F459841

General Info

Members Datasets Scaffolds Average Seq Length
529 218 1058 115

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0059424|Ga0466966_0059424_1958_2308
Length 116
Sequence MHPELMRQVAMARMADFNRNAARYRRARQATFRRPQPVRTAIQLRASACREELERLALLSERPLREGGDWIVADVDGVAVAAVSVEDGTTVYDPFRPTSQAVSLLRLRRKQVLTAA

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
102 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
103 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
108 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
111 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
126 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
150 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
158 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
171 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
172 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
173 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
174 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
175 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
214 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
215 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
218 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.73
Metatranscriptomes 2.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 10.21
Rhizosphere 89.22
Stem 0
Stem Tuber 0
Unclassified 12.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0059424 3300044684 Bacteria 2414
2 rootH1_10165460 3300003323 Bacteria 1664
3 Ga0070658_10073144 3300005327 Bacteria 2810
4 Ga0070683_100129799 3300005329 Bacteria 2385
5 Ga0070683_100366323 3300005329 Bacteria 1372
6 Ga0070683_100616390 3300005329 Bacteria 1039
7 Ga0070683_101574501 3300005329 Bacteria 632
8 Ga0070690_101729702 3300005330 Bacteria 509
9 Ga0070680_100037484 3300005336 Bacteria 3917
10 Ga0070680_100108482 3300005336 Bacteria 2309
11 Ga0070682_100225513 3300005337 Bacteria 1337
12 Ga0070682_100362089 3300005337 Bacteria 1085
13 Ga0070682_100522096 3300005337 Bacteria 924
14 Ga0070682_100812638 3300005337 Bacteria 761
15 Ga0068868_100317308 3300005338 Bacteria 1327
16 Ga0068868_101657357 3300005338 Bacteria 602
17 Ga0070660_100051424 3300005339 Bacteria 3173
18 Ga0070660_100560862 3300005339 Bacteria 953
19 Ga0070660_101905139 3300005339 Unclassified 507
20 Ga0070689_100695891 3300005340 Bacteria 887
21 Ga0070691_10090143 3300005341 Bacteria 1511
22 Ga0070661_100123530 3300005344 Bacteria 1940
23 Ga0070671_100614051 3300005355 Bacteria 940
24 Ga0070659_100032341 3300005366 Bacteria 4056
25 Ga0070659_101047228 3300005366 Bacteria 718
26 Ga0070659_101626901 3300005366 Unclassified 577
27 Ga0070709_10005227 3300005434 Bacteria 7023
28 Ga0070709_10045926 3300005434 Bacteria 2714
29 Ga0070714_100008658 3300005435 Bacteria 7956
30 Ga0070714_100024330 3300005435 Bacteria 4984
31 Ga0070714_100033947 3300005435 Bacteria 4271
32 Ga0070714_100037311 3300005435 Bacteria 4083
33 Ga0070714_100070280 3300005435 Bacteria 3026
34 Ga0070714_100401584 3300005435 Bacteria 1295
35 Ga0070714_102018027 3300005435 Bacteria 562
36 Ga0070713_100041466 3300005436 Bacteria 3750
37 Ga0070713_100130919 3300005436 Bacteria 2212
38 Ga0070713_100595324 3300005436 Bacteria 1050
39 Ga0070713_102492242 3300005436 Unclassified 500
40 Ga0070710_10003439 3300005437 Bacteria 7503
41 Ga0070710_10009232 3300005437 Bacteria 4820
42 Ga0070710_10362156 3300005437 Bacteria 963
43 Ga0070711_100027039 3300005439 Bacteria 3763
44 Ga0070711_100047147 3300005439 Bacteria 2940
45 Ga0070711_100462746 3300005439 Bacteria 1040
46 Ga0070711_100592735 3300005439 Unclassified 924
47 Ga0070711_102023504 3300005439 Unclassified 507
48 Ga0070705_100234719 3300005440 Bacteria 1278
49 Ga0070694_100089405 3300005444 Bacteria 2158
50 Ga0070694_100721798 3300005444 Bacteria 812
51 Ga0070662_100583750 3300005457 Bacteria 939
52 Ga0070681_10051474 3300005458 Bacteria 4108
53 Ga0070681_10079821 3300005458 Bacteria 3228
54 Ga0070681_10342328 3300005458 Bacteria 1405
55 Ga0070706_100336286 3300005467 Bacteria 1408
56 Ga0070707_100001986 3300005468 Bacteria 19582
57 Ga0070707_101137191 3300005468 Bacteria 747
58 Ga0070707_101381501 3300005468 Bacteria 671
59 Ga0070698_100219347 3300005471 Bacteria 1836
60 Ga0070679_100072110 3300005530 Bacteria 3445
61 Ga0070679_100078303 3300005530 Bacteria 3294
62 Ga0070684_100064797 3300005535 Bacteria 3206
63 Ga0070684_100201828 3300005535 Bacteria 1811
64 Ga0070684_101925879 3300005535 Bacteria 558
65 Ga0070697_100773346 3300005536 Bacteria 849
66 Ga0070697_100804516 3300005536 Bacteria 832
67 Ga0068853_100895866 3300005539 Bacteria 852
68 Ga0070695_100000814 3300005545 Bacteria 16811
69 Ga0070695_101083295 3300005545 Bacteria 655
70 Ga0070693_100784384 3300005547 Bacteria 705
71 Ga0070704_100064573 3300005549 Bacteria 2632
72 Ga0068855_100248344 3300005563 Bacteria 1985
73 Ga0068855_100294375 3300005563 Unclassified 1799
74 Ga0070664_100174483 3300005564 Bacteria 1908
75 Ga0068856_100145685 3300005614 Bacteria 2376
76 Ga0068856_100632822 3300005614 Bacteria 1090
77 Ga0068856_100843316 3300005614 Bacteria 936
78 Ga0070702_100352085 3300005615 Bacteria 1037
79 Ga0068852_100097658 3300005616 Bacteria 2643
80 Ga0068863_100412618 3300005841 Bacteria 1322
81 Ga0068860_101537212 3300005843 Unclassified 687
82 Ga0070717_10007800 3300006028 Bacteria 7966
83 Ga0070717_10056185 3300006028 Bacteria 3251
84 Ga0070717_10088713 3300006028 Bacteria 2607
85 Ga0070715_10021489 3300006163 Bacteria 2503
86 Ga0070715_10069226 3300006163 Bacteria 1572
87 Ga0070716_100019365 3300006173 Bacteria 3556
88 Ga0070716_100373935 3300006173 Bacteria 1016
89 Ga0070716_100389974 3300006173 Bacteria 998
90 Ga0070716_101579568 3300006173 Bacteria 538
91 Ga0070712_100016542 3300006175 Bacteria 4765
92 Ga0070712_100210879 3300006175 Bacteria 1531
93 Ga0070712_100470114 3300006175 Bacteria 1050
94 Ga0070712_100576985 3300006175 Bacteria 950
95 Ga0070712_101122520 3300006175 Unclassified 683
96 Ga0075433_10491832 3300006852 Unclassified 1080
97 Ga0075433_10624501 3300006852 Bacteria 945
98 Ga0075434_100157187 3300006871 Bacteria 2293
99 Ga0075434_101608288 3300006871 Bacteria 658
100 Ga0075435_101322390 3300007076 Unclassified 631
101 Ga0105240_10407593 3300009093 Unclassified 1530
102 Ga0105240_10490071 3300009093 Bacteria 1369
103 Ga0105240_12268068 3300009093 Bacteria 562
104 Ga0105245_10079742 3300009098 Bacteria 2990
105 Ga0105241_10727162 3300009174 Bacteria 908
106 Ga0105248_10088356 3300009177 Bacteria 3488
107 Ga0105237_10011717 3300009545 Bacteria 9272
108 Ga0105237_10466644 3300009545 Bacteria 1268
109 Ga0105237_10821067 3300009545 Bacteria 937
110 Ga0105238_10450213 3300009551 Bacteria 1284
111 Ga0105238_10685846 3300009551 Bacteria 1036
112 Ga0105249_10988960 3300009553 Bacteria 910
113 Ga0105239_10452822 3300010375 Bacteria 1456
114 Ga0105239_11977906 3300010375 Bacteria 677
115 Ga0157373_10948097 3300013100 Bacteria 640
116 Ga0157371_10563760 3300013102 Bacteria 845
117 Ga0157370_11082174 3300013104 Bacteria 725
118 Ga0157369_10654885 3300013105 Bacteria 1083
119 Ga0157369_10954431 3300013105 Bacteria 879
120 Ga0157374_10053595 3300013296 Bacteria 3760
121 Ga0157374_10091287 3300013296 Bacteria 2904
122 Ga0157378_11332222 3300013297 Unclassified 760
123 Ga0157372_10162489 3300013307 Bacteria 2581
124 Ga0157372_10314130 3300013307 Bacteria 1824
125 Ga0157372_10990119 3300013307 Unclassified 974
126 Ga0157372_11557328 3300013307 Bacteria 761
127 Ga0182008_10068894 3300014497 Unclassified 1741
128 Ga0182008_10372733 3300014497 Bacteria 761
129 Ga0182008_10956873 3300014497 Unclassified 508
130 Ga0157377_10998008 3300014745 Bacteria 634
131 Ga0157376_10432611 3300014969 Bacteria 1279
132 Ga0157376_12521369 3300014969 Bacteria 554
133 Ga0197907_10394550 3300020069 Bacteria 733
134 Ga0197907_10497667 3300020069 Bacteria 634
135 Ga0206356_10802283 3300020070 Bacteria 511
136 Ga0206356_10989153 3300020070 Bacteria 2931
137 Ga0206349_1852444 3300020075 Bacteria 613
138 Ga0206350_11436359 3300020080 Bacteria 605
139 Ga0206354_11244338 3300020081 Bacteria 1365
140 Ga0206353_11954450 3300020082 Bacteria 2665
141 Ga0224712_10025428 3300022467 Bacteria 2081
142 Ga0224712_10197100 3300022467 Bacteria 914
143 Ga0224712_10298936 3300022467 Bacteria 752
144 Ga0224712_10408332 3300022467 Bacteria 648
145 Ga0207692_10005324 3300025898 Bacteria 5149
146 Ga0207692_10028126 3300025898 Bacteria 2655
147 Ga0207692_10068332 3300025898 Bacteria 1863
148 Ga0207685_10067479 3300025905 Bacteria 1439
149 Ga0207699_10017684 3300025906 Bacteria 3760
150 Ga0207699_10056405 3300025906 Bacteria 2341
151 Ga0207699_10995300 3300025906 Bacteria 620
152 Ga0207699_11447100 3300025906 Unclassified 508
153 Ga0207705_10079078 3300025909 Bacteria 2394
154 Ga0207684_10398312 3300025910 Bacteria 1183
155 Ga0207707_10158917 3300025912 Bacteria 1976
156 Ga0207707_10389603 3300025912 Bacteria 1197
157 Ga0207695_10252136 3300025913 Bacteria 1664
158 Ga0207671_10027756 3300025914 Bacteria 4232
159 Ga0207671_10521592 3300025914 Bacteria 947
160 Ga0207693_10000282 3300025915 Bacteria 47278
161 Ga0207693_10231790 3300025915 Bacteria 1450
162 Ga0207663_10007649 3300025916 Bacteria 5617
163 Ga0207663_10717703 3300025916 Unclassified 792
164 Ga0207663_11293401 3300025916 Unclassified 587
165 Ga0207660_10319830 3300025917 Bacteria 1239
166 Ga0207660_10724895 3300025917 Unclassified 811
167 Ga0207657_10000988 3300025919 Bacteria 30190
168 Ga0207657_11178567 3300025919 Bacteria 583
169 Ga0207649_11187328 3300025920 Bacteria 603
170 Ga0207652_10425497 3300025921 Bacteria 1197
171 Ga0207652_11050150 3300025921 Bacteria 714
172 Ga0207646_10346744 3300025922 Bacteria 1342
173 Ga0207646_10528197 3300025922 Bacteria 1062
174 Ga0207646_11094956 3300025922 Bacteria 701
175 Ga0207694_10705017 3300025924 Bacteria 851
176 Ga0207700_10045424 3300025928 Bacteria 3241
177 Ga0207700_10079100 3300025928 Bacteria 2559
178 Ga0207664_10007295 3300025929 Bacteria 7666
179 Ga0207664_10035721 3300025929 Bacteria 3836
180 Ga0207664_10044965 3300025929 Bacteria 3460
181 Ga0207664_10190897 3300025929 Unclassified 1763
182 Ga0207664_10363048 3300025929 Bacteria 1283
183 Ga0207644_10406528 3300025931 Unclassified 1114
184 Ga0207644_10485660 3300025931 Bacteria 1018
185 Ga0207644_10810793 3300025931 Bacteria 783
186 Ga0207690_10053245 3300025932 Bacteria 2714
187 Ga0207690_10435728 3300025932 Unclassified 1051
188 Ga0207665_10001074 3300025939 Bacteria 18382
189 Ga0207665_10050605 3300025939 Bacteria 2794
190 Ga0207665_10716247 3300025939 Bacteria 787
191 Ga0207665_11285156 3300025939 Unclassified 583
192 Ga0207711_10108441 3300025941 Bacteria 2466
193 Ga0207661_10074555 3300025944 Bacteria 2781
194 Ga0207667_10458885 3300025949 Bacteria 1294
195 Ga0207712_10718254 3300025961 Bacteria 873
196 Ga0207677_11445945 3300026023 Bacteria 634
197 Ga0207702_10116059 3300026078 Bacteria 2388
198 Ga0207702_10633061 3300026078 Bacteria 1051
199 Ga0207698_10207099 3300026142 Bacteria 1761
200 Ga0265334_10019463 3300028573 Bacteria 2792
201 Ga0265322_10244659 3300028654 Bacteria 515
202 Ga0265336_10017499 3300028666 Bacteria 2333
203 Ga0265336_10065008 3300028666 Bacteria 1091
204 Ga0265338_10000924 3300028800 Bacteria 49511
205 Ga0265338_10003221 3300028800 Bacteria 23276
206 Ga0265338_10116893 3300028800 Bacteria 2135
207 Ga0265324_10021117 3300029957 Bacteria 2336
208 Ga0265324_10051196 3300029957 Bacteria 1419
209 Ga0265313_10113507 3300031595 Bacteria 1189
210 Ga0373926_0024316 3300035083 Bacteria 2109
211 Ga0373923_0185933 3300035111 Bacteria 956
212 Ga0373936_0093672 3300035113 Bacteria 1261
213 Ga0373945_0153433 3300035116 Unclassified 935
214 Ga0373956_0110362 3300035119 Bacteria 1280
215 Ga0373943_0004768 3300035170 Bacteria 6129
216 Ga0373943_0558916 3300035170 Bacteria 672
217 Ga0373943_0775987 3300035170 Bacteria 570
218 Ga0373946_0050098 3300035171 Bacteria 1743
219 Ga0373955_0501032 3300035172 Bacteria 742
220 Ga0373924_0427892 3300035410 Unclassified 593
221 Ga0373931_0088921 3300035691 Bacteria 1718
222 Ga0373931_0372046 3300035691 Unclassified 899
223 Ga0373935_0387249 3300035692 Bacteria 1002
224 Ga0373933_0069500 3300035724 Bacteria 2141
225 Ga0373947_0000371 3300035725 Bacteria 25349
226 Ga0373937_0000725 3300036401 Bacteria 28683
227 Ga0373937_0328754 3300036401 Bacteria 1447
228 Ga0373937_1768689 3300036401 Unclassified 565
229 Ga0373925_0001462 3300037068 Bacteria 20386
230 Ga0395899_0045692 3300037312 Bacteria 3263
231 Ga0395899_0982444 3300037312 Bacteria 510
232 Ga0395898_0109506 3300037466 Bacteria 2648
233 Ga0395905_0308059 3300037471 Bacteria 1472
234 Ga0436363_0758919 3300039450 Bacteria 544
235 Ga0451789_0943147 3300041443 Unclassified 829
236 Ga0466972_0049299 3300044658 Bacteria 2034
237 Ga0466972_0200849 3300044658 Bacteria 934
238 Ga0466965_0024499 3300044683 Bacteria 2920
239 Ga0466965_0244381 3300044683 Bacteria 961
240 Ga0466966_0122629 3300044684 Bacteria 1595
241 Ga0466966_0358564 3300044684 Bacteria 876
242 Ga0466961_0008333 3300044693 Bacteria 6599
243 Ga0466961_0014252 3300044693 Bacteria 5103
244 Ga0466961_0030814 3300044693 Bacteria 3446
245 Ga0466961_0048840 3300044693 Bacteria 2705
246 Ga0466963_0000102 3300044694 Bacteria 30465
247 Ga0466963_0003617 3300044694 Bacteria 8883
248 Ga0466963_0005276 3300044694 Bacteria 7547
249 Ga0466963_0012870 3300044694 Bacteria 5125
250 Ga0466963_0013692 3300044694 Bacteria 4987
251 Ga0466963_0019443 3300044694 Bacteria 4261
252 Ga0466963_0035681 3300044694 Bacteria 3240
253 Ga0466963_0038174 3300044694 Bacteria 3139
254 Ga0466963_0070780 3300044694 Bacteria 2346
255 Ga0466963_0103188 3300044694 Bacteria 1953
256 Ga0466963_0348803 3300044694 Bacteria 1042
257 Ga0466963_0390204 3300044694 Bacteria 981
258 Ga0466963_0526818 3300044694 Unclassified 834
259 Ga0466963_0913593 3300044694 Bacteria 618
260 Ga0466964_0003428 3300044706 Bacteria 5785
261 Ga0466964_0006069 3300044706 Bacteria 4504
262 Ga0466964_0007107 3300044706 Bacteria 4188
263 Ga0466964_0026692 3300044706 Bacteria 2262
264 Ga0466964_0034062 3300044706 Bacteria 2031
265 Ga0466964_0051181 3300044706 Bacteria 1696
266 Ga0466964_0068165 3300044706 Unclassified 1498
267 Ga0466971_0015053 3300044719 Bacteria 3402
268 Ga0466971_0021563 3300044719 Bacteria 2866
269 Ga0466971_0063321 3300044719 Bacteria 1674
270 Ga0466971_0081435 3300044719 Bacteria 1476
271 Ga0466971_0344630 3300044719 Bacteria 720
272 Ga0466968_0001167 3300044735 Bacteria 9315
273 Ga0466968_0010565 3300044735 Bacteria 3582
274 Ga0466968_0023275 3300044735 Bacteria 2522
275 Ga0466968_0037625 3300044735 Bacteria 2031
276 Ga0466968_0160200 3300044735 Bacteria 1038
277 Ga0466968_0327472 3300044735 Bacteria 741
278 Ga0466970_0038292 3300044765 Bacteria 2543
279 Ga0466957_0005373 3300044842 Bacteria 7191
280 Ga0466957_0005782 3300044842 Bacteria 6952
281 Ga0466957_0008474 3300044842 Bacteria 5849
282 Ga0466957_0010928 3300044842 Bacteria 5221
283 Ga0466957_0012050 3300044842 Bacteria 4998
284 Ga0466957_0325143 3300044842 Unclassified 1038
285 Ga0466957_0688260 3300044842 Bacteria 721
286 Ga0466957_1301988 3300044842 Bacteria 527
287 Ga0466960_0061333 3300044901 Bacteria 1846
288 Ga0466960_0063635 3300044901 Bacteria 1816
289 Ga0466959_0082093 3300045049 Unclassified 2322
290 Ga0466959_0166385 3300045049 Bacteria 1548
291 Ga0466958_0005167 3300045836 Bacteria 6983
292 Ga0466958_0005361 3300045836 Bacteria 6889
293 Ga0466958_0010780 3300045836 Bacteria 5128
294 Ga0466958_0023292 3300045836 Bacteria 3632
295 Ga0466958_0023638 3300045836 Bacteria 3610
296 Ga0466958_0098786 3300045836 Bacteria 1813
297 Ga0466958_0106069 3300045836 Bacteria 1751
298 Ga0466958_0198218 3300045836 Bacteria 1277
299 Ga0466958_0979555 3300045836 Unclassified 552
300 Ga0466967_0000094 3300045976 Bacteria 31562
301 Ga0466967_0039568 3300045976 Bacteria 4054
302 Ga0466967_0053118 3300045976 Bacteria 3560
303 Ga0466967_0066834 3300045976 Bacteria 3204
304 Ga0466967_0076521 3300045976 Bacteria 3010
305 Ga0466967_0217266 3300045976 Bacteria 1815
306 Ga0466967_0218412 3300045976 Bacteria 1810
307 Ga0466967_0275727 3300045976 Bacteria 1612
308 Ga0466967_0449437 3300045976 Bacteria 1259
309 Ga0466967_0531299 3300045976 Bacteria 1156
310 Ga0466967_0742378 3300045976 Bacteria 973
311 Ga0495592_0000050 3300046454 Bacteria 111971
312 Ga0495592_0002810 3300046454 Bacteria 12341
313 Ga0495592_0140719 3300046454 Unclassified 1679
314 Ga0495603_0295877 3300046455 Bacteria 930
315 Ga0495629_0110268 3300046459 Bacteria 1918
316 Ga0495629_0294950 3300046459 Bacteria 1111
317 Ga0495651_0000028 3300046462 Bacteria 105473
318 Ga0495651_0106647 3300046462 Bacteria 2076
319 Ga0495653_0001289 3300046463 Bacteria 19386
320 Ga0495653_0005665 3300046463 Bacteria 10200
321 Ga0495653_0039159 3300046463 Bacteria 3715
322 Ga0495653_0564850 3300046463 Bacteria 703
323 Ga0495653_0838902 3300046463 Unclassified 550
324 Ga0495653_0955102 3300046463 Unclassified 508
325 Ga0495580_0004702 3300046472 Bacteria 11446
326 Ga0495582_0003512 3300046473 Bacteria 8836
327 Ga0495605_0370916 3300046474 Bacteria 598
328 Ga0495639_0000481 3300046475 Bacteria 19003
329 Ga0495664_0006065 3300046477 Bacteria 6664
330 Ga0495664_0164078 3300046477 Bacteria 1348
331 Ga0495664_0225910 3300046477 Bacteria 1133
332 Ga0495664_0248175 3300046477 Bacteria 1076
333 Ga0495664_0262876 3300046477 Bacteria 1043
334 Ga0495664_0547795 3300046477 Unclassified 689
335 Ga0495664_0566758 3300046477 Unclassified 676
336 Ga0495584_0019684 3300046491 Bacteria 3429
337 Ga0495594_0796415 3300046499 Bacteria 533
338 Ga0495607_0053355 3300046501 Bacteria 2337
339 Ga0495608_0002062 3300046511 Bacteria 14459
340 Ga0495608_0048015 3300046511 Bacteria 2837
341 Ga0495608_0081771 3300046511 Bacteria 2098
342 Ga0495608_0167776 3300046511 Unclassified 1393
343 Ga0495618_0001024 3300046514 Bacteria 19164
344 Ga0495618_0051562 3300046514 Bacteria 2599
345 Ga0495618_0113005 3300046514 Unclassified 1739
346 Ga0495618_0130561 3300046514 Bacteria 1607
347 Ga0495618_0279690 3300046514 Bacteria 1041
348 Ga0495628_0000060 3300046516 Bacteria 87173
349 Ga0495628_0008128 3300046516 Bacteria 9029
350 Ga0495628_0321985 3300046516 Unclassified 1141
351 Ga0495628_0354432 3300046516 Bacteria 1078
352 Ga0495628_0447383 3300046516 Unclassified 939
353 Ga0495630_0000995 3300046517 Bacteria 19714
354 Ga0495630_0101997 3300046517 Bacteria 2170
355 Ga0495630_0104039 3300046517 Bacteria 2148
356 Ga0495630_0221223 3300046517 Unclassified 1445
357 Ga0495666_0000688 3300046526 Bacteria 15346
358 Ga0495642_0519802 3300046528 Unclassified 527
359 Ga0495652_0000969 3300046529 Bacteria 32863
360 Ga0495652_0008136 3300046529 Bacteria 9590
361 Ga0495652_0010648 3300046529 Bacteria 8330
362 Ga0495652_0096000 3300046529 Bacteria 2415
363 Ga0495652_0141504 3300046529 Bacteria 1891
364 Ga0495665_0004703 3300046531 Bacteria 7364
365 Ga0495640_0203567 3300046533 Unclassified 1254
366 Ga0495640_0229531 3300046533 Bacteria 1168
367 Ga0495586_0033309 3300046535 Bacteria 2765
368 Ga0495587_0000062 3300046536 Bacteria 91862
369 Ga0495587_0086090 3300046536 Bacteria 1819
370 Ga0495587_0139273 3300046536 Unclassified 1385
371 Ga0495587_0394646 3300046536 Unclassified 769
372 Ga0495645_0000207 3300046543 Bacteria 42086
373 Ga0495645_0004423 3300046543 Bacteria 9598
374 Ga0495645_0055416 3300046543 Bacteria 2879
375 Ga0495667_0009415 3300046559 Bacteria 6617
376 Ga0495667_0071626 3300046559 Bacteria 2260
377 Ga0495667_0694724 3300046559 Unclassified 631
378 Ga0495656_0017577 3300046615 Bacteria 2731
379 Ga0495634_0024255 3300046642 Bacteria 4259
380 Ga0495634_0038991 3300046642 Bacteria 3237
381 Ga0495634_0068329 3300046642 Bacteria 2348
382 Ga0495634_0134930 3300046642 Bacteria 1571
383 Ga0495634_0221227 3300046642 Bacteria 1168
384 Ga0495611_0025819 3300046648 Bacteria 2562
385 Ga0495635_0009343 3300046663 Bacteria 6852
386 Ga0495635_0074020 3300046663 Bacteria 2333
387 Ga0495635_0191008 3300046663 Unclassified 1390
388 Ga0495635_0417440 3300046663 Unclassified 890
389 Ga0495635_0678416 3300046663 Unclassified 669
390 Ga0495588_0607589 3300046674 Unclassified 573
391 Ga0495657_0014967 3300046675 Bacteria 5690
392 Ga0495657_0477377 3300046675 Bacteria 728
393 Ga0495657_0525376 3300046675 Bacteria 689
394 Ga0495599_0000202 3300046678 Bacteria 39562
395 Ga0495599_0052755 3300046678 Bacteria 2547
396 Ga0495599_0068408 3300046678 Bacteria 2217
397 Ga0495599_0235787 3300046678 Bacteria 1116
398 Ga0495623_0000230 3300046679 Bacteria 35964
399 Ga0495623_0276655 3300046679 Bacteria 935
400 Ga0495646_0017844 3300046680 Bacteria 4497
401 Ga0495646_0019601 3300046680 Bacteria 4279
402 Ga0495647_0000670 3300046681 Bacteria 10187
403 Ga0495658_0782852 3300046683 Bacteria 611
404 Ga0495613_0005595 3300046689 Bacteria 9434
405 Ga0495613_0028992 3300046689 Bacteria 4115
406 Ga0495613_0516690 3300046689 Bacteria 802
407 Ga0495624_0126911 3300046690 Bacteria 1565
408 Ga0495670_0054914 3300046691 Bacteria 1997
409 Ga0495589_0073821 3300046794 Bacteria 1664
410 Ga0495600_0008576 3300046809 Bacteria 6286
411 Ga0495600_0042913 3300046809 Bacteria 2949
412 Ga0495600_0172045 3300046809 Bacteria 1398
413 Ga0495600_0247676 3300046809 Unclassified 1134
414 Ga0495581_0017948 3300047315 Bacteria 4111
415 Ga0495581_0236512 3300047315 Bacteria 1068
416 Ga0495581_0277642 3300047315 Bacteria 979
417 Ga0495604_0000262 3300047317 Bacteria 46873
418 Ga0495604_0045005 3300047317 Bacteria 3446
419 Ga0495674_0147744 3300047319 Bacteria 1972
420 Ga0495674_0476548 3300047319 Bacteria 1000
421 Ga0495674_0507958 3300047319 Unclassified 963
422 Ga0495674_0937249 3300047319 Bacteria 667
423 Ga0495676_0019630 3300047321 Bacteria 5942
424 Ga0495676_0032491 3300047321 Bacteria 4404
425 Ga0495676_0400808 3300047321 Unclassified 910
426 Ga0495676_0701014 3300047321 Bacteria 655
427 Ga0495680_0020304 3300047322 Bacteria 5592
428 Ga0495680_0034009 3300047322 Bacteria 4123
429 Ga0495680_0285333 3300047322 Unclassified 1162
430 Ga0495680_0608752 3300047322 Bacteria 730
431 Ga0495675_0000020 3300047444 Bacteria 111526
432 Ga0495675_0045314 3300047444 Bacteria 2801
433 Ga0495684_0012195 3300047471 Bacteria 6630
434 Ga0495684_0016556 3300047471 Bacteria 5679
435 Ga0495684_0039015 3300047471 Bacteria 3640
436 Ga0495684_0133613 3300047471 Bacteria 1862
437 Ga0495593_0001863 3300047673 Bacteria 12556
438 Ga0495593_0014233 3300047673 Bacteria 4523
439 Ga0495593_0603945 3300047673 Bacteria 551
440 Ga0495602_0000222 3300048088 Bacteria 53050
441 Ga0495602_0039532 3300048088 Bacteria 4342
442 Ga0495602_0217204 3300048088 Unclassified 1446
443 Ga0495602_0902414 3300048088 Unclassified 588
444 Ga0495614_0001717 3300048089 Bacteria 9568
445 Ga0496100_0041479 3300048903 Bacteria 2933
446 Ga0496100_0206156 3300048903 Bacteria 1436
447 Ga0496100_0208200 3300048903 Bacteria 1429
448 Ga0496101_0011809 3300048904 Bacteria 5809
449 Ga0496101_0515753 3300048904 Bacteria 945
450 Ga0496102_0021075 3300048905 Bacteria 5764
451 Ga0496102_0082856 3300048905 Bacteria 2958
452 Ga0496102_1141931 3300048905 Bacteria 699
453 Ga0496102_1283529 3300048905 Bacteria 651
454 Ga0496103_0014385 3300048906 Bacteria 4700
455 Ga0496103_0018723 3300048906 Bacteria 4155
456 Ga0496104_0014672 3300048907 Bacteria 7078
457 Ga0496104_0015903 3300048907 Bacteria 6828
458 Ga0496105_0019886 3300048908 Bacteria 5418
459 Ga0496105_0029719 3300048908 Bacteria 4473
460 Ga0496105_0453627 3300048908 Bacteria 1012
461 Ga0496106_0259759 3300048909 Bacteria 1390
462 Ga0496106_0427281 3300048909 Bacteria 1065
463 Ga0496106_0598504 3300048909 Bacteria 883
464 Ga0496107_0009770 3300048910 Bacteria 6654
465 Ga0496107_0076515 3300048910 Bacteria 2437
466 Ga0496107_0323184 3300048910 Unclassified 1148
467 Ga0496108_0009079 3300048911 Bacteria 8054
468 Ga0496108_0034402 3300048911 Bacteria 4210
469 Ga0496108_0071809 3300048911 Bacteria 2921
470 Ga0496108_0521562 3300048911 Bacteria 1037
471 Ga0496109_0003892 3300048912 Bacteria 12470
472 Ga0496109_0010667 3300048912 Bacteria 7860
473 Ga0496109_0603730 3300048912 Bacteria 1033
474 Ga0496110_0134934 3300048913 Bacteria 2230
475 Ga0496110_0141353 3300048913 Bacteria 2176
476 Ga0496110_0525975 3300048913 Bacteria 1076
477 Ga0496111_0036366 3300048914 Bacteria 3520
478 Ga0496111_0046870 3300048914 Bacteria 3113
479 Ga0496111_0096509 3300048914 Bacteria 2170
480 Ga0496111_0279040 3300048914 Bacteria 1239
481 Ga0496111_0999759 3300048914 Bacteria 599
482 Ga0496112_0098299 3300048915 Bacteria 2896
483 Ga0496112_0106028 3300048915 Bacteria 2780
484 Ga0496112_0655954 3300048915 Bacteria 979
485 Ga0496112_0914666 3300048915 Bacteria 799
486 Ga0496113_0029330 3300048916 Bacteria 3971
487 Ga0496113_0131356 3300048916 Bacteria 1965
488 Ga0496113_0133676 3300048916 Bacteria 1948
489 Ga0496114_0017907 3300048917 Bacteria 5725
490 Ga0496114_0052601 3300048917 Bacteria 3393
491 Ga0496114_0066011 3300048917 Bacteria 3033
492 Ga0496114_1682285 3300048917 Bacteria 523
493 Ga0496115_0048713 3300048918 Bacteria 3389
494 Ga0496115_0061199 3300048918 Bacteria 3035
495 Ga0496115_0079276 3300048918 Bacteria 2673
496 Ga0496115_0118095 3300048918 Bacteria 2181
497 Ga0496115_0209041 3300048918 Bacteria 1612
498 Ga0501067_0337534 3300049583 Bacteria 840
499 nmdc:mga0n895_25551_c1 3300050512 Bacteria 5582
500 nmdc:mga0rr50_1139521_c1 3300050513 Unclassified 663
501 nmdc:mga0a205_551650_c1 3300050515 Unclassified 1007
502 nmdc:mga0a205_95152_c1 3300050515 Bacteria 2877
503 Ga0495601_0000218 3300053077 Bacteria 30705
504 Ga0495601_0005907 3300053077 Bacteria 7136
505 Ga0495601_0053519 3300053077 Bacteria 2551
506 Ga0495601_0158768 3300053077 Unclassified 1477
507 Ga0495601_0202888 3300053077 Bacteria 1295
508 Ga0495601_0203688 3300053077 Bacteria 1293
509 Ga0495601_0467905 3300053077 Unclassified 815
510 Ga0495601_0975539 3300053077 Unclassified 533
511 Ga0495612_0003098 3300053078 Bacteria 6890
512 Ga0495612_0016785 3300053078 Bacteria 2932
513 Ga0495612_0308191 3300053078 Bacteria 711
514 Ga0495655_0004634 3300053083 Bacteria 2368
515 Ga0495595_0063170 3300053084 Bacteria 1738
516 Ga0495595_0124640 3300053084 Bacteria 1256
517 Ga0495595_0204444 3300053084 Bacteria 983
518 Ga0495595_0256357 3300053084 Unclassified 876
519 Ga0495595_0287766 3300053084 Bacteria 826
520 Ga0495619_0001137 3300053085 Bacteria 17476
521 Ga0495619_0032960 3300053085 Bacteria 3363
522 Ga0495619_0333784 3300053085 Bacteria 1049
523 Ga0495619_0524733 3300053085 Unclassified 813
524 Ga0500566_0237195 3300053094 Unclassified 896
525 Ga0466962_0000096 3300061719 Bacteria 35253
526 Ga0466962_0020166 3300061719 Bacteria 3204
527 Ga0466962_0060040 3300061719 Bacteria 1815
528 Ga0466962_0074919 3300061719 Bacteria 1617
529 Ga0466962_0131907 3300061719 Bacteria 1208
530 Ga0466966_0059424
531 rootH1_10165460
532 Ga0070658_10073144
533 Ga0070683_100129799
534 Ga0070683_100366323
535 Ga0070683_100616390
536 Ga0070683_101574501
537 Ga0070690_101729702
538 Ga0070680_100037484
539 Ga0070680_100108482
540 Ga0070682_100225513
541 Ga0070682_100362089
542 Ga0070682_100522096
543 Ga0070682_100812638
544 Ga0068868_100317308
545 Ga0068868_101657357
546 Ga0070660_100051424
547 Ga0070660_100560862
548 Ga0070660_101905139
549 Ga0070689_100695891
550 Ga0070691_10090143
551 Ga0070661_100123530
552 Ga0070671_100614051
553 Ga0070659_100032341
554 Ga0070659_101047228
555 Ga0070659_101626901
556 Ga0070709_10005227
557 Ga0070709_10045926
558 Ga0070714_100008658
559 Ga0070714_100024330
560 Ga0070714_100033947
561 Ga0070714_100037311
562 Ga0070714_100070280
563 Ga0070714_100401584
564 Ga0070714_102018027
565 Ga0070713_100041466
566 Ga0070713_100130919
567 Ga0070713_100595324
568 Ga0070713_102492242
569 Ga0070710_10003439
570 Ga0070710_10009232
571 Ga0070710_10362156
572 Ga0070711_100027039
573 Ga0070711_100047147
574 Ga0070711_100462746
575 Ga0070711_100592735
576 Ga0070711_102023504
577 Ga0070705_100234719
578 Ga0070694_100089405
579 Ga0070694_100721798
580 Ga0070662_100583750
581 Ga0070681_10051474
582 Ga0070681_10079821
583 Ga0070681_10342328
584 Ga0070706_100336286
585 Ga0070707_100001986
586 Ga0070707_101137191
587 Ga0070707_101381501
588 Ga0070698_100219347
589 Ga0070679_100072110
590 Ga0070679_100078303
591 Ga0070684_100064797
592 Ga0070684_100201828
593 Ga0070684_101925879
594 Ga0070697_100773346
595 Ga0070697_100804516
596 Ga0068853_100895866
597 Ga0070695_100000814
598 Ga0070695_101083295
599 Ga0070693_100784384
600 Ga0070704_100064573
601 Ga0068855_100248344
602 Ga0068855_100294375
603 Ga0070664_100174483
604 Ga0068856_100145685
605 Ga0068856_100632822
606 Ga0068856_100843316
607 Ga0070702_100352085
608 Ga0068852_100097658
609 Ga0068863_100412618
610 Ga0068860_101537212
611 Ga0070717_10007800
612 Ga0070717_10056185
613 Ga0070717_10088713
614 Ga0070715_10021489
615 Ga0070715_10069226
616 Ga0070716_100019365
617 Ga0070716_100373935
618 Ga0070716_100389974
619 Ga0070716_101579568
620 Ga0070712_100016542
621 Ga0070712_100210879
622 Ga0070712_100470114
623 Ga0070712_100576985
624 Ga0070712_101122520
625 Ga0075433_10491832
626 Ga0075433_10624501
627 Ga0075434_100157187
628 Ga0075434_101608288
629 Ga0075435_101322390
630 Ga0105240_10407593
631 Ga0105240_10490071
632 Ga0105240_12268068
633 Ga0105245_10079742
634 Ga0105241_10727162
635 Ga0105248_10088356
636 Ga0105237_10011717
637 Ga0105237_10466644
638 Ga0105237_10821067
639 Ga0105238_10450213
640 Ga0105238_10685846
641 Ga0105249_10988960
642 Ga0105239_10452822
643 Ga0105239_11977906
644 Ga0157373_10948097
645 Ga0157371_10563760
646 Ga0157370_11082174
647 Ga0157369_10654885
648 Ga0157369_10954431
649 Ga0157374_10053595
650 Ga0157374_10091287
651 Ga0157378_11332222
652 Ga0157372_10162489
653 Ga0157372_10314130
654 Ga0157372_10990119
655 Ga0157372_11557328
656 Ga0182008_10068894
657 Ga0182008_10372733
658 Ga0182008_10956873
659 Ga0157377_10998008
660 Ga0157376_10432611
661 Ga0157376_12521369
662 Ga0197907_10394550
663 Ga0197907_10497667
664 Ga0206356_10802283
665 Ga0206356_10989153
666 Ga0206349_1852444
667 Ga0206350_11436359
668 Ga0206354_11244338
669 Ga0206353_11954450
670 Ga0224712_10025428
671 Ga0224712_10197100
672 Ga0224712_10298936
673 Ga0224712_10408332
674 Ga0207692_10005324
675 Ga0207692_10028126
676 Ga0207692_10068332
677 Ga0207685_10067479
678 Ga0207699_10017684
679 Ga0207699_10056405
680 Ga0207699_10995300
681 Ga0207699_11447100
682 Ga0207705_10079078
683 Ga0207684_10398312
684 Ga0207707_10158917
685 Ga0207707_10389603
686 Ga0207695_10252136
687 Ga0207671_10027756
688 Ga0207671_10521592
689 Ga0207693_10000282
690 Ga0207693_10231790
691 Ga0207663_10007649
692 Ga0207663_10717703
693 Ga0207663_11293401
694 Ga0207660_10319830
695 Ga0207660_10724895
696 Ga0207657_10000988
697 Ga0207657_11178567
698 Ga0207649_11187328
699 Ga0207652_10425497
700 Ga0207652_11050150
701 Ga0207646_10346744
702 Ga0207646_10528197
703 Ga0207646_11094956
704 Ga0207694_10705017
705 Ga0207700_10045424
706 Ga0207700_10079100
707 Ga0207664_10007295
708 Ga0207664_10035721
709 Ga0207664_10044965
710 Ga0207664_10190897
711 Ga0207664_10363048
712 Ga0207644_10406528
713 Ga0207644_10485660
714 Ga0207644_10810793
715 Ga0207690_10053245
716 Ga0207690_10435728
717 Ga0207665_10001074
718 Ga0207665_10050605
719 Ga0207665_10716247
720 Ga0207665_11285156
721 Ga0207711_10108441
722 Ga0207661_10074555
723 Ga0207667_10458885
724 Ga0207712_10718254
725 Ga0207677_11445945
726 Ga0207702_10116059
727 Ga0207702_10633061
728 Ga0207698_10207099
729 Ga0265334_10019463
730 Ga0265322_10244659
731 Ga0265336_10017499
732 Ga0265336_10065008
733 Ga0265338_10000924
734 Ga0265338_10003221
735 Ga0265338_10116893
736 Ga0265324_10021117
737 Ga0265324_10051196
738 Ga0265313_10113507
739 Ga0373926_0024316
740 Ga0373923_0185933
741 Ga0373936_0093672
742 Ga0373945_0153433
743 Ga0373956_0110362
744 Ga0373943_0004768
745 Ga0373943_0558916
746 Ga0373943_0775987
747 Ga0373946_0050098
748 Ga0373955_0501032
749 Ga0373924_0427892
750 Ga0373931_0088921
751 Ga0373931_0372046
752 Ga0373935_0387249
753 Ga0373933_0069500
754 Ga0373947_0000371
755 Ga0373937_0000725
756 Ga0373937_0328754
757 Ga0373937_1768689
758 Ga0373925_0001462
759 Ga0395899_0045692
760 Ga0395899_0982444
761 Ga0395898_0109506
762 Ga0395905_0308059
763 Ga0436363_0758919
764 Ga0451789_0943147
765 Ga0466972_0049299
766 Ga0466972_0200849
767 Ga0466965_0024499
768 Ga0466965_0244381
769 Ga0466966_0122629
770 Ga0466966_0358564
771 Ga0466961_0008333
772 Ga0466961_0014252
773 Ga0466961_0030814
774 Ga0466961_0048840
775 Ga0466963_0000102
776 Ga0466963_0003617
777 Ga0466963_0005276
778 Ga0466963_0012870
779 Ga0466963_0013692
780 Ga0466963_0019443
781 Ga0466963_0035681
782 Ga0466963_0038174
783 Ga0466963_0070780
784 Ga0466963_0103188
785 Ga0466963_0348803
786 Ga0466963_0390204
787 Ga0466963_0526818
788 Ga0466963_0913593
789 Ga0466964_0003428
790 Ga0466964_0006069
791 Ga0466964_0007107
792 Ga0466964_0026692
793 Ga0466964_0034062
794 Ga0466964_0051181
795 Ga0466964_0068165
796 Ga0466971_0015053
797 Ga0466971_0021563
798 Ga0466971_0063321
799 Ga0466971_0081435
800 Ga0466971_0344630
801 Ga0466968_0001167
802 Ga0466968_0010565
803 Ga0466968_0023275
804 Ga0466968_0037625
805 Ga0466968_0160200
806 Ga0466968_0327472
807 Ga0466970_0038292
808 Ga0466957_0005373
809 Ga0466957_0005782
810 Ga0466957_0008474
811 Ga0466957_0010928
812 Ga0466957_0012050
813 Ga0466957_0325143
814 Ga0466957_0688260
815 Ga0466957_1301988
816 Ga0466960_0061333
817 Ga0466960_0063635
818 Ga0466959_0082093
819 Ga0466959_0166385
820 Ga0466958_0005167
821 Ga0466958_0005361
822 Ga0466958_0010780
823 Ga0466958_0023292
824 Ga0466958_0023638
825 Ga0466958_0098786
826 Ga0466958_0106069
827 Ga0466958_0198218
828 Ga0466958_0979555
829 Ga0466967_0000094
830 Ga0466967_0039568
831 Ga0466967_0053118
832 Ga0466967_0066834
833 Ga0466967_0076521
834 Ga0466967_0217266
835 Ga0466967_0218412
836 Ga0466967_0275727
837 Ga0466967_0449437
838 Ga0466967_0531299
839 Ga0466967_0742378
840 Ga0495592_0000050
841 Ga0495592_0002810
842 Ga0495592_0140719
843 Ga0495603_0295877
844 Ga0495629_0110268
845 Ga0495629_0294950
846 Ga0495651_0000028
847 Ga0495651_0106647
848 Ga0495653_0001289
849 Ga0495653_0005665
850 Ga0495653_0039159
851 Ga0495653_0564850
852 Ga0495653_0838902
853 Ga0495653_0955102
854 Ga0495580_0004702
855 Ga0495582_0003512
856 Ga0495605_0370916
857 Ga0495639_0000481
858 Ga0495664_0006065
859 Ga0495664_0164078
860 Ga0495664_0225910
861 Ga0495664_0248175
862 Ga0495664_0262876
863 Ga0495664_0547795
864 Ga0495664_0566758
865 Ga0495584_0019684
866 Ga0495594_0796415
867 Ga0495607_0053355
868 Ga0495608_0002062
869 Ga0495608_0048015
870 Ga0495608_0081771
871 Ga0495608_0167776
872 Ga0495618_0001024
873 Ga0495618_0051562
874 Ga0495618_0113005
875 Ga0495618_0130561
876 Ga0495618_0279690
877 Ga0495628_0000060
878 Ga0495628_0008128
879 Ga0495628_0321985
880 Ga0495628_0354432
881 Ga0495628_0447383
882 Ga0495630_0000995
883 Ga0495630_0101997
884 Ga0495630_0104039
885 Ga0495630_0221223
886 Ga0495666_0000688
887 Ga0495642_0519802
888 Ga0495652_0000969
889 Ga0495652_0008136
890 Ga0495652_0010648
891 Ga0495652_0096000
892 Ga0495652_0141504
893 Ga0495665_0004703
894 Ga0495640_0203567
895 Ga0495640_0229531
896 Ga0495586_0033309
897 Ga0495587_0000062
898 Ga0495587_0086090
899 Ga0495587_0139273
900 Ga0495587_0394646
901 Ga0495645_0000207
902 Ga0495645_0004423
903 Ga0495645_0055416
904 Ga0495667_0009415
905 Ga0495667_0071626
906 Ga0495667_0694724
907 Ga0495656_0017577
908 Ga0495634_0024255
909 Ga0495634_0038991
910 Ga0495634_0068329
911 Ga0495634_0134930
912 Ga0495634_0221227
913 Ga0495611_0025819
914 Ga0495635_0009343
915 Ga0495635_0074020
916 Ga0495635_0191008
917 Ga0495635_0417440
918 Ga0495635_0678416
919 Ga0495588_0607589
920 Ga0495657_0014967
921 Ga0495657_0477377
922 Ga0495657_0525376
923 Ga0495599_0000202
924 Ga0495599_0052755
925 Ga0495599_0068408
926 Ga0495599_0235787
927 Ga0495623_0000230
928 Ga0495623_0276655
929 Ga0495646_0017844
930 Ga0495646_0019601
931 Ga0495647_0000670
932 Ga0495658_0782852
933 Ga0495613_0005595
934 Ga0495613_0028992
935 Ga0495613_0516690
936 Ga0495624_0126911
937 Ga0495670_0054914
938 Ga0495589_0073821
939 Ga0495600_0008576
940 Ga0495600_0042913
941 Ga0495600_0172045
942 Ga0495600_0247676
943 Ga0495581_0017948
944 Ga0495581_0236512
945 Ga0495581_0277642
946 Ga0495604_0000262
947 Ga0495604_0045005
948 Ga0495674_0147744
949 Ga0495674_0476548
950 Ga0495674_0507958
951 Ga0495674_0937249
952 Ga0495676_0019630
953 Ga0495676_0032491
954 Ga0495676_0400808
955 Ga0495676_0701014
956 Ga0495680_0020304
957 Ga0495680_0034009
958 Ga0495680_0285333
959 Ga0495680_0608752
960 Ga0495675_0000020
961 Ga0495675_0045314
962 Ga0495684_0012195
963 Ga0495684_0016556
964 Ga0495684_0039015
965 Ga0495684_0133613
966 Ga0495593_0001863
967 Ga0495593_0014233
968 Ga0495593_0603945
969 Ga0495602_0000222
970 Ga0495602_0039532
971 Ga0495602_0217204
972 Ga0495602_0902414
973 Ga0495614_0001717
974 Ga0496100_0041479
975 Ga0496100_0206156
976 Ga0496100_0208200
977 Ga0496101_0011809
978 Ga0496101_0515753
979 Ga0496102_0021075
980 Ga0496102_0082856
981 Ga0496102_1141931
982 Ga0496102_1283529
983 Ga0496103_0014385
984 Ga0496103_0018723
985 Ga0496104_0014672
986 Ga0496104_0015903
987 Ga0496105_0019886
988 Ga0496105_0029719
989 Ga0496105_0453627
990 Ga0496106_0259759
991 Ga0496106_0427281
992 Ga0496106_0598504
993 Ga0496107_0009770
994 Ga0496107_0076515
995 Ga0496107_0323184
996 Ga0496108_0009079
997 Ga0496108_0034402
998 Ga0496108_0071809
999 Ga0496108_0521562
1000 Ga0496109_0003892
1001 Ga0496109_0010667
1002 Ga0496109_0603730
1003 Ga0496110_0134934
1004 Ga0496110_0141353
1005 Ga0496110_0525975
1006 Ga0496111_0036366
1007 Ga0496111_0046870
1008 Ga0496111_0096509
1009 Ga0496111_0279040
1010 Ga0496111_0999759
1011 Ga0496112_0098299
1012 Ga0496112_0106028
1013 Ga0496112_0655954
1014 Ga0496112_0914666
1015 Ga0496113_0029330
1016 Ga0496113_0131356
1017 Ga0496113_0133676
1018 Ga0496114_0017907
1019 Ga0496114_0052601
1020 Ga0496114_0066011
1021 Ga0496114_1682285
1022 Ga0496115_0048713
1023 Ga0496115_0061199
1024 Ga0496115_0079276
1025 Ga0496115_0118095
1026 Ga0496115_0209041
1027 Ga0501067_0337534
1028 nmdc:mga0n895_25551_c1
1029 nmdc:mga0rr50_1139521_c1
1030 nmdc:mga0a205_551650_c1
1031 nmdc:mga0a205_95152_c1
1032 Ga0495601_0000218
1033 Ga0495601_0005907
1034 Ga0495601_0053519
1035 Ga0495601_0158768
1036 Ga0495601_0202888
1037 Ga0495601_0203688
1038 Ga0495601_0467905
1039 Ga0495601_0975539
1040 Ga0495612_0003098
1041 Ga0495612_0016785
1042 Ga0495612_0308191
1043 Ga0495655_0004634
1044 Ga0495595_0063170
1045 Ga0495595_0124640
1046 Ga0495595_0204444
1047 Ga0495595_0256357
1048 Ga0495595_0287766
1049 Ga0495619_0001137
1050 Ga0495619_0032960
1051 Ga0495619_0333784
1052 Ga0495619_0524733
1053 Ga0500566_0237195
1054 Ga0466962_0000096
1055 Ga0466962_0020166
1056 Ga0466962_0060040
1057 Ga0466962_0074919
1058 Ga0466962_0131907

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vr2-assembly1.cif.gz_B aminoglycoside n-2'-acetyltransferase-ia [aac(2')-ia] in complex with acetylated-tobramycin and coa 0.7683 41 114
4zbg-assembly1.cif.gz_A crystal structure of a gnat family acetyltransferase from brucella melitensis in complex with acetyl-coa 0.7233 41 115
1s60-assembly1.cif.gz_A-2 aminoglycoside n-acetyltransferase aac(6')-iy in complex with coa and n-terminal his(6)-tag (crystal form 2) 0.6949 37 115
5vrv-assembly1.cif.gz_A 2.05 angstrom resolution crystal structure of c-terminal domain (duf2156) of putative lysylphosphatidylglycerol synthetase from agrobacterium fabrum. 0.6893 39 110
2vi7-assembly2.cif.gz_C structure of a putative acetyltransferase (pa1377)from pseudomonas aeruginosa 0.6832 40 107
ID Description Score Start End Superfamily
af_P9WKI9_1_164_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.8502 68 81 3.30.540.10
af_Q869K3_5_181_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.8366 68 81 3.30.540.10
af_P39368_4_174_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7481 41 115 3.40.630.30
af_Q9LTQ0_232_292_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7256 40 82 3.30.160.20
af_Q9VMG0_1_216_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7249 41 115 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A538CYL1-F1-model_v4 GNAT family N-acetyltransferase 0.9631 36 113
AF-A0A7V9MF45-F1-model_v4 GNAT family N-acetyltransferase 0.9562 38 115
AF-A0A2W5Y2L7-F1-model_v4 Uncharacterized protein 0.955 45 111
AF-A0A7W1NHN9-F1-model_v4 deleted 0.949 35 113
AF-A0A660KY30-F1-model_v4 Uncharacterized protein 0.9435 41 115

Map