |
| 324 | Ga0265313_10022892 | 3300031595 | Bacteria | 3378 |
| 325 | Ga0265314_10000688 | 3300031711 | Bacteria | 41004 |
| 326 | Ga0307409_100017751 | 3300031995 | Bacteria | 4756 |
| 327 | Ga0307411_10090262 | 3300032005 | Bacteria | 2137 |
| 328 | Ga0307411_10157777 | 3300032005 | Bacteria | 1695 |
| 329 | Ga0373926_0060627 | 3300035083 | Bacteria | 1379 |
| 330 | Ga0373923_0011295 | 3300035111 | Bacteria | 3272 |
| 331 | Ga0373936_0001992 | 3300035113 | Bacteria | 7562 |
| 332 | Ga0373945_0026719 | 3300035116 | Bacteria | 2012 |
| 333 | Ga0373945_0029477 | 3300035116 | Unclassified | 1929 |
| 334 | Ga0373953_0001201 | 3300035117 | Bacteria | 7382 |
| 335 | Ga0373953_0026047 | 3300035117 | Bacteria | 2239 |
| 336 | Ga0373954_0002785 | 3300035118 | Bacteria | 7367 |
| 337 | Ga0373943_0017142 | 3300035170 | Unclassified | 3313 |
| 338 | Ga0373946_0001775 | 3300035171 | Bacteria | 7518 |
| 339 | Ga0373946_0012588 | 3300035171 | Bacteria | 3169 |
| 340 | Ga0373955_0000132 | 3300035172 | Bacteria | 29609 |
| 341 | Ga0373955_0029585 | 3300035172 | Unclassified | 2850 |
| 342 | Ga0373962_0064323 | 3300035242 | Bacteria | 1084 |
| 343 | Ga0373935_0000291 | 3300035692 | Bacteria | 24802 |
| 344 | Ga0373935_0008286 | 3300035692 | Bacteria | 6220 |
| 345 | Ga0373935_0038590 | 3300035692 | Bacteria | 2991 |
| 346 | Ga0373935_0166961 | 3300035692 | Bacteria | 1503 |
| 347 | Ga0373927_0012906 | 3300035695 | Bacteria | 5556 |
| 348 | Ga0373927_0063377 | 3300035695 | Unclassified | 2391 |
| 349 | Ga0373927_0137632 | 3300035695 | Bacteria | 1596 |
| 350 | Ga0373933_0026680 | 3300035724 | Unclassified | 3319 |
| 351 | Ga0373947_0002232 | 3300035725 | Bacteria | 11714 |
| 352 | Ga0373947_0022225 | 3300035725 | Bacteria | 3676 |
| 353 | Ga0373947_0072939 | 3300035725 | Unclassified | 2109 |
| 354 | Ga0373937_0000004 | 3300036401 | Bacteria | 212269 |
| 355 | Ga0373937_0054617 | 3300036401 | Bacteria | 3666 |
| 356 | Ga0373937_0099528 | 3300036401 | Bacteria | 2697 |
| 357 | Ga0373937_0124128 | 3300036401 | Bacteria | 2408 |
| 358 | Ga0373925_0000460 | 3300037068 | Bacteria | 41057 |
| 359 | Ga0373925_0005039 | 3300037068 | Bacteria | 9912 |
| 360 | Ga0373925_0043588 | 3300037068 | Unclassified | 3331 |
| 361 | Ga0373925_0050218 | 3300037068 | Unclassified | 3111 |
| 362 | Ga0373925_0053102 | 3300037068 | Bacteria | 3029 |
| 363 | Ga0373925_0070111 | 3300037068 | Bacteria | 2649 |
| 364 | Ga0373925_0081823 | 3300037068 | Bacteria | 2456 |
| 365 | Ga0436363_0625030 | 3300039450 | Bacteria | 7567 |
| 366 | Ga0439435_0010511 | 3300042436 | Bacteria | 2197 |
| 367 | Ga0451576_0021989 | 3300045051 | Bacteria | 6924 |
| 368 | Ga0495592_0000029 | 3300046454 | Bacteria | 131879 |
| 369 | Ga0495603_0092350 | 3300046455 | Unclassified | 1769 |
| 370 | Ga0495603_0155000 | 3300046455 | Unclassified | 1330 |
| 371 | Ga0495629_0012909 | 3300046459 | Bacteria | 6042 |
| 372 | Ga0495629_0203450 | 3300046459 | Bacteria | 1369 |
| 373 | Ga0495651_0001216 | 3300046462 | Bacteria | 19890 |
| 374 | Ga0495653_0000012 | 3300046463 | Bacteria | 266880 |
| 375 | Ga0495580_0009761 | 3300046472 | Bacteria | 7528 |
| 376 | Ga0495582_0014127 | 3300046473 | Bacteria | 4394 |
| 377 | Ga0495582_0019002 | 3300046473 | Bacteria | 3761 |
| 378 | Ga0495605_0124909 | 3300046474 | Bacteria | 1164 |
| 379 | Ga0495639_0025722 | 3300046475 | Bacteria | 2597 |
| 380 | Ga0495639_0067136 | 3300046475 | Unclassified | 1652 |
| 381 | Ga0495639_0072984 | 3300046475 | Bacteria | 1588 |
| 382 | Ga0495662_0000344 | 3300046476 | Bacteria | 20328 |
| 383 | Ga0495664_0000004 | 3300046477 | Bacteria | 489411 |
| 384 | Ga0495664_0119702 | 3300046477 | Bacteria | 1593 |
| 385 | Ga0495584_0026307 | 3300046491 | Bacteria | 2947 |
| 386 | Ga0495585_0068472 | 3300046492 | Unclassified | 1939 |
| 387 | Ga0495594_0003464 | 3300046499 | Bacteria | 8146 |
| 388 | Ga0495594_0023891 | 3300046499 | Unclassified | 3279 |
| 389 | Ga0495607_0080892 | 3300046501 | Unclassified | 1785 |
| 390 | Ga0495608_0000017 | 3300046511 | Bacteria | 192929 |
| 391 | Ga0495616_0075489 | 3300046513 | Bacteria | 1622 |
| 392 | Ga0495618_0000006 | 3300046514 | Bacteria | 229906 |
| 393 | Ga0495628_0000001 | 3300046516 | Bacteria | 917742 |
| 394 | Ga0495630_0008041 | 3300046517 | Bacteria | 7582 |
| 395 | Ga0495630_0149318 | 3300046517 | Bacteria | 1778 |
| 396 | Ga0495631_0092622 | 3300046518 | Unclassified | 1301 |
| 397 | Ga0495637_0023960 | 3300046520 | Unclassified | 2764 |
| 398 | Ga0495652_0000002 | 3300046529 | Bacteria | 946606 |
| 399 | Ga0495665_0009488 | 3300046531 | Bacteria | 5268 |
| 400 | Ga0495640_0000001 | 3300046533 | Bacteria | 853827 |
| 401 | Ga0495640_0024836 | 3300046533 | Bacteria | 4354 |
| 402 | Ga0495587_0000008 | 3300046536 | Bacteria | 271097 |
| 403 | Ga0495598_0005223 | 3300046537 | Bacteria | 2864 |
| 404 | Ga0495598_0014871 | 3300046537 | Unclassified | 1953 |
| 405 | Ga0495609_0098177 | 3300046538 | Bacteria | 1270 |
| 406 | Ga0495621_0014412 | 3300046539 | Unclassified | 2501 |
| 407 | Ga0495645_0000002 | 3300046543 | Bacteria | 651644 |
| 408 | Ga0495633_0021834 | 3300046558 | Unclassified | 3196 |
| 409 | Ga0495667_0000029 | 3300046559 | Bacteria | 151568 |
| 410 | Ga0495667_0064697 | 3300046559 | Unclassified | 2392 |
| 411 | Ga0495656_0009620 | 3300046615 | Bacteria | 3483 |
| 412 | Ga0495668_0055726 | 3300046616 | Unclassified | 2183 |
| 413 | Ga0495634_0003829 | 3300046642 | Bacteria | 11950 |
| 414 | Ga0495634_0038958 | 3300046642 | Bacteria | 3239 |
| 415 | Ga0495634_0109967 | 3300046642 | Bacteria | 1773 |
| 416 | Ga0495611_0036999 | 3300046648 | Unclassified | 2168 |
| 417 | Ga0495635_0000002 | 3300046663 | Bacteria | 490490 |
| 418 | Ga0495659_0011228 | 3300046664 | Bacteria | 2885 |
| 419 | Ga0495657_0000459 | 3300046675 | Bacteria | 38116 |
| 420 | Ga0495599_0000247 | 3300046678 | Bacteria | 34186 |
| 421 | Ga0495623_0009278 | 3300046679 | Bacteria | 6387 |
| 422 | Ga0495623_0126540 | 3300046679 | Bacteria | 1534 |
| 423 | Ga0495646_0000064 | 3300046680 | Bacteria | 50992 |
| 424 | Ga0495658_0025337 | 3300046683 | Bacteria | 3169 |
| 425 | Ga0495658_0055215 | 3300046683 | Bacteria | 2262 |
| 426 | Ga0495658_0121976 | 3300046683 | Unclassified | 1577 |
| 427 | Ga0495658_0134671 | 3300046683 | Bacteria | 1507 |
| 428 | Ga0495658_0245787 | 3300046683 | Bacteria | 1124 |
| 429 | Ga0495613_0083995 | 3300046689 | Bacteria | 2312 |
| 430 | Ga0495613_0129799 | 3300046689 | Bacteria | 1805 |
| 431 | Ga0495624_0006416 | 3300046690 | Bacteria | 8345 |
| 432 | Ga0495624_0091362 | 3300046690 | Unclassified | 1878 |
| 433 | Ga0495670_0030241 | 3300046691 | Bacteria | 2690 |
| 434 | Ga0495649_0084003 | 3300046694 | Unclassified | 1701 |
| 435 | Ga0495589_0135468 | 3300046794 | Unclassified | 1181 |
| 436 | Ga0495600_0002611 | 3300046809 | Bacteria | 10388 |
| 437 | Ga0495581_0018382 | 3300047315 | Unclassified | 4059 |
| 438 | Ga0495581_0055274 | 3300047315 | Bacteria | 2291 |
| 439 | Ga0495581_0271406 | 3300047315 | Bacteria | 992 |
| 440 | Ga0495604_0000009 | 3300047317 | Bacteria | 326341 |
| 441 | Ga0495604_0184093 | 3300047317 | Unclassified | 1460 |
| 442 | Ga0495674_0000002 | 3300047319 | Bacteria | 642785 |
| 443 | Ga0495674_0052279 | 3300047319 | Unclassified | 3596 |
| 444 | Ga0495676_0150029 | 3300047321 | Unclassified | 1660 |
| 445 | Ga0495680_0000752 | 3300047322 | Bacteria | 36296 |
| 446 | Ga0495683_0052146 | 3300047323 | Bacteria | 2043 |
| 447 | Ga0495675_0000028 | 3300047444 | Bacteria | 105848 |
| 448 | Ga0495684_0000006 | 3300047471 | Bacteria | 247568 |
| 449 | Ga0495684_0186602 | 3300047471 | Unclassified | 1535 |
| 450 | Ga0495593_0000268 | 3300047673 | Bacteria | 28172 |
| 451 | Ga0495602_0000005 | 3300048088 | Bacteria | 325957 |
| 452 | Ga0496100_0005342 | 3300048903 | Bacteria | 6908 |
| 453 | Ga0496102_0169653 | 3300048905 | Bacteria | 2054 |
| 454 | Ga0496104_0001072 | 3300048907 | Bacteria | 23341 |
| 455 | Ga0496104_0252113 | 3300048907 | Unclassified | 1678 |
| 456 | Ga0496105_0116722 | 3300048908 | Bacteria | 2202 |
| 457 | Ga0496106_0019992 | 3300048909 | Bacteria | 4966 |
| 458 | Ga0496109_0127136 | 3300048912 | Bacteria | 2376 |
| 459 | Ga0496114_0000906 | 3300048917 | Bacteria | 22197 |
| 460 | Ga0496114_0090104 | 3300048917 | Bacteria | 2603 |
| 461 | Ga0496114_0127259 | 3300048917 | Bacteria | 2197 |
| 462 | Ga0496114_0272009 | 3300048917 | Unclassified | 1493 |
| 463 | Ga0496115_0027972 | 3300048918 | Bacteria | 4415 |
| 464 | Ga0496115_0094377 | 3300048918 | Bacteria | 2447 |
| 465 | Ga0496115_0191537 | 3300048918 | Bacteria | 1690 |
| 466 | Ga0501039_0094842 | 3300049575 | Unclassified | 2326 |
| 467 | Ga0501039_0157197 | 3300049575 | Unclassified | 1786 |
| 468 | Ga0501040_0056735 | 3300049576 | Bacteria | 2688 |
| 469 | Ga0501040_0068174 | 3300049576 | Bacteria | 2453 |
| 470 | Ga0501040_0166142 | 3300049576 | Unclassified | 1561 |
| 471 | Ga0501041_0057559 | 3300049577 | Bacteria | 2377 |
| 472 | Ga0501042_0014447 | 3300049578 | Bacteria | 5390 |
| 473 | Ga0501042_0024196 | 3300049578 | Bacteria | 4258 |
| 474 | Ga0501048_0121909 | 3300049582 | Unclassified | 1842 |
| 475 | Ga0501075_0021967 | 3300049591 | Unclassified | 4657 |
| 476 | Ga0501075_0023196 | 3300049591 | Bacteria | 4541 |
| 477 | Ga0501075_0031520 | 3300049591 | Unclassified | 3935 |
| 478 | Ga0501076_0040571 | 3300049592 | Unclassified | 3659 |
| 479 | Ga0501076_0115869 | 3300049592 | Unclassified | 2168 |
| 480 | Ga0501079_0016592 | 3300049741 | Bacteria | 5624 |
| 481 | Ga0501079_0055352 | 3300049741 | Bacteria | 3061 |
| 482 | Ga0501081_0001316 | 3300049743 | Bacteria | 15150 |
| 483 | Ga0501081_0040920 | 3300049743 | Unclassified | 3173 |
| 484 | Ga0501081_0042968 | 3300049743 | Bacteria | 3099 |
| 485 | Ga0501083_0112876 | 3300049744 | Unclassified | 1786 |
| 486 | Ga0501035_0090365 | 3300049822 | Unclassified | 2696 |
| 487 | Ga0501045_0001602 | 3300049824 | Bacteria | 15127 |
| 488 | Ga0501045_0143187 | 3300049824 | Bacteria | 1778 |
| 489 | nmdc:mga05p37_1455_c1 | 3300050507 | Bacteria | 27534 |
| 490 | nmdc:mga05p37_8616_c2 | 3300050507 | Bacteria | 9217 |
| 491 | nmdc:mga09592_10400_c1 | 3300050508 | Bacteria | 7572 |
| 492 | nmdc:mga09592_168123_c1 | 3300050508 | Bacteria | 1896 |
| 493 | nmdc:mga09592_19614_c1 | 3300050508 | Bacteria | 5552 |
| 494 | nmdc:mga09592_56461_c1 | 3300050508 | Unclassified | 3318 |
| 495 | nmdc:mga0qj67_11886_c1 | 3300050509 | Bacteria | 6539 |
| 496 | nmdc:mga0qj67_124221_c1 | 3300050509 | Bacteria | 2088 |
| 497 | nmdc:mga0qj67_201_c1 | 3300050509 | Bacteria | 40409 |
| 498 | nmdc:mga0qj67_34039_c1 | 3300050509 | Bacteria | 3978 |
| 499 | nmdc:mga06r32_12636_c1 | 3300050510 | Bacteria | 7629 |
| 500 | nmdc:mga06r32_204966_c1 | 3300050510 | Bacteria | 1960 |
| 501 | nmdc:mga06r32_293731_c1 | 3300050510 | Unclassified | 1612 |
| 502 | nmdc:mga06r32_50936_c1 | 3300050510 | Unclassified | 3961 |
| 503 | nmdc:mga06r32_8322_c1 | 3300050510 | Bacteria | 9335 |
| 504 | nmdc:mga08y16_156340_c1 | 3300050511 | Bacteria | 2369 |
| 505 | nmdc:mga08y16_19077_c1 | 3300050511 | Bacteria | 7226 |
| 506 | nmdc:mga08y16_25884_c1 | 3300050511 | Bacteria | 6190 |
| 507 | nmdc:mga08y16_33047_c1 | 3300050511 | Bacteria | 5435 |
| 508 | nmdc:mga0n895_1834_c1 | 3300050512 | Bacteria | 16199 |
| 509 | nmdc:mga0n895_26604_c1 | 3300050512 | Bacteria | 5482 |
| 510 | nmdc:mga0n895_29204_c1 | 3300050512 | Bacteria | 5256 |
| 511 | nmdc:mga0n895_29332_c1 | 3300050512 | Bacteria | 5246 |
| 512 | nmdc:mga0n895_59025_c1 | 3300050512 | Unclassified | 3785 |
| 513 | nmdc:mga0n895_7126_c1 | 3300050512 | Bacteria | 9558 |
| 514 | nmdc:mga0rr50_30654_c1 | 3300050513 | Bacteria | 3810 |
| 515 | nmdc:mga0rr50_4619_c1 | 3300050513 | Bacteria | 8113 |
| 516 | nmdc:mga08x19_112961_c1 | 3300050514 | Bacteria | 1814 |
| 517 | nmdc:mga0a205_11870_c1 | 3300050515 | Bacteria | 8041 |
| 518 | nmdc:mga0a205_155573_c1 | 3300050515 | Unclassified | 2185 |
| 519 | nmdc:mga0a205_252354_c1 | 3300050515 | Bacteria | 1643 |
| 520 | nmdc:mga0a205_4063_c1 | 3300050515 | Bacteria | 13083 |
| 521 | nmdc:mga0a205_87962_c1 | 3300050515 | Unclassified | 3002 |
| 522 | Ga0495601_0000002 | 3300053077 | Bacteria | 528704 |
| 523 | Ga0495612_0000010 | 3300053078 | Bacteria | 227618 |
| 524 | Ga0495612_0029063 | 3300053078 | Bacteria | 2225 |
| 525 | Ga0495595_0001122 | 3300053084 | Bacteria | 10369 |
| 526 | Ga0495619_0000019 | 3300053085 | Bacteria | 209518 |
| 527 | Ga0501084_0039207 | 3300054114 | Unclassified | 3962 |
| 528 | Ga0501084_0186967 | 3300054114 | Unclassified | 1748 |
| 529 | Ga0501082_0007369 | 3300060353 | Bacteria | 9492 |
| 530 | Ga0530510_0008298 | 3300061734 | Bacteria | 7243 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047315 | Ga0495581_0271406 | Ga0495581_0271406_20_976 | 280 |
| 2 | 3300046474 | Ga0495605_0124909 | Ga0495605_0124909_97_1128 | 305 |
| 3 | 3300046475 | Ga0495639_0067136 | Ga0495639_0067136_600_1631 | 305 |
| 4 | 3300046501 | Ga0495607_0080892 | Ga0495607_0080892_38_1069 | 305 |
| 5 | 3300046794 | Ga0495589_0135468 | Ga0495589_0135468_112_1143 | 305 |
| 6 | 3300035692 | Ga0373935_0038590 | Ga0373935_0038590_781_1812 | 306 |
| 7 | 3300035695 | Ga0373927_0137632 | Ga0373927_0137632_373_1404 | 306 |
| 8 | 3300037068 | Ga0373925_0081823 | Ga0373925_0081823_1024_2055 | 306 |
| 9 | 3300046517 | Ga0495630_0149318 | Ga0495630_0149318_56_1087 | 306 |
| 10 | 3300046533 | Ga0495640_0024836 | Ga0495640_0024836_1413_2444 | 306 |
| 11 | 3300046683 | Ga0495658_0134671 | Ga0495658_0134671_174_1205 | 306 |
| 12 | 3300048907 | Ga0496104_0001072 | Ga0496104_0001072_119_1150 | 306 |
| 13 | 3300048917 | Ga0496114_0272009 | Ga0496114_0272009_77_1108 | 306 |
| 14 | 3300046683 | Ga0495658_0055215 | Ga0495658_0055215_23_979 | 308 |
| 15 | 3300009098 | Ga0105245_10512704 | Ga0105245_105127041 | 316 |
| 16 | 3300039450 | Ga0436363_0625030 | Ga0436363_0625030_3279_4364 | 318 |
| 17 | 3300049576 | Ga0501040_0056735 | Ga0501040_0056735_943_2022 | 319 |
| 18 | 3300049578 | Ga0501042_0014447 | Ga0501042_0014447_3829_4908 | 319 |
| 19 | 3300049591 | Ga0501075_0023196 | Ga0501075_0023196_2625_3704 | 319 |
| 20 | 3300049741 | Ga0501079_0055352 | Ga0501079_0055352_239_1318 | 319 |
| 21 | 3300049744 | Ga0501083_0112876 | Ga0501083_0112876_768_1775 | 319 |
| 22 | 3300049577 | Ga0501041_0057559 | Ga0501041_0057559_536_1615 | 320 |
| 23 | 3300049743 | Ga0501081_0042968 | Ga0501081_0042968_1292_2371 | 320 |
| 24 | 3300046459 | Ga0495629_0203450 | Ga0495629_0203450_155_1213 | 321 |
| 25 | 3300046679 | Ga0495623_0126540 | Ga0495623_0126540_192_1250 | 321 |
| 26 | 3300009148 | Ga0105243_10206658 | Ga0105243_102066581 | 323 |
| 27 | 3300013306 | Ga0163162_10188416 | Ga0163162_101884163 | 323 |
| 28 | 3300025899 | Ga0207642_10155294 | Ga0207642_101552942 | 323 |
| 29 | 3300035116 | Ga0373945_0029477 | Ga0373945_0029477_215_1300 | 323 |
| 30 | 3300035170 | Ga0373943_0017142 | Ga0373943_0017142_1856_2953 | 323 |
| 31 | 3300035171 | Ga0373946_0012588 | Ga0373946_0012588_2001_3098 | 323 |
| 32 | 3300035172 | Ga0373955_0029585 | Ga0373955_0029585_193_1290 | 323 |
| 33 | 3300035692 | Ga0373935_0008286 | Ga0373935_0008286_3269_4366 | 323 |
| 34 | 3300035725 | Ga0373947_0072939 | Ga0373947_0072939_790_1875 | 323 |
| 35 | 3300036401 | Ga0373937_0099528 | Ga0373937_0099528_507_1604 | 323 |
| 36 | 3300037068 | Ga0373925_0050218 | Ga0373925_0050218_193_1290 | 323 |
| 37 | 3300046491 | Ga0495584_0026307 | Ga0495584_0026307_998_2083 | 323 |
| 38 | 3300046492 | Ga0495585_0068472 | Ga0495585_0068472_306_1391 | 323 |
| 39 | 3300046513 | Ga0495616_0075489 | Ga0495616_0075489_448_1533 | 323 |
| 40 | 3300046518 | Ga0495631_0092622 | Ga0495631_0092622_166_1251 | 323 |
| 41 | 3300046520 | Ga0495637_0023960 | Ga0495637_0023960_1138_2223 | 323 |
| 42 | 3300046537 | Ga0495598_0005223 | Ga0495598_0005223_1278_2363 | 323 |
| 43 | 3300046558 | Ga0495633_0021834 | Ga0495633_0021834_1127_2212 | 323 |
| 44 | 3300046615 | Ga0495656_0009620 | Ga0495656_0009620_1209_2294 | 323 |
| 45 | 3300046616 | Ga0495668_0055726 | Ga0495668_0055726_261_1346 | 323 |
| 46 | 3300046648 | Ga0495611_0036999 | Ga0495611_0036999_715_1800 | 323 |
| 47 | 3300046690 | Ga0495624_0091362 | Ga0495624_0091362_758_1843 | 323 |
| 48 | 3300046691 | Ga0495670_0030241 | Ga0495670_0030241_1120_2205 | 323 |
| 49 | 3300046694 | Ga0495649_0084003 | Ga0495649_0084003_175_1260 | 323 |
| 50 | 3300047321 | Ga0495676_0150029 | Ga0495676_0150029_405_1490 | 323 |
| 51 | 3300047323 | Ga0495683_0052146 | Ga0495683_0052146_285_1370 | 323 |
| 52 | 3300048905 | Ga0496102_0169653 | Ga0496102_0169653_71_1156 | 323 |
| 53 | 3300048909 | Ga0496106_0019992 | Ga0496106_0019992_3085_4170 | 323 |
| 54 | 3300048917 | Ga0496114_0090104 | Ga0496114_0090104_298_1383 | 323 |
| 55 | 3300048918 | Ga0496115_0094377 | Ga0496115_0094377_359_1444 | 323 |
| 56 | 3300006871 | Ga0075434_100041547 | Ga0075434_1000415472 | 324 |
| 57 | 3300006914 | Ga0075436_100109329 | Ga0075436_1001093292 | 324 |
| 58 | 3300007788 | Ga0099795_10012027 | Ga0099795_100120272 | 324 |
| 59 | 3300009101 | Ga0105247_10151240 | Ga0105247_101512402 | 324 |
| 60 | 3300035113 | Ga0373936_0001992 | Ga0373936_0001992_3419_4504 | 324 |
| 61 | 3300035116 | Ga0373945_0026719 | Ga0373945_0026719_35_1120 | 324 |
| 62 | 3300035117 | Ga0373953_0001201 | Ga0373953_0001201_1523_2608 | 324 |
| 63 | 3300035118 | Ga0373954_0002785 | Ga0373954_0002785_854_1939 | 324 |
| 64 | 3300035171 | Ga0373946_0001775 | Ga0373946_0001775_3321_4406 | 324 |
| 65 | 3300035172 | Ga0373955_0000132 | Ga0373955_0000132_17860_18945 | 324 |
| 66 | 3300035692 | Ga0373935_0000291 | Ga0373935_0000291_18631_19716 | 324 |
| 67 | 3300035725 | Ga0373947_0002232 | Ga0373947_0002232_9849_10934 | 324 |
| 68 | 3300036401 | Ga0373937_0000004 | Ga0373937_0000004_99821_100906 | 324 |
| 69 | 3300037068 | Ga0373925_0000460 | Ga0373925_0000460_17171_18256 | 324 |
| 70 | 3300046454 | Ga0495592_0000029 | Ga0495592_0000029_113963_115048 | 324 |
| 71 | 3300046459 | Ga0495629_0012909 | Ga0495629_0012909_2112_3197 | 324 |
| 72 | 3300046462 | Ga0495651_0001216 | Ga0495651_0001216_14651_15736 | 324 |
| 73 | 3300046463 | Ga0495653_0000012 | Ga0495653_0000012_237605_238690 | 324 |
| 74 | 3300046476 | Ga0495662_0000344 | Ga0495662_0000344_3495_4580 | 324 |
| 75 | 3300046477 | Ga0495664_0000004 | Ga0495664_0000004_143627_144712 | 324 |
| 76 | 3300046511 | Ga0495608_0000017 | Ga0495608_0000017_143614_144699 | 324 |
| 77 | 3300046514 | Ga0495618_0000006 | Ga0495618_0000006_102720_103805 | 324 |
| 78 | 3300046516 | Ga0495628_0000001 | Ga0495628_0000001_143616_144701 | 324 |
| 79 | 3300046517 | Ga0495630_0008041 | Ga0495630_0008041_1256_2341 | 324 |
| 80 | 3300046529 | Ga0495652_0000002 | Ga0495652_0000002_358150_359235 | 324 |
| 81 | 3300046533 | Ga0495640_0000001 | Ga0495640_0000001_452154_453239 | 324 |
| 82 | 3300046536 | Ga0495587_0000008 | Ga0495587_0000008_143834_144919 | 324 |
| 83 | 3300046543 | Ga0495645_0000002 | Ga0495645_0000002_143629_144714 | 324 |
| 84 | 3300046559 | Ga0495667_0000029 | Ga0495667_0000029_143625_144710 | 324 |
| 85 | 3300046642 | Ga0495634_0003829 | Ga0495634_0003829_6892_7977 | 324 |
| 86 | 3300046663 | Ga0495635_0000002 | Ga0495635_0000002_342223_343308 | 324 |
| 87 | 3300046675 | Ga0495657_0000459 | Ga0495657_0000459_28140_29225 | 324 |
| 88 | 3300046678 | Ga0495599_0000247 | Ga0495599_0000247_6041_7126 | 324 |
| 89 | 3300046679 | Ga0495623_0009278 | Ga0495623_0009278_242_1327 | 324 |
| 90 | 3300046680 | Ga0495646_0000064 | Ga0495646_0000064_16548_17633 | 324 |
| 91 | 3300046683 | Ga0495658_0245787 | Ga0495658_0245787_11_1096 | 324 |
| 92 | 3300046689 | Ga0495613_0129799 | Ga0495613_0129799_463_1548 | 324 |
| 93 | 3300046690 | Ga0495624_0006416 | Ga0495624_0006416_3095_4180 | 324 |
| 94 | 3300046809 | Ga0495600_0002611 | Ga0495600_0002611_5085_6170 | 324 |
| 95 | 3300047315 | Ga0495581_0018382 | Ga0495581_0018382_1412_2497 | 324 |
| 96 | 3300047317 | Ga0495604_0000009 | Ga0495604_0000009_181591_182676 | 324 |
| 97 | 3300047319 | Ga0495674_0000002 | Ga0495674_0000002_143617_144702 | 324 |
| 98 | 3300047322 | Ga0495680_0000752 | Ga0495680_0000752_7561_8646 | 324 |
| 99 | 3300047444 | Ga0495675_0000028 | Ga0495675_0000028_93240_94325 | 324 |
| 100 | 3300047471 | Ga0495684_0000006 | Ga0495684_0000006_143576_144661 | 324 |
| 101 | 3300047673 | Ga0495593_0000268 | Ga0495593_0000268_17182_18267 | 324 |
| 102 | 3300048088 | Ga0495602_0000005 | Ga0495602_0000005_200972_202057 | 324 |
| 103 | 3300050512 | nmdc:mga0n895_29332_c1 | nmdc:mga0n895_29332_c1_971_2056 | 324 |
| 104 | 3300053077 | Ga0495601_0000002 | Ga0495601_0000002_166760_167845 | 324 |
| 105 | 3300053078 | Ga0495612_0000010 | Ga0495612_0000010_102648_103733 | 324 |
| 106 | 3300053084 | Ga0495595_0001122 | Ga0495595_0001122_5068_6153 | 324 |
| 107 | 3300053085 | Ga0495619_0000019 | Ga0495619_0000019_126096_127181 | 324 |
| 108 | 3300005293 | Ga0065715_10223059 | Ga0065715_102230591 | 325 |
| 109 | 3300009176 | Ga0105242_10234856 | Ga0105242_102348562 | 325 |
| 110 | 3300048917 | Ga0496114_0127259 | Ga0496114_0127259_322_1407 | 325 |
| 111 | 3300013297 | Ga0157378_10016812 | Ga0157378_100168128 | 326 |
| 112 | 3300013306 | Ga0163162_10062217 | Ga0163162_100622172 | 326 |
| 113 | 3300005339 | Ga0070660_100119489 | Ga0070660_1001194892 | 327 |
| 114 | 3300005295 | Ga0065707_10149666 | Ga0065707_101496661 | 328 |
| 115 | 3300005438 | Ga0070701_10026945 | Ga0070701_100269452 | 328 |
| 116 | 3300005456 | Ga0070678_100227331 | Ga0070678_1002273312 | 328 |
| 117 | 3300013296 | Ga0157374_10080339 | Ga0157374_100803392 | 328 |
| 118 | 3300025960 | Ga0207651_10064775 | Ga0207651_100647752 | 328 |
| 119 | 3300026121 | Ga0207683_10078904 | Ga0207683_100789042 | 328 |
| 120 | 3300035242 | Ga0373962_0064323 | Ga0373962_0064323_20_1039 | 328 |
| 121 | 3300035692 | Ga0373935_0166961 | Ga0373935_0166961_400_1476 | 328 |
| 122 | 3300035695 | Ga0373927_0012906 | Ga0373927_0012906_3511_4530 | 328 |
| 123 | 3300035725 | Ga0373947_0022225 | Ga0373947_0022225_1649_2668 | 328 |
| 124 | 3300037068 | Ga0373925_0070111 | Ga0373925_0070111_1292_2311 | 328 |
| 125 | 3300046683 | Ga0495658_0025337 | Ga0495658_0025337_1691_2710 | 328 |
| 126 | 3300047315 | Ga0495581_0055274 | Ga0495581_0055274_1249_2268 | 328 |
| 127 | 3300005444 | Ga0070694_100273182 | Ga0070694_1002731821 | 330 |
| 128 | 3300005535 | Ga0070684_100329897 | Ga0070684_1003298971 | 330 |
| 129 | 3300046455 | Ga0495603_0092350 | Ga0495603_0092350_473_1498 | 330 |
| 130 | 3300046473 | Ga0495582_0014127 | Ga0495582_0014127_1879_2976 | 330 |
| 131 | 3300046475 | Ga0495639_0025722 | Ga0495639_0025722_959_2056 | 330 |
| 132 | 3300046642 | Ga0495634_0038958 | Ga0495634_0038958_995_2092 | 330 |
| 133 | 3300013306 | Ga0163162_10226708 | Ga0163162_102267082 | 334 |
| 134 | 3300005618 | Ga0068864_100121352 | Ga0068864_1001213524 | 335 |
| 135 | 3300026095 | Ga0207676_10115916 | Ga0207676_101159161 | 335 |
| 136 | 3300046475 | Ga0495639_0072984 | Ga0495639_0072984_399_1508 | 335 |
| 137 | 3300050512 | nmdc:mga0n895_59025_c1 | nmdc:mga0n895_59025_c1_2369_3466 | 335 |
| 138 | 3300005295 | Ga0065707_10174666 | Ga0065707_101746661 | 336 |
| 139 | 3300005436 | Ga0070713_100071328 | Ga0070713_1000713284 | 336 |
| 140 | 3300005468 | Ga0070707_100400975 | Ga0070707_1004009751 | 336 |
| 141 | 3300009098 | Ga0105245_10002799 | Ga0105245_100027996 | 336 |
| 142 | 3300009098 | Ga0105245_10262164 | Ga0105245_102621642 | 336 |
| 143 | 3300013297 | Ga0157378_10172554 | Ga0157378_101725542 | 336 |
| 144 | 3300025928 | Ga0207700_10160015 | Ga0207700_101600152 | 336 |
| 145 | 3300026035 | Ga0207703_10020302 | Ga0207703_100203022 | 336 |
| 146 | 3300046664 | Ga0495659_0011228 | Ga0495659_0011228_697_1743 | 336 |
| 147 | 3300005444 | Ga0070694_100075536 | Ga0070694_1000755362 | 337 |
| 148 | 3300009094 | Ga0111539_10011138 | Ga0111539_1001113811 | 337 |
| 149 | 3300009147 | Ga0114129_10119167 | Ga0114129_101191673 | 337 |
| 150 | 3300027907 | Ga0207428_10001471 | Ga0207428_1000147113 | 337 |
| 151 | 3300046538 | Ga0495609_0098177 | Ga0495609_0098177_41_1087 | 337 |
| 152 | 3300050511 | nmdc:mga08y16_19077_c1 | nmdc:mga08y16_19077_c1_126_1226 | 337 |
| 153 | 3300006852 | Ga0075433_10230909 | Ga0075433_102309092 | 338 |
| 154 | 3300047317 | Ga0495604_0184093 | Ga0495604_0184093_73_1125 | 338 |
| 155 | 3300047471 | Ga0495684_0186602 | Ga0495684_0186602_179_1231 | 338 |
| 156 | 3300050515 | nmdc:mga0a205_252354_c1 | nmdc:mga0a205_252354_c1_243_1343 | 338 |
| 157 | 3300009551 | Ga0105238_10007551 | Ga0105238_1000755110 | 339 |
| 158 | 3300025934 | Ga0207686_10144282 | Ga0207686_101442821 | 339 |
| 159 | 3300035083 | Ga0373926_0060627 | Ga0373926_0060627_24_1133 | 339 |
| 160 | 3300046537 | Ga0495598_0014871 | Ga0495598_0014871_66_1175 | 339 |
| 161 | 3300048907 | Ga0496104_0252113 | Ga0496104_0252113_143_1267 | 339 |
| 162 | 3300050508 | nmdc:mga09592_168123_c1 | nmdc:mga09592_168123_c1_337_1467 | 339 |
| 163 | 3300005355 | Ga0070671_100051591 | Ga0070671_1000515912 | 340 |
| 164 | 3300005543 | Ga0070672_100058506 | Ga0070672_1000585063 | 340 |
| 165 | 3300006871 | Ga0075434_100097773 | Ga0075434_1000977732 | 340 |
| 166 | 3300025940 | Ga0207691_10075850 | Ga0207691_100758502 | 340 |
| 167 | 3300005549 | Ga0070704_100226383 | Ga0070704_1002263832 | 341 |
| 168 | 3300005616 | Ga0068852_100178002 | Ga0068852_1001780022 | 341 |
| 169 | 3300005844 | Ga0068862_100075872 | Ga0068862_1000758722 | 341 |
| 170 | 3300006844 | Ga0075428_100003051 | Ga0075428_10000305112 | 341 |
| 171 | 3300006846 | Ga0075430_100176023 | Ga0075430_1001760232 | 341 |
| 172 | 3300006847 | Ga0075431_100012528 | Ga0075431_1000125286 | 341 |
| 173 | 3300006880 | Ga0075429_100011042 | Ga0075429_1000110423 | 341 |
| 174 | 3300026142 | Ga0207698_10135106 | Ga0207698_101351062 | 341 |
| 175 | 3300046477 | Ga0495664_0119702 | Ga0495664_0119702_296_1411 | 341 |
| 176 | 3300050508 | nmdc:mga09592_19614_c1 | nmdc:mga09592_19614_c1_110_1198 | 341 |
| 177 | 3300050509 | nmdc:mga0qj67_124221_c1 | nmdc:mga0qj67_124221_c1_20_1108 | 341 |
| 178 | 3300050510 | nmdc:mga06r32_8322_c1 | nmdc:mga06r32_8322_c1_1538_2626 | 341 |
| 179 | 3300005549 | Ga0070704_100040153 | Ga0070704_1000401532 | 342 |
| 180 | 3300009147 | Ga0114129_10020076 | Ga0114129_100200764 | 342 |
| 181 | 3300031995 | Ga0307409_100017751 | Ga0307409_1000177512 | 342 |
| 182 | 3300032005 | Ga0307411_10090262 | Ga0307411_100902622 | 342 |
| 183 | 3300050507 | nmdc:mga05p37_1455_c1 | nmdc:mga05p37_1455_c1_26055_27167 | 342 |
| 184 | 3300005843 | Ga0068860_100088857 | Ga0068860_1000888573 | 343 |
| 185 | 3300006847 | Ga0075431_100269643 | Ga0075431_1002696432 | 343 |
| 186 | 3300013306 | Ga0163162_10006888 | Ga0163162_100068887 | 343 |
| 187 | 3300046683 | Ga0495658_0121976 | Ga0495658_0121976_68_1129 | 343 |
| 188 | 3300050512 | nmdc:mga0n895_26604_c1 | nmdc:mga0n895_26604_c1_57_1133 | 343 |
| 189 | 3300032005 | Ga0307411_10157777 | Ga0307411_101577772 | 344 |
| 190 | 3300046473 | Ga0495582_0019002 | Ga0495582_0019002_2220_3284 | 344 |
| 191 | 3300046531 | Ga0495665_0009488 | Ga0495665_0009488_424_1488 | 344 |
| 192 | 3300005290 | Ga0065712_10009208 | Ga0065712_100092082 | 345 |
| 193 | 3300005293 | Ga0065715_10089355 | Ga0065715_100893559 | 345 |
| 194 | 3300005468 | Ga0070707_100198431 | Ga0070707_1001984312 | 345 |
| 195 | 3300005545 | Ga0070695_100018179 | Ga0070695_1000181792 | 345 |
| 196 | 3300005549 | Ga0070704_100012587 | Ga0070704_1000125874 | 345 |
| 197 | 3300006881 | Ga0068865_100036402 | Ga0068865_1000364023 | 345 |
| 198 | 3300006914 | Ga0075436_100030830 | Ga0075436_1000308302 | 345 |
| 199 | 3300014325 | Ga0163163_10096972 | Ga0163163_100969722 | 345 |
| 200 | 3300025922 | Ga0207646_10169102 | Ga0207646_101691022 | 345 |
| 201 | 3300025938 | Ga0207704_10174411 | Ga0207704_101744112 | 345 |
| 202 | 3300025960 | Ga0207651_10048489 | Ga0207651_100484892 | 345 |
| 203 | 3300031711 | Ga0265314_10000688 | Ga0265314_1000068818 | 345 |
| 204 | 3300050514 | nmdc:mga08x19_112961_c1 | nmdc:mga08x19_112961_c1_315_1427 | 345 |
| 205 | 3300006846 | Ga0075430_100000342 | Ga0075430_1000003425 | 346 |
| 206 | 3300006847 | Ga0075431_100154821 | Ga0075431_1001548212 | 346 |
| 207 | 3300009147 | Ga0114129_10019932 | Ga0114129_100199322 | 346 |
| 208 | 3300050509 | nmdc:mga0qj67_201_c1 | nmdc:mga0qj67_201_c1_36606_37769 | 346 |
| 209 | 3300050512 | nmdc:mga0n895_7126_c1 | nmdc:mga0n895_7126_c1_1242_2318 | 346 |
| 210 | 3300050515 | nmdc:mga0a205_87962_c1 | nmdc:mga0a205_87962_c1_927_2003 | 346 |
| 211 | 3300005329 | Ga0070683_100022360 | Ga0070683_1000223604 | 347 |
| 212 | 3300005355 | Ga0070671_100044018 | Ga0070671_1000440183 | 347 |
| 213 | 3300005459 | Ga0068867_100120806 | Ga0068867_1001208063 | 347 |
| 214 | 3300005535 | Ga0070684_100024270 | Ga0070684_1000242703 | 347 |
| 215 | 3300005539 | Ga0068853_100082608 | Ga0068853_1000826083 | 347 |
| 216 | 3300005563 | Ga0068855_100013416 | Ga0068855_10001341610 | 347 |
| 217 | 3300005616 | Ga0068852_100092400 | Ga0068852_1000924002 | 347 |
| 218 | 3300005618 | Ga0068864_100468108 | Ga0068864_1004681081 | 347 |
| 219 | 3300005842 | Ga0068858_100387908 | Ga0068858_1003879082 | 347 |
| 220 | 3300005937 | Ga0081455_10023012 | Ga0081455_100230125 | 347 |
| 221 | 3300005983 | Ga0081540_1015506 | Ga0081540_10155062 | 347 |
| 222 | 3300006358 | Ga0068871_100141282 | Ga0068871_1001412822 | 347 |
| 223 | 3300009093 | Ga0105240_10055728 | Ga0105240_100557284 | 347 |
| 224 | 3300009176 | Ga0105242_10087416 | Ga0105242_100874163 | 347 |
| 225 | 3300009551 | Ga0105238_10003498 | Ga0105238_100034987 | 347 |
| 226 | 3300013104 | Ga0157370_10000570 | Ga0157370_100005705 | 347 |
| 227 | 3300013307 | Ga0157372_10070557 | Ga0157372_100705573 | 347 |
| 228 | 3300025919 | Ga0207657_10092760 | Ga0207657_100927602 | 347 |
| 229 | 3300025924 | Ga0207694_10002029 | Ga0207694_1000202911 | 347 |
| 230 | 3300025927 | Ga0207687_10001360 | Ga0207687_1000136011 | 347 |
| 231 | 3300025931 | Ga0207644_10032666 | Ga0207644_100326663 | 347 |
| 232 | 3300025934 | Ga0207686_10089946 | Ga0207686_100899462 | 347 |
| 233 | 3300025944 | Ga0207661_10022391 | Ga0207661_100223912 | 347 |
| 234 | 3300025949 | Ga0207667_10057303 | Ga0207667_100573032 | 347 |
| 235 | 3300025960 | Ga0207651_10030552 | Ga0207651_100305523 | 347 |
| 236 | 3300026041 | Ga0207639_10068572 | Ga0207639_100685722 | 347 |
| 237 | 3300026078 | Ga0207702_10021413 | Ga0207702_100214133 | 347 |
| 238 | 3300026089 | Ga0207648_10258190 | Ga0207648_102581902 | 347 |
| 239 | 3300026121 | Ga0207683_10086073 | Ga0207683_100860733 | 347 |
| 240 | 3300026142 | Ga0207698_10065480 | Ga0207698_100654802 | 347 |
| 241 | 3300046472 | Ga0495580_0009761 | Ga0495580_0009761_61_1134 | 347 |
| 242 | 3300048908 | Ga0496105_0116722 | Ga0496105_0116722_1113_2186 | 347 |
| 243 | 3300005459 | Ga0068867_100015031 | Ga0068867_1000150316 | 348 |
| 244 | 3300005563 | Ga0068855_100102960 | Ga0068855_1001029602 | 348 |
| 245 | 3300005577 | Ga0068857_100126564 | Ga0068857_1001265642 | 348 |
| 246 | 3300006358 | Ga0068871_100005092 | Ga0068871_1000050922 | 348 |
| 247 | 3300006847 | Ga0075431_100054575 | Ga0075431_1000545753 | 348 |
| 248 | 3300009093 | Ga0105240_10205218 | Ga0105240_102052183 | 348 |
| 249 | 3300009545 | Ga0105237_10055938 | Ga0105237_100559385 | 348 |
| 250 | 3300010375 | Ga0105239_10182832 | Ga0105239_101828322 | 348 |
| 251 | 3300013296 | Ga0157374_10548694 | Ga0157374_105486941 | 348 |
| 252 | 3300025913 | Ga0207695_10147462 | Ga0207695_101474622 | 348 |
| 253 | 3300025914 | Ga0207671_10011000 | Ga0207671_100110002 | 348 |
| 254 | 3300025934 | Ga0207686_10009873 | Ga0207686_100098731 | 348 |
| 255 | 3300025938 | Ga0207704_10023554 | Ga0207704_100235542 | 348 |
| 256 | 3300026089 | Ga0207648_10006379 | Ga0207648_1000637911 | 348 |
| 257 | 3300026116 | Ga0207674_10077948 | Ga0207674_100779484 | 348 |
| 258 | 3300035724 | Ga0373933_0026680 | Ga0373933_0026680_556_1650 | 348 |
| 259 | 3300046689 | Ga0495613_0083995 | Ga0495613_0083995_268_1362 | 348 |
| 260 | 3300048918 | Ga0496115_0027972 | Ga0496115_0027972_2295_3371 | 348 |
| 261 | 3300050510 | nmdc:mga06r32_50936_c1 | nmdc:mga06r32_50936_c1_766_1860 | 348 |
| 262 | 3300005434 | Ga0070709_10020907 | Ga0070709_100209073 | 349 |
| 263 | 3300005937 | Ga0081455_10063048 | Ga0081455_100630483 | 349 |
| 264 | 3300006844 | Ga0075428_100098239 | Ga0075428_1000982393 | 349 |
| 265 | 3300006847 | Ga0075431_100428808 | Ga0075431_1004288082 | 349 |
| 266 | 3300006880 | Ga0075429_100014050 | Ga0075429_1000140504 | 349 |
| 267 | 3300009094 | Ga0111539_10005554 | Ga0111539_100055544 | 349 |
| 268 | 3300009094 | Ga0111539_10112896 | Ga0111539_101128962 | 349 |
| 269 | 3300009177 | Ga0105248_10068038 | Ga0105248_100680382 | 349 |
| 270 | 3300025906 | Ga0207699_10082670 | Ga0207699_100826701 | 349 |
| 271 | 3300025941 | Ga0207711_10114005 | Ga0207711_101140052 | 349 |
| 272 | 3300037068 | Ga0373925_0005039 | Ga0373925_0005039_8468_9565 | 349 |
| 273 | 3300049575 | Ga0501039_0094842 | Ga0501039_0094842_300_1376 | 349 |
| 274 | 3300049576 | Ga0501040_0068174 | Ga0501040_0068174_28_1104 | 349 |
| 275 | 3300049578 | Ga0501042_0024196 | Ga0501042_0024196_2633_3709 | 349 |
| 276 | 3300049582 | Ga0501048_0121909 | Ga0501048_0121909_300_1376 | 349 |
| 277 | 3300049591 | Ga0501075_0031520 | Ga0501075_0031520_1583_2659 | 349 |
| 278 | 3300049592 | Ga0501076_0115869 | Ga0501076_0115869_838_1914 | 349 |
| 279 | 3300049743 | Ga0501081_0040920 | Ga0501081_0040920_734_1810 | 349 |
| 280 | 3300050510 | nmdc:mga06r32_293731_c1 | nmdc:mga06r32_293731_c1_126_1268 | 349 |
| 281 | 3300054114 | Ga0501084_0186967 | Ga0501084_0186967_300_1376 | 349 |
| 282 | 3300061734 | Ga0530510_0008298 | Ga0530510_0008298_3545_4621 | 349 |
| 283 | 3300005334 | Ga0068869_100116937 | Ga0068869_1001169372 | 350 |
| 284 | 3300013308 | Ga0157375_10323829 | Ga0157375_103238292 | 350 |
| 285 | 3300014325 | Ga0163163_10011417 | Ga0163163_100114177 | 350 |
| 286 | 3300025912 | Ga0207707_10334118 | Ga0207707_103341182 | 350 |
| 287 | 3300025942 | Ga0207689_10060895 | Ga0207689_100608953 | 350 |
| 288 | 3300031595 | Ga0265313_10022892 | Ga0265313_100228922 | 350 |
| 289 | 3300046499 | Ga0495594_0003464 | Ga0495594_0003464_3392_4480 | 350 |
| 290 | 3300006846 | Ga0075430_100105626 | Ga0075430_1001056264 | 351 |
| 291 | 3300009094 | Ga0111539_10042777 | Ga0111539_100427774 | 351 |
| 292 | 3300035111 | Ga0373923_0011295 | Ga0373923_0011295_1536_2636 | 351 |
| 293 | 3300035117 | Ga0373953_0026047 | Ga0373953_0026047_1083_2183 | 351 |
| 294 | 3300050511 | nmdc:mga08y16_33047_c1 | nmdc:mga08y16_33047_c1_1924_3024 | 351 |
| 295 | 3300005456 | Ga0070678_100054063 | Ga0070678_1000540634 | 352 |
| 296 | 3300005618 | Ga0068864_100059601 | Ga0068864_1000596012 | 352 |
| 297 | 3300006852 | Ga0075433_10001870 | Ga0075433_100018708 | 352 |
| 298 | 3300006871 | Ga0075434_100001267 | Ga0075434_1000012675 | 352 |
| 299 | 3300007076 | Ga0075435_100002821 | Ga0075435_10000282110 | 352 |
| 300 | 3300009176 | Ga0105242_10002798 | Ga0105242_100027982 | 352 |
| 301 | 3300025914 | Ga0207671_10290391 | Ga0207671_102903911 | 352 |
| 302 | 3300025923 | Ga0207681_10060987 | Ga0207681_100609873 | 352 |
| 303 | 3300025934 | Ga0207686_10042178 | Ga0207686_100421782 | 352 |
| 304 | 3300028379 | Ga0268266_10105825 | Ga0268266_101058252 | 352 |
| 305 | 3300050509 | nmdc:mga0qj67_34039_c1 | nmdc:mga0qj67_34039_c1_1059_2147 | 352 |
| 306 | 3300050512 | nmdc:mga0n895_1834_c1 | nmdc:mga0n895_1834_c1_4656_5750 | 352 |
| 307 | 3300050513 | nmdc:mga0rr50_4619_c1 | nmdc:mga0rr50_4619_c1_1011_2105 | 352 |
| 308 | 3300050515 | nmdc:mga0a205_4063_c1 | nmdc:mga0a205_4063_c1_11153_12247 | 352 |
| 309 | 3300005293 | Ga0065715_10020731 | Ga0065715_100207311 | 353 |
| 310 | 3300005295 | Ga0065707_10126867 | Ga0065707_101268672 | 353 |
| 311 | 3300005333 | Ga0070677_10099929 | Ga0070677_100999291 | 353 |
| 312 | 3300005356 | Ga0070674_100019519 | Ga0070674_1000195194 | 353 |
| 313 | 3300014326 | Ga0157380_10003682 | Ga0157380_100036822 | 353 |
| 314 | 3300025937 | Ga0207669_10013181 | Ga0207669_100131812 | 353 |
| 315 | 3300005330 | Ga0070690_100014612 | Ga0070690_1000146122 | 354 |
| 316 | 3300005355 | Ga0070671_100104840 | Ga0070671_1001048402 | 354 |
| 317 | 3300005367 | Ga0070667_100016918 | Ga0070667_1000169182 | 354 |
| 318 | 3300005436 | Ga0070713_100188545 | Ga0070713_1001885452 | 354 |
| 319 | 3300005436 | Ga0070713_100226462 | Ga0070713_1002264622 | 354 |
| 320 | 3300005458 | Ga0070681_10003849 | Ga0070681_1000384913 | 354 |
| 321 | 3300005719 | Ga0068861_100189101 | Ga0068861_1001891012 | 354 |
| 322 | 3300005841 | Ga0068863_100051532 | Ga0068863_1000515322 | 354 |
| 323 | 3300005843 | Ga0068860_100004137 | Ga0068860_1000041372 | 354 |
| 324 | 3300006237 | Ga0097621_100017933 | Ga0097621_1000179333 | 354 |
| 325 | 3300006237 | Ga0097621_100040603 | Ga0097621_1000406032 | 354 |
| 326 | 3300006844 | Ga0075428_100000671 | Ga0075428_1000006716 | 354 |
| 327 | 3300006846 | Ga0075430_100004736 | Ga0075430_1000047363 | 354 |
| 328 | 3300006847 | Ga0075431_100017720 | Ga0075431_1000177203 | 354 |
| 329 | 3300006880 | Ga0075429_100001556 | Ga0075429_10000155615 | 354 |
| 330 | 3300006881 | Ga0068865_100027656 | Ga0068865_1000276562 | 354 |
| 331 | 3300009147 | Ga0114129_10153105 | Ga0114129_101531053 | 354 |
| 332 | 3300009176 | Ga0105242_10006040 | Ga0105242_100060407 | 354 |
| 333 | 3300009177 | Ga0105248_10009933 | Ga0105248_100099337 | 354 |
| 334 | 3300009177 | Ga0105248_10242330 | Ga0105248_102423302 | 354 |
| 335 | 3300013308 | Ga0157375_10062200 | Ga0157375_100622002 | 354 |
| 336 | 3300013308 | Ga0157375_10681158 | Ga0157375_106811581 | 354 |
| 337 | 3300014969 | Ga0157376_10015129 | Ga0157376_100151294 | 354 |
| 338 | 3300014969 | Ga0157376_10301862 | Ga0157376_103018622 | 354 |
| 339 | 3300025912 | Ga0207707_10088645 | Ga0207707_100886452 | 354 |
| 340 | 3300025921 | Ga0207652_10248217 | Ga0207652_102482172 | 354 |
| 341 | 3300025924 | Ga0207694_10009724 | Ga0207694_100097246 | 354 |
| 342 | 3300025927 | Ga0207687_10022675 | Ga0207687_100226752 | 354 |
| 343 | 3300025931 | Ga0207644_10279843 | Ga0207644_102798432 | 354 |
| 344 | 3300025933 | Ga0207706_10065055 | Ga0207706_100650552 | 354 |
| 345 | 3300025934 | Ga0207686_10016842 | Ga0207686_100168422 | 354 |
| 346 | 3300025940 | Ga0207691_10235856 | Ga0207691_102358562 | 354 |
| 347 | 3300025941 | Ga0207711_10008109 | Ga0207711_100081093 | 354 |
| 348 | 3300025941 | Ga0207711_10238982 | Ga0207711_102389821 | 354 |
| 349 | 3300025960 | Ga0207651_10021257 | Ga0207651_100212572 | 354 |
| 350 | 3300025986 | Ga0207658_10006450 | Ga0207658_100064502 | 354 |
| 351 | 3300026088 | Ga0207641_10038701 | Ga0207641_100387012 | 354 |
| 352 | 3300026088 | Ga0207641_10141550 | Ga0207641_101415501 | 354 |
| 353 | 3300028379 | Ga0268266_10319326 | Ga0268266_103193262 | 354 |
| 354 | 3300049824 | Ga0501045_0143187 | Ga0501045_0143187_346_1443 | 354 |
| 355 | 3300050508 | nmdc:mga09592_10400_c1 | nmdc:mga09592_10400_c1_620_1723 | 354 |
| 356 | 3300050509 | nmdc:mga0qj67_11886_c1 | nmdc:mga0qj67_11886_c1_787_1890 | 354 |
| 357 | 3300050510 | nmdc:mga06r32_12636_c1 | nmdc:mga06r32_12636_c1_4817_5920 | 354 |
| 358 | 3300005335 | Ga0070666_10057936 | Ga0070666_100579362 | 355 |
| 359 | 3300005338 | Ga0068868_100228068 | Ga0068868_1002280681 | 355 |
| 360 | 3300006847 | Ga0075431_100168997 | Ga0075431_1001689972 | 355 |
| 361 | 3300009094 | Ga0111539_10371634 | Ga0111539_103716341 | 355 |
| 362 | 3300009177 | Ga0105248_10009554 | Ga0105248_100095546 | 355 |
| 363 | 3300009551 | Ga0105238_10343246 | Ga0105238_103432461 | 355 |
| 364 | 3300014325 | Ga0163163_10111750 | Ga0163163_101117502 | 355 |
| 365 | 3300025924 | Ga0207694_10240092 | Ga0207694_102400922 | 355 |
| 366 | 3300025925 | Ga0207650_10090673 | Ga0207650_100906732 | 355 |
| 367 | 3300042436 | Ga0439435_0010511 | Ga0439435_0010511_981_2138 | 355 |
| 368 | 3300046499 | Ga0495594_0023891 | Ga0495594_0023891_1327_2481 | 355 |
| 369 | 3300046559 | Ga0495667_0064697 | Ga0495667_0064697_878_1993 | 355 |
| 370 | 3300046642 | Ga0495634_0109967 | Ga0495634_0109967_374_1492 | 355 |
| 371 | 3300005288 | Ga0065714_10087600 | Ga0065714_100876002 | 356 |
| 372 | 3300005293 | Ga0065715_10012322 | Ga0065715_100123222 | 356 |
| 373 | 3300005334 | Ga0068869_100065251 | Ga0068869_1000652512 | 356 |
| 374 | 3300005353 | Ga0070669_100043889 | Ga0070669_1000438894 | 356 |
| 375 | 3300005354 | Ga0070675_100083966 | Ga0070675_1000839663 | 356 |
| 376 | 3300005364 | Ga0070673_100003697 | Ga0070673_1000036979 | 356 |
| 377 | 3300005364 | Ga0070673_100051124 | Ga0070673_1000511244 | 356 |
| 378 | 3300005456 | Ga0070678_100011635 | Ga0070678_1000116352 | 356 |
| 379 | 3300005458 | Ga0070681_10039175 | Ga0070681_100391752 | 356 |
| 380 | 3300005468 | Ga0070707_100139772 | Ga0070707_1001397721 | 356 |
| 381 | 3300005543 | Ga0070672_100158457 | Ga0070672_1001584572 | 356 |
| 382 | 3300005719 | Ga0068861_100141542 | Ga0068861_1001415422 | 356 |
| 383 | 3300005840 | Ga0068870_10002696 | Ga0068870_100026964 | 356 |
| 384 | 3300005844 | Ga0068862_100267313 | Ga0068862_1002673132 | 356 |
| 385 | 3300005985 | Ga0081539_10001123 | Ga0081539_1000112326 | 356 |
| 386 | 3300009094 | Ga0111539_10222987 | Ga0111539_102229872 | 356 |
| 387 | 3300009098 | Ga0105245_10077017 | Ga0105245_100770172 | 356 |
| 388 | 3300009147 | Ga0114129_10003741 | Ga0114129_1000374112 | 356 |
| 389 | 3300009147 | Ga0114129_10029461 | Ga0114129_100294615 | 356 |
| 390 | 3300013308 | Ga0157375_10048147 | Ga0157375_100481474 | 356 |
| 391 | 3300014326 | Ga0157380_10016294 | Ga0157380_100162942 | 356 |
| 392 | 3300025907 | Ga0207645_10086692 | Ga0207645_100866922 | 356 |
| 393 | 3300025908 | Ga0207643_10008053 | Ga0207643_100080532 | 356 |
| 394 | 3300025922 | Ga0207646_10154071 | Ga0207646_101540712 | 356 |
| 395 | 3300025926 | Ga0207659_10061401 | Ga0207659_100614012 | 356 |
| 396 | 3300025940 | Ga0207691_10026050 | Ga0207691_100260502 | 356 |
| 397 | 3300025960 | Ga0207651_10010839 | Ga0207651_100108393 | 356 |
| 398 | 3300026089 | Ga0207648_10069308 | Ga0207648_100693084 | 356 |
| 399 | 3300026118 | Ga0207675_100364796 | Ga0207675_1003647962 | 356 |
| 400 | 3300028380 | Ga0268265_10088693 | Ga0268265_100886933 | 356 |
| 401 | 3300028380 | Ga0268265_10156003 | Ga0268265_101560032 | 356 |
| 402 | 3300049575 | Ga0501039_0157197 | Ga0501039_0157197_473_1594 | 356 |
| 403 | 3300049576 | Ga0501040_0166142 | Ga0501040_0166142_182_1303 | 356 |
| 404 | 3300049591 | Ga0501075_0021967 | Ga0501075_0021967_762_1883 | 356 |
| 405 | 3300049592 | Ga0501076_0040571 | Ga0501076_0040571_2280_3401 | 356 |
| 406 | 3300049741 | Ga0501079_0016592 | Ga0501079_0016592_2758_3879 | 356 |
| 407 | 3300049743 | Ga0501081_0001316 | Ga0501081_0001316_2887_4008 | 356 |
| 408 | 3300049822 | Ga0501035_0090365 | Ga0501035_0090365_461_1582 | 356 |
| 409 | 3300049824 | Ga0501045_0001602 | Ga0501045_0001602_2812_3933 | 356 |
| 410 | 3300050507 | nmdc:mga05p37_8616_c2 | nmdc:mga05p37_8616_c2_6665_7783 | 356 |
| 411 | 3300050513 | nmdc:mga0rr50_30654_c1 | nmdc:mga0rr50_30654_c1_2262_3362 | 356 |
| 412 | 3300054114 | Ga0501084_0039207 | Ga0501084_0039207_1935_3056 | 356 |
| 413 | 3300060353 | Ga0501082_0007369 | Ga0501082_0007369_2947_4068 | 356 |
| 414 | 3300005293 | Ga0065715_10005897 | Ga0065715_100058972 | 357 |
| 415 | 3300005328 | Ga0070676_10026333 | Ga0070676_100263332 | 357 |
| 416 | 3300005333 | Ga0070677_10020198 | Ga0070677_100201982 | 357 |
| 417 | 3300005334 | Ga0068869_100175113 | Ga0068869_1001751132 | 357 |
| 418 | 3300005338 | Ga0068868_100010145 | Ga0068868_1000101453 | 357 |
| 419 | 3300005340 | Ga0070689_100021346 | Ga0070689_1000213462 | 357 |
| 420 | 3300005353 | Ga0070669_100020283 | Ga0070669_1000202833 | 357 |
| 421 | 3300005364 | Ga0070673_100013605 | Ga0070673_1000136053 | 357 |
| 422 | 3300005367 | Ga0070667_100062416 | Ga0070667_1000624163 | 357 |
| 423 | 3300005438 | Ga0070701_10006253 | Ga0070701_100062533 | 357 |
| 424 | 3300005457 | Ga0070662_100004709 | Ga0070662_1000047093 | 357 |
| 425 | 3300005466 | Ga0070685_10016609 | Ga0070685_100166094 | 357 |
| 426 | 3300005548 | Ga0070665_100169811 | Ga0070665_1001698113 | 357 |
| 427 | 3300005719 | Ga0068861_100086284 | Ga0068861_1000862842 | 357 |
| 428 | 3300005840 | Ga0068870_10008107 | Ga0068870_100081074 | 357 |
| 429 | 3300005842 | Ga0068858_100027619 | Ga0068858_1000276193 | 357 |
| 430 | 3300005843 | Ga0068860_100053410 | Ga0068860_1000534103 | 357 |
| 431 | 3300005844 | Ga0068862_100022549 | Ga0068862_1000225493 | 357 |
| 432 | 3300006237 | Ga0097621_100223596 | Ga0097621_1002235962 | 357 |
| 433 | 3300006880 | Ga0075429_100015477 | Ga0075429_1000154775 | 357 |
| 434 | 3300006881 | Ga0068865_100017599 | Ga0068865_1000175993 | 357 |
| 435 | 3300009094 | Ga0111539_10033694 | Ga0111539_100336944 | 357 |
| 436 | 3300009177 | Ga0105248_10106549 | Ga0105248_101065493 | 357 |
| 437 | 3300013306 | Ga0163162_10024011 | Ga0163162_100240113 | 357 |
| 438 | 3300014326 | Ga0157380_10012175 | Ga0157380_100121754 | 357 |
| 439 | 3300025893 | Ga0207682_10000800 | Ga0207682_100008003 | 357 |
| 440 | 3300025907 | Ga0207645_10005880 | Ga0207645_100058802 | 357 |
| 441 | 3300025908 | Ga0207643_10000941 | Ga0207643_1000094111 | 357 |
| 442 | 3300025923 | Ga0207681_10060264 | Ga0207681_100602643 | 357 |
| 443 | 3300025938 | Ga0207704_10135892 | Ga0207704_101358922 | 357 |
| 444 | 3300025942 | Ga0207689_10004772 | Ga0207689_100047725 | 357 |
| 445 | 3300025986 | Ga0207658_10099215 | Ga0207658_100992152 | 357 |
| 446 | 3300026118 | Ga0207675_100033671 | Ga0207675_1000336715 | 357 |
| 447 | 3300027907 | Ga0207428_10003846 | Ga0207428_100038469 | 357 |
| 448 | 3300028379 | Ga0268266_10160844 | Ga0268266_101608442 | 357 |
| 449 | 3300028380 | Ga0268265_10026193 | Ga0268265_100261935 | 357 |
| 450 | 3300045051 | Ga0451576_0021989 | Ga0451576_0021989_5657_6784 | 357 |
| 451 | 3300050508 | nmdc:mga09592_56461_c1 | nmdc:mga09592_56461_c1_87_1214 | 357 |
| 452 | 3300005334 | Ga0068869_100222705 | Ga0068869_1002227052 | 358 |
| 453 | 3300005338 | Ga0068868_100155676 | Ga0068868_1001556762 | 358 |
| 454 | 3300005356 | Ga0070674_100184671 | Ga0070674_1001846711 | 358 |
| 455 | 3300005842 | Ga0068858_100087366 | Ga0068858_1000873663 | 358 |
| 456 | 3300006237 | Ga0097621_100181538 | Ga0097621_1001815382 | 358 |
| 457 | 3300006871 | Ga0075434_100007176 | Ga0075434_1000071763 | 358 |
| 458 | 3300007076 | Ga0075435_100032148 | Ga0075435_1000321481 | 358 |
| 459 | 3300009098 | Ga0105245_10015703 | Ga0105245_100157037 | 358 |
| 460 | 3300009176 | Ga0105242_10140239 | Ga0105242_101402392 | 358 |
| 461 | 3300009177 | Ga0105248_10028518 | Ga0105248_100285183 | 358 |
| 462 | 3300009177 | Ga0105248_10076703 | Ga0105248_100767032 | 358 |
| 463 | 3300013306 | Ga0163162_10367235 | Ga0163162_103672351 | 358 |
| 464 | 3300013308 | Ga0157375_10270911 | Ga0157375_102709112 | 358 |
| 465 | 3300014969 | Ga0157376_10001464 | Ga0157376_100014644 | 358 |
| 466 | 3300025907 | Ga0207645_10064515 | Ga0207645_100645152 | 358 |
| 467 | 3300025934 | Ga0207686_10176284 | Ga0207686_101762842 | 358 |
| 468 | 3300025938 | Ga0207704_10037376 | Ga0207704_100373763 | 358 |
| 469 | 3300025941 | Ga0207711_10095178 | Ga0207711_100951782 | 358 |
| 470 | 3300025942 | Ga0207689_10265747 | Ga0207689_102657472 | 358 |
| 471 | 3300005577 | Ga0068857_100127822 | Ga0068857_1001278222 | 359 |
| 472 | 3300005985 | Ga0081539_10003380 | Ga0081539_1000338015 | 359 |
| 473 | 3300009094 | Ga0111539_10011039 | Ga0111539_100110392 | 359 |
| 474 | 3300009177 | Ga0105248_10431387 | Ga0105248_104313871 | 359 |
| 475 | 3300050511 | nmdc:mga08y16_156340_c1 | nmdc:mga08y16_156340_c1_725_1834 | 359 |
| 476 | 3300005354 | Ga0070675_100053208 | Ga0070675_1000532082 | 360 |
| 477 | 3300005842 | Ga0068858_100001351 | Ga0068858_10000135116 | 360 |
| 478 | 3300007265 | Ga0099794_10093151 | Ga0099794_100931512 | 360 |
| 479 | 3300025913 | Ga0207695_10052420 | Ga0207695_100524202 | 360 |
| 480 | 3300025928 | Ga0207700_10179037 | Ga0207700_101790372 | 360 |
| 481 | 3300025942 | Ga0207689_10080083 | Ga0207689_100800833 | 360 |
| 482 | 3300025949 | Ga0207667_10078514 | Ga0207667_100785144 | 360 |
| 483 | 3300026089 | Ga0207648_10256192 | Ga0207648_102561922 | 360 |
| 484 | 3300050511 | nmdc:mga08y16_25884_c1 | nmdc:mga08y16_25884_c1_3944_5059 | 360 |
| 485 | 3300050515 | nmdc:mga0a205_155573_c1 | nmdc:mga0a205_155573_c1_76_1206 | 360 |
| 486 | 3300005295 | Ga0065707_10094052 | Ga0065707_100940522 | 361 |
| 487 | 3300005354 | Ga0070675_100064586 | Ga0070675_1000645864 | 361 |
| 488 | 3300005471 | Ga0070698_100129028 | Ga0070698_1001290282 | 361 |
| 489 | 3300035695 | Ga0373927_0063377 | Ga0373927_0063377_89_1204 | 361 |
| 490 | 3300036401 | Ga0373937_0054617 | Ga0373937_0054617_953_2068 | 361 |
| 491 | 3300037068 | Ga0373925_0043588 | Ga0373925_0043588_1786_2901 | 361 |
| 492 | 3300047319 | Ga0495674_0052279 | Ga0495674_0052279_2453_3568 | 361 |
| 493 | 3300053078 | Ga0495612_0029063 | Ga0495612_0029063_741_1856 | 361 |
| 494 | 3300003203 | JGI25406J46586_10001085 | JGI25406J46586_100010859 | 362 |
| 495 | 3300005330 | Ga0070690_100074318 | Ga0070690_1000743181 | 362 |
| 496 | 3300005343 | Ga0070687_100086088 | Ga0070687_1000860882 | 362 |
| 497 | 3300005344 | Ga0070661_100039715 | Ga0070661_1000397152 | 362 |
| 498 | 3300005355 | Ga0070671_100054563 | Ga0070671_1000545632 | 362 |
| 499 | 3300005365 | Ga0070688_100050401 | Ga0070688_1000504012 | 362 |
| 500 | 3300005456 | Ga0070678_100015207 | Ga0070678_1000152074 | 362 |
| 501 | 3300005471 | Ga0070698_100123558 | Ga0070698_1001235583 | 362 |
| 502 | 3300005518 | Ga0070699_100012959 | Ga0070699_1000129595 | 362 |
| 503 | 3300005544 | Ga0070686_100009775 | Ga0070686_1000097753 | 362 |
| 504 | 3300005549 | Ga0070704_100116781 | Ga0070704_1001167812 | 362 |
| 505 | 3300005564 | Ga0070664_100008705 | Ga0070664_1000087054 | 362 |
| 506 | 3300005617 | Ga0068859_100006551 | Ga0068859_1000065515 | 362 |
| 507 | 3300005841 | Ga0068863_100170633 | Ga0068863_1001706332 | 362 |
| 508 | 3300005985 | Ga0081539_10000010 | Ga0081539_10000010116 | 362 |
| 509 | 3300006852 | Ga0075433_10001202 | Ga0075433_100012027 | 362 |
| 510 | 3300006931 | Ga0097620_100006551 | Ga0097620_1000065516 | 362 |
| 511 | 3300009147 | Ga0114129_10068758 | Ga0114129_100687582 | 362 |
| 512 | 3300014745 | Ga0157377_10015214 | Ga0157377_100152144 | 362 |
| 513 | 3300025901 | Ga0207688_10024087 | Ga0207688_100240872 | 362 |
| 514 | 3300025918 | Ga0207662_10050444 | Ga0207662_100504441 | 362 |
| 515 | 3300025933 | Ga0207706_10002760 | Ga0207706_100027605 | 362 |
| 516 | 3300025945 | Ga0207679_10042708 | Ga0207679_100427082 | 362 |
| 517 | 3300026075 | Ga0207708_10042995 | Ga0207708_100429952 | 362 |
| 518 | 3300026088 | Ga0207641_10012782 | Ga0207641_100127822 | 362 |
| 519 | 3300026121 | Ga0207683_10034303 | Ga0207683_100343035 | 362 |
| 520 | 3300036401 | Ga0373937_0124128 | Ga0373937_0124128_323_1441 | 362 |
| 521 | 3300037068 | Ga0373925_0053102 | Ga0373925_0053102_1464_2582 | 362 |
| 522 | 3300046455 | Ga0495603_0155000 | Ga0495603_0155000_14_1132 | 362 |
| 523 | 3300046539 | Ga0495621_0014412 | Ga0495621_0014412_477_1595 | 362 |
| 524 | 3300048903 | Ga0496100_0005342 | Ga0496100_0005342_5327_6463 | 362 |
| 525 | 3300048912 | Ga0496109_0127136 | Ga0496109_0127136_1101_2228 | 362 |
| 526 | 3300048917 | Ga0496114_0000906 | Ga0496114_0000906_5115_6251 | 362 |
| 527 | 3300048918 | Ga0496115_0191537 | Ga0496115_0191537_28_1164 | 362 |
| 528 | 3300050510 | nmdc:mga06r32_204966_c1 | nmdc:mga06r32_204966_c1_723_1841 | 362 |
| 529 | 3300050512 | nmdc:mga0n895_29204_c1 | nmdc:mga0n895_29204_c1_1446_2573 | 362 |
| 530 | 3300050515 | nmdc:mga0a205_11870_c1 | nmdc:mga0a205_11870_c1_6764_7891 | 362 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7qrv-assembly2.cif.gz_B | crystal structure of nhl domain of trim2 (full c-terminal) | 0.7916 | 66 | 360 |
| 1npe-assembly1.cif.gz_A | crystal structure of nidogen/laminin complex | 0.7846 | 67 | 323 |
| 3ww8-assembly1.cif.gz_B | crystal structure of the computationally designed pizza3 protein | 0.7811 | 233 | 357 |
| 7qrw-assembly1.cif.gz_A | crystal structure of nhl domain of trim3 | 0.7726 | 66 | 361 |
| 3fw0-assembly1.cif.gz_A | structure of peptidyl-alpha-hydroxyglycine alpha-amidating lyase (pal) bound to alpha-hydroxyhippuric acid (non-peptidic substrate) | 0.7659 | 43 | 361 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q79FU0_283_386_2.40.10.500 | Mainly Beta;Beta Barrel;Thrombin, subunit H; | 0.8098 | 236 | 343 | 2.40.10.500 |
| af_A0A1D6E8A7_186_285_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8054 | 276 | 359 | 2.130.10.10 |
| af_B7YZK8_1340_1431_2.40.10.500 | Mainly Beta;Beta Barrel;Thrombin, subunit H; | 0.801 | 226 | 316 | 2.40.10.500 |
| af_B7YZK8_1231_1339_2.40.10.500 | Mainly Beta;Beta Barrel;Thrombin, subunit H; | 0.7984 | 223 | 320 | 2.40.10.500 |
| af_Q9U489_879_1020_2.40.10.500 | Mainly Beta;Beta Barrel;Thrombin, subunit H; | 0.7966 | 223 | 357 | 2.40.10.500 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8IL83-F1-model_v4 | 6-bladed beta-propeller | 0.982 | 221 | 361 |
|
| AF-A0A2V8M559-F1-model_v4 | SMP-30/Gluconolactonase/LRE-like region domain-containing protein | 0.9804 | 238 | 361 |
|
| AF-A0A2V8IL83-F1-model_v4 | 6-bladed beta-propeller | 0.9751 | 221 | 361 |
|
| AF-A0A2V8M559-F1-model_v4 | SMP-30/Gluconolactonase/LRE-like region domain-containing protein | 0.9726 | 238 | 361 |
|
| AF-A0A2V8KFD0-F1-model_v4 | 6-bladed beta-propeller | 0.9654 | 94 | 361 |
GO:0005576
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar