F459736
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 528 | 221 | 528 | 160 |
Family's Representative Sequence
| Representative Sequence | 3300049823|Ga0501044_0002694|Ga0501044_0002694_12219_12788 |
| Length | 189 |
| Sequence | LRPEFVAPSLMYALYTSLGRSCSGRKISRAAKSEPMTSDLPYRPCVGIMLFNKDGEVFVGKRIDQTVEGWQMPQGGIDEGETPRQAALRELREEVGTSKAEIIGEMDDWVTYDLPPHLIGVAFHGKYKGQRQKWFALRFLGQDADIDLTAHEPEFSAYRWLALEALPHVIVPFKRRTYAAVIAAFRGLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 38 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 43 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 44 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 45 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 123 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 124 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 125 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 126 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 127 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 128 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 129 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 130 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 131 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 132 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 133 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 134 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 135 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 136 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 137 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 139 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 140 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 141 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 142 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 143 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 145 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 146 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 147 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 148 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 149 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 150 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 151 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 152 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 153 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 154 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 155 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 156 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 169 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 170 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 171 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 172 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 173 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 174 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 175 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 208 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 209 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 210 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 211 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 212 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 213 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 214 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 215 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 216 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 217 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 218 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 219 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 220 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.17 |
| Nodule | 0 |
| Rhizoplane | 1.7 |
| Rhizosphere | 92.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000035 | 3300003214 | Bacteria | 290723 |
| 2 | JGI25153J46596_10001230 | 3300003215 | Bacteria | 15443 |
| 3 | Ga0070658_10476598 | 3300005327 | Bacteria | 1077 |
| 4 | Ga0070658_10631670 | 3300005327 | Bacteria | 929 |
| 5 | Ga0070670_100245078 | 3300005331 | Bacteria | 1560 |
| 6 | Ga0070677_10086048 | 3300005333 | Bacteria | 1357 |
| 7 | Ga0068869_100539882 | 3300005334 | Bacteria | 978 |
| 8 | Ga0068869_100904246 | 3300005334 | Bacteria | 764 |
| 9 | Ga0070680_100461394 | 3300005336 | Bacteria | 1085 |
| 10 | Ga0070682_100642173 | 3300005337 | Bacteria | 844 |
| 11 | Ga0068868_100610041 | 3300005338 | Bacteria | 968 |
| 12 | Ga0070660_100110972 | 3300005339 | Bacteria | 2182 |
| 13 | Ga0070661_100010114 | 3300005344 | Bacteria | 6552 |
| 14 | Ga0070661_100496246 | 3300005344 | Bacteria | 977 |
| 15 | Ga0070661_100802057 | 3300005344 | Bacteria | 773 |
| 16 | Ga0070674_100688561 | 3300005356 | Bacteria | 873 |
| 17 | Ga0070674_100719895 | 3300005356 | Bacteria | 855 |
| 18 | Ga0070667_100128627 | 3300005367 | Bacteria | 2209 |
| 19 | Ga0070709_10003569 | 3300005434 | Bacteria | 8355 |
| 20 | Ga0070709_10077723 | 3300005434 | Bacteria | 2158 |
| 21 | Ga0070714_100042367 | 3300005435 | Bacteria | 3845 |
| 22 | Ga0070714_100259178 | 3300005435 | Bacteria | 1610 |
| 23 | Ga0070714_100751218 | 3300005435 | Bacteria | 943 |
| 24 | Ga0070713_100000011 | 3300005436 | Bacteria | 146314 |
| 25 | Ga0070713_100325451 | 3300005436 | Bacteria | 1420 |
| 26 | Ga0070711_100047094 | 3300005439 | Bacteria | 2942 |
| 27 | Ga0070711_100330474 | 3300005439 | Bacteria | 1220 |
| 28 | Ga0070663_100152829 | 3300005455 | Bacteria | 1771 |
| 29 | Ga0070663_100634136 | 3300005455 | Bacteria | 902 |
| 30 | Ga0070678_100009857 | 3300005456 | Bacteria | 5807 |
| 31 | Ga0070678_101276540 | 3300005456 | Bacteria | 683 |
| 32 | Ga0070681_10000002 | 3300005458 | Bacteria | 821814 |
| 33 | Ga0070681_10083094 | 3300005458 | Bacteria | 3157 |
| 34 | Ga0070681_10227245 | 3300005458 | Bacteria | 1781 |
| 35 | Ga0068867_100362411 | 3300005459 | Bacteria | 1213 |
| 36 | Ga0068867_101343761 | 3300005459 | Bacteria | 661 |
| 37 | Ga0070699_100823059 | 3300005518 | Bacteria | 850 |
| 38 | Ga0070679_100000035 | 3300005530 | Bacteria | 103095 |
| 39 | Ga0070679_100084210 | 3300005530 | Bacteria | 3168 |
| 40 | Ga0070679_100185968 | 3300005530 | Bacteria | 2048 |
| 41 | Ga0070679_100486465 | 3300005530 | Bacteria | 1178 |
| 42 | Ga0070684_100106639 | 3300005535 | Bacteria | 2509 |
| 43 | Ga0068853_100002661 | 3300005539 | Bacteria | 13465 |
| 44 | Ga0068853_100051940 | 3300005539 | Bacteria | 3530 |
| 45 | Ga0068853_100126529 | 3300005539 | Bacteria | 2283 |
| 46 | Ga0068853_100267801 | 3300005539 | Bacteria | 1572 |
| 47 | Ga0068853_100412886 | 3300005539 | Bacteria | 1265 |
| 48 | Ga0070695_100001867 | 3300005545 | Bacteria | 11898 |
| 49 | Ga0070695_100417322 | 3300005545 | Bacteria | 1021 |
| 50 | Ga0070693_100561209 | 3300005547 | Bacteria | 819 |
| 51 | Ga0070693_100800145 | 3300005547 | Bacteria | 699 |
| 52 | Ga0070665_100002451 | 3300005548 | Bacteria | 20457 |
| 53 | Ga0070665_100032429 | 3300005548 | Bacteria | 5257 |
| 54 | Ga0070665_100037121 | 3300005548 | Bacteria | 4900 |
| 55 | Ga0070665_100270196 | 3300005548 | Bacteria | 1702 |
| 56 | Ga0070665_100406409 | 3300005548 | Bacteria | 1370 |
| 57 | Ga0068855_100003403 | 3300005563 | Bacteria | 19479 |
| 58 | Ga0068855_100044193 | 3300005563 | Bacteria | 5273 |
| 59 | Ga0068855_100350659 | 3300005563 | Bacteria | 1626 |
| 60 | Ga0068855_100599834 | 3300005563 | Bacteria | 1188 |
| 61 | Ga0068855_100973124 | 3300005563 | Bacteria | 893 |
| 62 | Ga0068857_100018013 | 3300005577 | Bacteria | 6195 |
| 63 | Ga0068857_100340923 | 3300005577 | Bacteria | 1386 |
| 64 | Ga0068854_100452350 | 3300005578 | Bacteria | 1073 |
| 65 | Ga0068856_100000324 | 3300005614 | Bacteria | 52557 |
| 66 | Ga0068856_100011811 | 3300005614 | Bacteria | 8465 |
| 67 | Ga0068856_100129623 | 3300005614 | Bacteria | 2526 |
| 68 | Ga0068856_100166042 | 3300005614 | Bacteria | 2219 |
| 69 | Ga0068856_100441425 | 3300005614 | Bacteria | 1322 |
| 70 | Ga0068856_100463568 | 3300005614 | Bacteria | 1288 |
| 71 | Ga0068852_100203930 | 3300005616 | Bacteria | 1872 |
| 72 | Ga0068852_100292054 | 3300005616 | Unclassified | 1575 |
| 73 | Ga0068864_100093642 | 3300005618 | Bacteria | 2654 |
| 74 | Ga0068864_100249382 | 3300005618 | Bacteria | 1648 |
| 75 | Ga0068863_100014949 | 3300005841 | Bacteria | 7455 |
| 76 | Ga0068863_100564900 | 3300005841 | Bacteria | 1124 |
| 77 | Ga0068860_100172919 | 3300005843 | Bacteria | 2087 |
| 78 | Ga0068862_100090910 | 3300005844 | Bacteria | 2658 |
| 79 | Ga0070716_100240391 | 3300006173 | Bacteria | 1228 |
| 80 | Ga0070712_100000014 | 3300006175 | Bacteria | 108668 |
| 81 | Ga0070712_100006487 | 3300006175 | Bacteria | 7256 |
| 82 | Ga0070712_100819793 | 3300006175 | Bacteria | 799 |
| 83 | Ga0097621_100059380 | 3300006237 | Bacteria | 3131 |
| 84 | Ga0097621_100221544 | 3300006237 | Bacteria | 1649 |
| 85 | Ga0097621_100527251 | 3300006237 | Bacteria | 1073 |
| 86 | Ga0068871_100041650 | 3300006358 | Bacteria | 3684 |
| 87 | Ga0068871_100099636 | 3300006358 | Bacteria | 2433 |
| 88 | Ga0068871_100768651 | 3300006358 | Bacteria | 886 |
| 89 | Ga0068871_100877059 | 3300006358 | Bacteria | 831 |
| 90 | Ga0075434_100063188 | 3300006871 | Bacteria | 3685 |
| 91 | Ga0068865_100004256 | 3300006881 | Bacteria | 8632 |
| 92 | Ga0068865_100067352 | 3300006881 | Bacteria | 2529 |
| 93 | Ga0075436_100000047 | 3300006914 | Bacteria | 72907 |
| 94 | Ga0075435_100038428 | 3300007076 | Bacteria | 3816 |
| 95 | Ga0075435_100131534 | 3300007076 | Bacteria | 2094 |
| 96 | Ga0105240_10000355 | 3300009093 | Bacteria | 86025 |
| 97 | Ga0105240_10070285 | 3300009093 | Bacteria | 4331 |
| 98 | Ga0105240_10106005 | 3300009093 | Bacteria | 3411 |
| 99 | Ga0105240_10107472 | 3300009093 | Bacteria | 3382 |
| 100 | Ga0105240_10202267 | 3300009093 | Bacteria | 2327 |
| 101 | Ga0105240_10266644 | 3300009093 | Bacteria | 1973 |
| 102 | Ga0105240_10335837 | 3300009093 | Bacteria | 1718 |
| 103 | Ga0105240_10359896 | 3300009093 | Bacteria | 1649 |
| 104 | Ga0105240_10800187 | 3300009093 | Bacteria | 1021 |
| 105 | Ga0105240_11530632 | 3300009093 | Bacteria | 699 |
| 106 | Ga0105245_10015475 | 3300009098 | Bacteria | 6651 |
| 107 | Ga0105245_10342868 | 3300009098 | Bacteria | 1478 |
| 108 | Ga0105245_12716642 | 3300009098 | Bacteria | 548 |
| 109 | Ga0105247_10012844 | 3300009101 | Bacteria | 5026 |
| 110 | Ga0105247_10247391 | 3300009101 | Bacteria | 1217 |
| 111 | Ga0105243_11067023 | 3300009148 | Bacteria | 814 |
| 112 | Ga0105241_10020313 | 3300009174 | Bacteria | 4908 |
| 113 | Ga0105241_10023450 | 3300009174 | Bacteria | 4577 |
| 114 | Ga0105241_10887437 | 3300009174 | Bacteria | 827 |
| 115 | Ga0105242_10357032 | 3300009176 | Bacteria | 1352 |
| 116 | Ga0105242_11192801 | 3300009176 | Bacteria | 780 |
| 117 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 118 | Ga0105248_10307484 | 3300009177 | Bacteria | 1785 |
| 119 | Ga0105248_11052145 | 3300009177 | Bacteria | 920 |
| 120 | Ga0105248_12830322 | 3300009177 | Bacteria | 553 |
| 121 | Ga0105237_10005340 | 3300009545 | Bacteria | 14538 |
| 122 | Ga0105237_10022042 | 3300009545 | Bacteria | 6538 |
| 123 | Ga0105237_10106817 | 3300009545 | Bacteria | 2791 |
| 124 | Ga0105237_10623082 | 3300009545 | Bacteria | 1086 |
| 125 | Ga0105237_10849293 | 3300009545 | Bacteria | 920 |
| 126 | Ga0105238_10069257 | 3300009551 | Bacteria | 3529 |
| 127 | Ga0105238_10084922 | 3300009551 | Bacteria | 3155 |
| 128 | Ga0105238_10123753 | 3300009551 | Bacteria | 2565 |
| 129 | Ga0105239_10001057 | 3300010375 | Bacteria | 38270 |
| 130 | Ga0105239_10006571 | 3300010375 | Bacteria | 13469 |
| 131 | Ga0105239_10017199 | 3300010375 | Bacteria | 7994 |
| 132 | Ga0105239_10020157 | 3300010375 | Bacteria | 7356 |
| 133 | Ga0105239_10252675 | 3300010375 | Bacteria | 1980 |
| 134 | Ga0105239_10817019 | 3300010375 | Bacteria | 1068 |
| 135 | Ga0105239_10931588 | 3300010375 | Bacteria | 997 |
| 136 | Ga0157373_10006397 | 3300013100 | Bacteria | 8798 |
| 137 | Ga0157370_10000280 | 3300013104 | Bacteria | 64677 |
| 138 | Ga0157370_10056413 | 3300013104 | Bacteria | 3739 |
| 139 | Ga0157370_10985497 | 3300013104 | Bacteria | 763 |
| 140 | Ga0157369_10003041 | 3300013105 | Bacteria | 20018 |
| 141 | Ga0157369_10017644 | 3300013105 | Bacteria | 8020 |
| 142 | Ga0157369_10023831 | 3300013105 | Bacteria | 6814 |
| 143 | Ga0157369_10085747 | 3300013105 | Bacteria | 3365 |
| 144 | Ga0157369_10827376 | 3300013105 | Bacteria | 951 |
| 145 | Ga0157374_10044703 | 3300013296 | Bacteria | 4094 |
| 146 | Ga0157374_11087418 | 3300013296 | Bacteria | 820 |
| 147 | Ga0163162_10034001 | 3300013306 | Bacteria | 5070 |
| 148 | Ga0163162_10168493 | 3300013306 | Bacteria | 2314 |
| 149 | Ga0163162_10277098 | 3300013306 | Unclassified | 1809 |
| 150 | Ga0157372_10010958 | 3300013307 | Bacteria | 9649 |
| 151 | Ga0157372_10053956 | 3300013307 | Bacteria | 4482 |
| 152 | Ga0157372_10352527 | 3300013307 | Bacteria | 1714 |
| 153 | Ga0157372_11298769 | 3300013307 | Bacteria | 840 |
| 154 | Ga0157375_10107987 | 3300013308 | Bacteria | 2877 |
| 155 | Ga0163163_10000012 | 3300014325 | Bacteria | 257369 |
| 156 | Ga0163163_10233286 | 3300014325 | Bacteria | 1889 |
| 157 | Ga0163163_10615921 | 3300014325 | Bacteria | 1149 |
| 158 | Ga0157380_10154212 | 3300014326 | Bacteria | 1989 |
| 159 | Ga0157379_10003319 | 3300014968 | Bacteria | 13629 |
| 160 | Ga0157379_10006401 | 3300014968 | Bacteria | 10142 |
| 161 | Ga0157379_10016921 | 3300014968 | Bacteria | 6417 |
| 162 | Ga0157379_11326752 | 3300014968 | Unclassified | 695 |
| 163 | Ga0157376_10047243 | 3300014969 | Unclassified | 3553 |
| 164 | Ga0157376_10908698 | 3300014969 | Bacteria | 899 |
| 165 | Ga0163161_10072881 | 3300017792 | Unclassified | 2515 |
| 166 | Ga0209233_1000006 | 3300025261 | Bacteria | 1473685 |
| 167 | Ga0209455_1031713 | 3300025272 | Bacteria | 884 |
| 168 | Ga0209758_1000008 | 3300025297 | Bacteria | 1215263 |
| 169 | Ga0207656_10087211 | 3300025321 | Bacteria | 1411 |
| 170 | Ga0207656_10306404 | 3300025321 | Bacteria | 787 |
| 171 | Ga0207682_10302327 | 3300025893 | Bacteria | 750 |
| 172 | Ga0207642_10042800 | 3300025899 | Bacteria | 1993 |
| 173 | Ga0207710_10013129 | 3300025900 | Bacteria | 3489 |
| 174 | Ga0207680_10093835 | 3300025903 | Bacteria | 1915 |
| 175 | Ga0207647_10153845 | 3300025904 | Bacteria | 1343 |
| 176 | Ga0207699_10002659 | 3300025906 | Bacteria | 8437 |
| 177 | Ga0207643_10054904 | 3300025908 | Bacteria | 2265 |
| 178 | Ga0207705_10006878 | 3300025909 | Bacteria | 8407 |
| 179 | Ga0207705_10338524 | 3300025909 | Bacteria | 1158 |
| 180 | Ga0207705_10377207 | 3300025909 | Bacteria | 1095 |
| 181 | Ga0207705_10525496 | 3300025909 | Bacteria | 919 |
| 182 | Ga0207705_11038643 | 3300025909 | Bacteria | 632 |
| 183 | Ga0207654_10018924 | 3300025911 | Bacteria | 3623 |
| 184 | Ga0207654_10074310 | 3300025911 | Bacteria | 2028 |
| 185 | Ga0207654_10085862 | 3300025911 | Bacteria | 1906 |
| 186 | Ga0207654_10103822 | 3300025911 | Bacteria | 1756 |
| 187 | Ga0207654_10197576 | 3300025911 | Bacteria | 1322 |
| 188 | Ga0207654_10217069 | 3300025911 | Bacteria | 1266 |
| 189 | Ga0207654_10415096 | 3300025911 | Bacteria | 938 |
| 190 | Ga0207707_10000002 | 3300025912 | Bacteria | 1142054 |
| 191 | Ga0207707_10134541 | 3300025912 | Bacteria | 2161 |
| 192 | Ga0207707_10490914 | 3300025912 | Bacteria | 1048 |
| 193 | Ga0207695_10002894 | 3300025913 | Bacteria | 24873 |
| 194 | Ga0207695_10005924 | 3300025913 | Bacteria | 16020 |
| 195 | Ga0207695_10006894 | 3300025913 | Bacteria | 14614 |
| 196 | Ga0207695_10029731 | 3300025913 | Bacteria | 6029 |
| 197 | Ga0207695_10043072 | 3300025913 | Bacteria | 4814 |
| 198 | Ga0207695_10081411 | 3300025913 | Bacteria | 3276 |
| 199 | Ga0207695_10083200 | 3300025913 | Bacteria | 3233 |
| 200 | Ga0207695_10176231 | 3300025913 | Bacteria | 2061 |
| 201 | Ga0207695_10228886 | 3300025913 | Bacteria | 1764 |
| 202 | Ga0207671_10010766 | 3300025914 | Bacteria | 7510 |
| 203 | Ga0207671_10075170 | 3300025914 | Bacteria | 2526 |
| 204 | Ga0207671_10099310 | 3300025914 | Bacteria | 2203 |
| 205 | Ga0207671_10173351 | 3300025914 | Bacteria | 1676 |
| 206 | Ga0207671_10380355 | 3300025914 | Bacteria | 1122 |
| 207 | Ga0207671_10393440 | 3300025914 | Bacteria | 1102 |
| 208 | Ga0207693_10001808 | 3300025915 | Bacteria | 18752 |
| 209 | Ga0207693_10082686 | 3300025915 | Bacteria | 2515 |
| 210 | Ga0207663_10003432 | 3300025916 | Bacteria | 7758 |
| 211 | Ga0207663_10473129 | 3300025916 | Bacteria | 969 |
| 212 | Ga0207660_10012316 | 3300025917 | Bacteria | 5593 |
| 213 | Ga0207660_10123799 | 3300025917 | Bacteria | 1961 |
| 214 | Ga0207657_10045169 | 3300025919 | Bacteria | 3868 |
| 215 | Ga0207649_10082871 | 3300025920 | Bacteria | 2080 |
| 216 | Ga0207649_10123402 | 3300025920 | Bacteria | 1749 |
| 217 | Ga0207649_10959613 | 3300025920 | Bacteria | 672 |
| 218 | Ga0207652_10000505 | 3300025921 | Bacteria | 39729 |
| 219 | Ga0207652_10073741 | 3300025921 | Bacteria | 2970 |
| 220 | Ga0207652_10128433 | 3300025921 | Bacteria | 2259 |
| 221 | Ga0207694_10034227 | 3300025924 | Bacteria | 3895 |
| 222 | Ga0207694_10058716 | 3300025924 | Bacteria | 2992 |
| 223 | Ga0207694_10108851 | 3300025924 | Bacteria | 2202 |
| 224 | Ga0207694_10172556 | 3300025924 | Bacteria | 1751 |
| 225 | Ga0207650_10121551 | 3300025925 | Bacteria | 2034 |
| 226 | Ga0207659_10057262 | 3300025926 | Bacteria | 2794 |
| 227 | Ga0207687_10055378 | 3300025927 | Bacteria | 2779 |
| 228 | Ga0207687_10083729 | 3300025927 | Bacteria | 2310 |
| 229 | Ga0207687_10322184 | 3300025927 | Bacteria | 1251 |
| 230 | Ga0207700_10000005 | 3300025928 | Bacteria | 394836 |
| 231 | Ga0207700_10092783 | 3300025928 | Bacteria | 2388 |
| 232 | Ga0207700_10342671 | 3300025928 | Bacteria | 1300 |
| 233 | Ga0207700_10657682 | 3300025928 | Bacteria | 934 |
| 234 | Ga0207700_10865288 | 3300025928 | Bacteria | 809 |
| 235 | Ga0207664_10005058 | 3300025929 | Bacteria | 8978 |
| 236 | Ga0207664_10019354 | 3300025929 | Bacteria | 5030 |
| 237 | Ga0207664_10457356 | 3300025929 | Bacteria | 1140 |
| 238 | Ga0207664_10906001 | 3300025929 | Bacteria | 792 |
| 239 | Ga0207686_10055672 | 3300025934 | Bacteria | 2483 |
| 240 | Ga0207686_10064909 | 3300025934 | Bacteria | 2326 |
| 241 | Ga0207670_10213921 | 3300025936 | Bacteria | 1472 |
| 242 | Ga0207704_10107182 | 3300025938 | Bacteria | 1879 |
| 243 | Ga0207704_10127682 | 3300025938 | Unclassified | 1754 |
| 244 | Ga0207665_10190276 | 3300025939 | Bacteria | 1490 |
| 245 | Ga0207691_10137580 | 3300025940 | Bacteria | 2154 |
| 246 | Ga0207691_10591196 | 3300025940 | Bacteria | 940 |
| 247 | Ga0207711_10000001 | 3300025941 | Bacteria | 1325674 |
| 248 | Ga0207711_10007394 | 3300025941 | Bacteria | 9190 |
| 249 | Ga0207689_10380798 | 3300025942 | Bacteria | 1175 |
| 250 | Ga0207689_10484941 | 3300025942 | Bacteria | 1035 |
| 251 | Ga0207661_10022224 | 3300025944 | Bacteria | 4772 |
| 252 | Ga0207661_10161221 | 3300025944 | Bacteria | 1946 |
| 253 | Ga0207661_10447730 | 3300025944 | Bacteria | 1176 |
| 254 | Ga0207667_10002638 | 3300025949 | Bacteria | 22170 |
| 255 | Ga0207667_10013610 | 3300025949 | Bacteria | 9299 |
| 256 | Ga0207667_10291968 | 3300025949 | Bacteria | 1666 |
| 257 | Ga0207667_10324439 | 3300025949 | Bacteria | 1572 |
| 258 | Ga0207667_10345664 | 3300025949 | Bacteria | 1517 |
| 259 | Ga0207667_10621922 | 3300025949 | Bacteria | 1087 |
| 260 | Ga0207667_10812031 | 3300025949 | Bacteria | 931 |
| 261 | Ga0207651_10148271 | 3300025960 | Bacteria | 1822 |
| 262 | Ga0207712_10886995 | 3300025961 | Bacteria | 788 |
| 263 | Ga0207640_10100272 | 3300025981 | Bacteria | 2029 |
| 264 | Ga0207640_10221218 | 3300025981 | Bacteria | 1450 |
| 265 | Ga0207640_10311411 | 3300025981 | Bacteria | 1250 |
| 266 | Ga0207677_10393652 | 3300026023 | Bacteria | 1173 |
| 267 | Ga0207677_10407435 | 3300026023 | Bacteria | 1155 |
| 268 | Ga0207703_10004691 | 3300026035 | Bacteria | 11162 |
| 269 | Ga0207639_10000177 | 3300026041 | Bacteria | 49899 |
| 270 | Ga0207639_10051967 | 3300026041 | Bacteria | 3120 |
| 271 | Ga0207639_10091289 | 3300026041 | Bacteria | 2438 |
| 272 | Ga0207639_10111022 | 3300026041 | Bacteria | 2234 |
| 273 | Ga0207639_10296858 | 3300026041 | Bacteria | 1427 |
| 274 | Ga0207639_10377580 | 3300026041 | Bacteria | 1272 |
| 275 | Ga0207639_10405199 | 3300026041 | Bacteria | 1229 |
| 276 | Ga0207639_10753091 | 3300026041 | Bacteria | 906 |
| 277 | Ga0207639_11456908 | 3300026041 | Bacteria | 643 |
| 278 | Ga0207678_10409795 | 3300026067 | Bacteria | 1174 |
| 279 | Ga0207702_10000173 | 3300026078 | Bacteria | 77458 |
| 280 | Ga0207702_10001957 | 3300026078 | Bacteria | 20052 |
| 281 | Ga0207702_10063041 | 3300026078 | Bacteria | 3169 |
| 282 | Ga0207702_10136329 | 3300026078 | Bacteria | 2215 |
| 283 | Ga0207702_11089609 | 3300026078 | Bacteria | 793 |
| 284 | Ga0207641_10545362 | 3300026088 | Bacteria | 1130 |
| 285 | Ga0207648_10002710 | 3300026089 | Bacteria | 18821 |
| 286 | Ga0207648_10004158 | 3300026089 | Bacteria | 14970 |
| 287 | Ga0207648_10609893 | 3300026089 | Bacteria | 1006 |
| 288 | Ga0207648_11425880 | 3300026089 | Bacteria | 651 |
| 289 | Ga0207676_10110609 | 3300026095 | Bacteria | 2298 |
| 290 | Ga0207674_10000112 | 3300026116 | Bacteria | 94220 |
| 291 | Ga0207683_10012382 | 3300026121 | Bacteria | 7279 |
| 292 | Ga0207683_10085041 | 3300026121 | Bacteria | 2812 |
| 293 | Ga0207698_10017098 | 3300026142 | Unclassified | 4911 |
| 294 | Ga0207698_10102985 | 3300026142 | Bacteria | 2371 |
| 295 | Ga0207698_10306776 | 3300026142 | Bacteria | 1480 |
| 296 | Ga0207698_10679454 | 3300026142 | Bacteria | 1023 |
| 297 | Ga0268266_10000463 | 3300028379 | Bacteria | 59089 |
| 298 | Ga0268266_10028386 | 3300028379 | Bacteria | 4757 |
| 299 | Ga0268266_10051941 | 3300028379 | Bacteria | 3519 |
| 300 | Ga0268266_10226067 | 3300028379 | Bacteria | 1722 |
| 301 | Ga0268266_10830101 | 3300028379 | Bacteria | 893 |
| 302 | Ga0268265_10095776 | 3300028380 | Bacteria | 2384 |
| 303 | Ga0268265_12359601 | 3300028380 | Bacteria | 538 |
| 304 | Ga0268264_10092261 | 3300028381 | Bacteria | 2614 |
| 305 | Ga0268264_11011090 | 3300028381 | Bacteria | 838 |
| 306 | Ga0265318_10020432 | 3300028577 | Bacteria | 2673 |
| 307 | Ga0265318_10173886 | 3300028577 | Bacteria | 789 |
| 308 | Ga0265338_10000649 | 3300028800 | Bacteria | 60084 |
| 309 | Ga0265338_10025110 | 3300028800 | Bacteria | 6062 |
| 310 | Ga0265338_10042395 | 3300028800 | Bacteria | 4238 |
| 311 | Ga0265338_10101580 | 3300028800 | Bacteria | 2341 |
| 312 | Ga0265338_10107996 | 3300028800 | Bacteria | 2249 |
| 313 | Ga0265330_10021948 | 3300031235 | Bacteria | 2909 |
| 314 | Ga0265330_10076589 | 3300031235 | Bacteria | 1444 |
| 315 | Ga0265330_10123028 | 3300031235 | Bacteria | 1105 |
| 316 | Ga0265330_10182896 | 3300031235 | Bacteria | 888 |
| 317 | Ga0265330_10248317 | 3300031235 | Bacteria | 750 |
| 318 | Ga0265330_10351148 | 3300031235 | Unclassified | 623 |
| 319 | Ga0265332_10028452 | 3300031238 | Bacteria | 2446 |
| 320 | Ga0265332_10036942 | 3300031238 | Bacteria | 2120 |
| 321 | Ga0265332_10048166 | 3300031238 | Bacteria | 1834 |
| 322 | Ga0265332_10193705 | 3300031238 | Bacteria | 845 |
| 323 | Ga0265332_10333762 | 3300031238 | Bacteria | 626 |
| 324 | Ga0265320_10228807 | 3300031240 | Bacteria | 827 |
| 325 | Ga0265320_10233401 | 3300031240 | Bacteria | 818 |
| 326 | Ga0265325_10000118 | 3300031241 | Bacteria | 54374 |
| 327 | Ga0265325_10026364 | 3300031241 | Bacteria | 3148 |
| 328 | Ga0265325_10087782 | 3300031241 | Bacteria | 1537 |
| 329 | Ga0265325_10207150 | 3300031241 | Bacteria | 902 |
| 330 | Ga0265340_10004919 | 3300031247 | Bacteria | 7430 |
| 331 | Ga0265340_10014528 | 3300031247 | Bacteria | 4110 |
| 332 | Ga0265339_10006488 | 3300031249 | Bacteria | 7671 |
| 333 | Ga0265339_10007455 | 3300031249 | Bacteria | 7069 |
| 334 | Ga0265339_10032724 | 3300031249 | Bacteria | 2932 |
| 335 | Ga0265331_10008800 | 3300031250 | Bacteria | 5717 |
| 336 | Ga0265331_10102867 | 3300031250 | Bacteria | 1313 |
| 337 | Ga0265316_10089652 | 3300031344 | Bacteria | 2346 |
| 338 | Ga0265316_10104106 | 3300031344 | Bacteria | 2154 |
| 339 | Ga0265316_10148198 | 3300031344 | Bacteria | 1759 |
| 340 | Ga0265316_10163518 | 3300031344 | Bacteria | 1663 |
| 341 | Ga0265316_10176209 | 3300031344 | Bacteria | 1593 |
| 342 | Ga0265313_10002149 | 3300031595 | Bacteria | 17538 |
| 343 | Ga0265313_10067381 | 3300031595 | Bacteria | 1656 |
| 344 | Ga0265313_10315098 | 3300031595 | Bacteria | 626 |
| 345 | Ga0265314_10016220 | 3300031711 | Bacteria | 5896 |
| 346 | Ga0265314_10022799 | 3300031711 | Bacteria | 4791 |
| 347 | Ga0265314_10029548 | 3300031711 | Bacteria | 4071 |
| 348 | Ga0265314_10050575 | 3300031711 | Bacteria | 2901 |
| 349 | Ga0265314_10054187 | 3300031711 | Bacteria | 2777 |
| 350 | Ga0265314_10072550 | 3300031711 | Bacteria | 2299 |
| 351 | Ga0265314_10176936 | 3300031711 | Bacteria | 1282 |
| 352 | Ga0265342_10100494 | 3300031712 | Bacteria | 1648 |
| 353 | Ga0265342_10159100 | 3300031712 | Bacteria | 1249 |
| 354 | Ga0307516_10028137 | 3300031730 | Bacteria | 5691 |
| 355 | Ga0373926_0201779 | 3300035083 | Bacteria | 765 |
| 356 | Ga0373932_0033289 | 3300035112 | Bacteria | 1446 |
| 357 | Ga0373943_0252068 | 3300035170 | Bacteria | 991 |
| 358 | Ga0373931_0064534 | 3300035691 | Bacteria | 1982 |
| 359 | Ga0373931_0068585 | 3300035691 | Bacteria | 1931 |
| 360 | Ga0373931_0436211 | 3300035691 | Bacteria | 835 |
| 361 | Ga0373935_0294390 | 3300035692 | Bacteria | 1146 |
| 362 | Ga0373935_0338874 | 3300035692 | Bacteria | 1070 |
| 363 | Ga0373927_0156825 | 3300035695 | Bacteria | 1491 |
| 364 | Ga0373927_0441764 | 3300035695 | Bacteria | 859 |
| 365 | Ga0373937_0000718 | 3300036401 | Bacteria | 28861 |
| 366 | Ga0373937_0362897 | 3300036401 | Bacteria | 1373 |
| 367 | Ga0373925_0049971 | 3300037068 | Bacteria | 3118 |
| 368 | Ga0395900_0020747 | 3300037418 | Bacteria | 6716 |
| 369 | Ga0395900_0422855 | 3300037418 | Bacteria | 1293 |
| 370 | Ga0395898_0026449 | 3300037466 | Bacteria | 5837 |
| 371 | Ga0395898_0028738 | 3300037466 | Bacteria | 5572 |
| 372 | Ga0395901_0006983 | 3300038443 | Bacteria | 11411 |
| 373 | Ga0395901_0258884 | 3300038443 | Bacteria | 1811 |
| 374 | Ga0436365_0412683 | 3300039437 | Bacteria | 137628 |
| 375 | Ga0436365_0756597 | 3300039437 | Bacteria | 13478 |
| 376 | Ga0436365_0795057 | 3300039437 | Bacteria | 592 |
| 377 | Ga0436360_0138325 | 3300039438 | Bacteria | 1355 |
| 378 | Ga0436360_0736524 | 3300039438 | Bacteria | 1126 |
| 379 | Ga0436363_0947660 | 3300039450 | Bacteria | 667 |
| 380 | Ga0451789_0025799 | 3300041443 | Bacteria | 584 |
| 381 | Ga0451807_1118758 | 3300041486 | Bacteria | 662 |
| 382 | Ga0451839_1107899 | 3300041496 | Bacteria | 630 |
| 383 | Ga0451577_0346840 | 3300042876 | Unclassified | 1347 |
| 384 | Ga0466971_0450817 | 3300044719 | Bacteria | 631 |
| 385 | Ga0466957_0231450 | 3300044842 | Bacteria | 1223 |
| 386 | Ga0495608_0254680 | 3300046511 | Bacteria | 1094 |
| 387 | Ga0495652_0175691 | 3300046529 | Bacteria | 1649 |
| 388 | Ga0495645_0097545 | 3300046543 | Unclassified | 2093 |
| 389 | Ga0495622_0005015 | 3300046557 | Bacteria | 6135 |
| 390 | Ga0495611_0057480 | 3300046648 | Bacteria | 1763 |
| 391 | Ga0495657_0108857 | 3300046675 | Bacteria | 1758 |
| 392 | Ga0495599_0043524 | 3300046678 | Bacteria | 2818 |
| 393 | Ga0495600_0678393 | 3300046809 | Bacteria | 621 |
| 394 | Ga0495604_0379618 | 3300047317 | Bacteria | 934 |
| 395 | Ga0495672_0180582 | 3300047320 | Bacteria | 1069 |
| 396 | Ga0495681_0067520 | 3300047470 | Bacteria | 1629 |
| 397 | Ga0496101_0925960 | 3300048904 | Bacteria | 686 |
| 398 | Ga0496102_0079458 | 3300048905 | Bacteria | 3021 |
| 399 | Ga0496106_0319118 | 3300048909 | Bacteria | 1247 |
| 400 | Ga0496106_0696862 | 3300048909 | Unclassified | 810 |
| 401 | Ga0496107_0674734 | 3300048910 | Bacteria | 761 |
| 402 | Ga0496110_0873247 | 3300048913 | Unclassified | 805 |
| 403 | Ga0496111_0209887 | 3300048914 | Bacteria | 1447 |
| 404 | Ga0496121_0001374 | 3300048924 | Bacteria | 41288 |
| 405 | Ga0496126_0055539 | 3300048929 | Bacteria | 3583 |
| 406 | Ga0496126_0104617 | 3300048929 | Bacteria | 2473 |
| 407 | Ga0495682_0159016 | 3300049460 | Bacteria | 805 |
| 408 | Ga0501031_0005444 | 3300049568 | Bacteria | 8288 |
| 409 | Ga0501031_0078158 | 3300049568 | Bacteria | 2156 |
| 410 | Ga0501031_0289476 | 3300049568 | Bacteria | 1062 |
| 411 | Ga0501032_0058487 | 3300049569 | Bacteria | 2588 |
| 412 | Ga0501032_0097502 | 3300049569 | Bacteria | 1948 |
| 413 | Ga0501032_0430144 | 3300049569 | Bacteria | 847 |
| 414 | Ga0501033_0022454 | 3300049570 | Bacteria | 4760 |
| 415 | Ga0501033_0025572 | 3300049570 | Bacteria | 4448 |
| 416 | Ga0501033_0122185 | 3300049570 | Bacteria | 1889 |
| 417 | Ga0501033_0433562 | 3300049570 | Bacteria | 914 |
| 418 | Ga0501033_0634340 | 3300049570 | Bacteria | 731 |
| 419 | Ga0501034_0007300 | 3300049571 | Bacteria | 11783 |
| 420 | Ga0501034_0014188 | 3300049571 | Bacteria | 8213 |
| 421 | Ga0501034_0045399 | 3300049571 | Bacteria | 4440 |
| 422 | Ga0501034_0070233 | 3300049571 | Bacteria | 3514 |
| 423 | Ga0501034_0114672 | 3300049571 | Bacteria | 2683 |
| 424 | Ga0501034_0224299 | 3300049571 | Bacteria | 1831 |
| 425 | Ga0501036_0000558 | 3300049572 | Bacteria | 26755 |
| 426 | Ga0501036_0014512 | 3300049572 | Bacteria | 6563 |
| 427 | Ga0501036_0101111 | 3300049572 | Bacteria | 2439 |
| 428 | Ga0501036_0139977 | 3300049572 | Bacteria | 2042 |
| 429 | Ga0501037_0004950 | 3300049573 | Bacteria | 9687 |
| 430 | Ga0501037_0015524 | 3300049573 | Bacteria | 5605 |
| 431 | Ga0501037_0042538 | 3300049573 | Bacteria | 3338 |
| 432 | Ga0501037_0650188 | 3300049573 | Bacteria | 705 |
| 433 | Ga0501038_0016521 | 3300049574 | Bacteria | 6690 |
| 434 | Ga0501038_0024321 | 3300049574 | Bacteria | 5405 |
| 435 | Ga0501038_0071389 | 3300049574 | Bacteria | 2945 |
| 436 | Ga0501038_0154418 | 3300049574 | Bacteria | 1870 |
| 437 | Ga0501038_0195944 | 3300049574 | Bacteria | 1624 |
| 438 | Ga0501039_0018130 | 3300049575 | Bacteria | 5402 |
| 439 | Ga0501040_0179597 | 3300049576 | Bacteria | 1500 |
| 440 | Ga0501042_0041796 | 3300049578 | Bacteria | 3261 |
| 441 | Ga0501043_0014171 | 3300049579 | Bacteria | 6237 |
| 442 | Ga0501043_0027321 | 3300049579 | Bacteria | 4481 |
| 443 | Ga0501043_0030978 | 3300049579 | Bacteria | 4206 |
| 444 | Ga0501043_0064808 | 3300049579 | Bacteria | 2869 |
| 445 | Ga0501043_0111009 | 3300049579 | Bacteria | 2153 |
| 446 | Ga0501043_0364648 | 3300049579 | Bacteria | 1096 |
| 447 | Ga0501046_0002604 | 3300049580 | Bacteria | 16849 |
| 448 | Ga0501046_0002663 | 3300049580 | Bacteria | 16652 |
| 449 | Ga0501046_0037462 | 3300049580 | Bacteria | 3897 |
| 450 | Ga0501046_0060433 | 3300049580 | Bacteria | 2965 |
| 451 | Ga0501046_0943620 | 3300049580 | Bacteria | 600 |
| 452 | Ga0501047_0007737 | 3300049581 | Bacteria | 10118 |
| 453 | Ga0501047_0010417 | 3300049581 | Bacteria | 8796 |
| 454 | Ga0501047_0013962 | 3300049581 | Bacteria | 7633 |
| 455 | Ga0501047_0018085 | 3300049581 | Bacteria | 6754 |
| 456 | Ga0501047_0066185 | 3300049581 | Bacteria | 3483 |
| 457 | Ga0501047_0127743 | 3300049581 | Bacteria | 2422 |
| 458 | Ga0501047_0576872 | 3300049581 | Bacteria | 948 |
| 459 | Ga0501048_0001789 | 3300049582 | Bacteria | 16336 |
| 460 | Ga0501048_0033129 | 3300049582 | Bacteria | 3734 |
| 461 | Ga0501067_0004055 | 3300049583 | Bacteria | 8078 |
| 462 | Ga0501067_0042667 | 3300049583 | Bacteria | 2518 |
| 463 | Ga0501067_0614261 | 3300049583 | Bacteria | 610 |
| 464 | Ga0501068_0009446 | 3300049584 | Bacteria | 5459 |
| 465 | Ga0501068_0479124 | 3300049584 | Bacteria | 806 |
| 466 | Ga0501069_0004628 | 3300049585 | Bacteria | 7118 |
| 467 | Ga0501069_0005812 | 3300049585 | Bacteria | 6423 |
| 468 | Ga0501070_0003030 | 3300049586 | Bacteria | 14629 |
| 469 | Ga0501070_0117328 | 3300049586 | Bacteria | 2198 |
| 470 | Ga0501072_0064417 | 3300049588 | Bacteria | 2890 |
| 471 | Ga0501073_0007843 | 3300049589 | Bacteria | 7925 |
| 472 | Ga0501073_0010669 | 3300049589 | Bacteria | 6727 |
| 473 | Ga0501073_0030051 | 3300049589 | Bacteria | 3881 |
| 474 | Ga0501073_0106868 | 3300049589 | Bacteria | 1942 |
| 475 | Ga0501074_0001185 | 3300049590 | Bacteria | 17126 |
| 476 | Ga0501074_0049193 | 3300049590 | Bacteria | 3043 |
| 477 | Ga0501079_0003589 | 3300049741 | Bacteria | 11407 |
| 478 | Ga0501079_0005218 | 3300049741 | Bacteria | 9652 |
| 479 | Ga0501080_0021202 | 3300049742 | Bacteria | 6013 |
| 480 | Ga0501080_0172012 | 3300049742 | Bacteria | 1997 |
| 481 | Ga0501080_0291497 | 3300049742 | Bacteria | 1482 |
| 482 | Ga0501083_0009000 | 3300049744 | Bacteria | 7047 |
| 483 | Ga0501083_0132593 | 3300049744 | Bacteria | 1633 |
| 484 | Ga0501083_0132664 | 3300049744 | Bacteria | 1633 |
| 485 | Ga0501035_0004255 | 3300049822 | Bacteria | 13585 |
| 486 | Ga0501035_0027400 | 3300049822 | Bacteria | 5208 |
| 487 | Ga0501035_0032219 | 3300049822 | Bacteria | 4770 |
| 488 | Ga0501035_0061541 | 3300049822 | Bacteria | 3341 |
| 489 | Ga0501035_0130572 | 3300049822 | Bacteria | 2190 |
| 490 | Ga0501035_0510977 | 3300049822 | Bacteria | 988 |
| 491 | Ga0501044_0002694 | 3300049823 | Bacteria | 20192 |
| 492 | Ga0501044_0019396 | 3300049823 | Bacteria | 7276 |
| 493 | Ga0501044_0020825 | 3300049823 | Bacteria | 7000 |
| 494 | Ga0501044_0045119 | 3300049823 | Bacteria | 4570 |
| 495 | Ga0501044_0059095 | 3300049823 | Bacteria | 3930 |
| 496 | Ga0501044_0118644 | 3300049823 | Bacteria | 2648 |
| 497 | Ga0501044_0295927 | 3300049823 | Bacteria | 1549 |
| 498 | Ga0501044_0650274 | 3300049823 | Bacteria | 943 |
| 499 | Ga0501044_0692107 | 3300049823 | Bacteria | 905 |
| 500 | Ga0501044_0728233 | 3300049823 | Bacteria | 875 |
| 501 | Ga0501045_0067708 | 3300049824 | Bacteria | 2623 |
| 502 | nmdc:mga0n895_95957_c1 | 3300050512 | Bacteria | 2970 |
| 503 | nmdc:mga0rr50_158750_c1 | 3300050513 | Bacteria | 1834 |
| 504 | nmdc:mga0rr50_24751_c1 | 3300050513 | Bacteria | 4163 |
| 505 | nmdc:mga08x19_119546_c1 | 3300050514 | Bacteria | 1765 |
| 506 | nmdc:mga08x19_62_c1 | 3300050514 | Bacteria | 114601 |
| 507 | Ga0495601_0286548 | 3300053077 | Bacteria | 1074 |
| 508 | Ga0500643_000027 | 3300053087 | Bacteria | 251062 |
| 509 | Ga0500646_0024524 | 3300053090 | Bacteria | 1624 |
| 510 | Ga0500650_0442624 | 3300053098 | Bacteria | 558 |
| 511 | Ga0500555_028111 | 3300053103 | Bacteria | 1603 |
| 512 | Ga0500595_001613 | 3300053119 | Bacteria | 11882 |
| 513 | Ga0500595_002881 | 3300053119 | Bacteria | 8246 |
| 514 | Ga0500595_061104 | 3300053119 | Bacteria | 1138 |
| 515 | Ga0500614_236329 | 3300053123 | Bacteria | 568 |
| 516 | Ga0500655_003054 | 3300053133 | Bacteria | 3037 |
| 517 | Ga0500559_0021837 | 3300053136 | Bacteria | 2715 |
| 518 | Ga0500559_0033420 | 3300053136 | Bacteria | 2214 |
| 519 | Ga0500559_0160260 | 3300053136 | Bacteria | 1057 |
| 520 | Ga0500568_0337175 | 3300053139 | Bacteria | 547 |
| 521 | Ga0500573_0000032 | 3300053140 | Bacteria | 131098 |
| 522 | Ga0500619_001906 | 3300053154 | Unclassified | 3864 |
| 523 | Ga0500645_080719 | 3300053730 | Bacteria | 928 |
| 524 | Ga0500587_004331 | 3300053739 | Bacteria | 1952 |
| 525 | Ga0501084_0004252 | 3300054114 | Bacteria | 11649 |
| 526 | Ga0501084_0035851 | 3300054114 | Bacteria | 4146 |
| 527 | Ga0501082_0098901 | 3300060353 | Bacteria | 2522 |
| 528 | Ga0501082_0681208 | 3300060353 | Bacteria | 900 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005841 | Ga0068863_100014949 | Ga0068863_1000149495 | 149 |
| 2 | 3300005331 | Ga0070670_100245078 | Ga0070670_1002450782 | 153 |
| 3 | 3300005456 | Ga0070678_101276540 | Ga0070678_1012765401 | 153 |
| 4 | 3300009098 | Ga0105245_10015475 | Ga0105245_100154752 | 153 |
| 5 | 3300009176 | Ga0105242_11192801 | Ga0105242_111928012 | 153 |
| 6 | 3300039437 | Ga0436365_0756597 | Ga0436365_0756597_3882_4355 | 153 |
| 7 | 3300003214 | JGI25165J46597_1000035 | JGI25165J46597_1000035246 | 154 |
| 8 | 3300003215 | JGI25153J46596_10001230 | JGI25153J46596_1000123012 | 154 |
| 9 | 3300005327 | Ga0070658_10476598 | Ga0070658_104765981 | 154 |
| 10 | 3300005327 | Ga0070658_10631670 | Ga0070658_106316702 | 154 |
| 11 | 3300005333 | Ga0070677_10086048 | Ga0070677_100860481 | 154 |
| 12 | 3300005334 | Ga0068869_100539882 | Ga0068869_1005398822 | 154 |
| 13 | 3300005334 | Ga0068869_100904246 | Ga0068869_1009042462 | 154 |
| 14 | 3300005336 | Ga0070680_100461394 | Ga0070680_1004613942 | 154 |
| 15 | 3300005337 | Ga0070682_100642173 | Ga0070682_1006421732 | 154 |
| 16 | 3300005338 | Ga0068868_100610041 | Ga0068868_1006100412 | 154 |
| 17 | 3300005339 | Ga0070660_100110972 | Ga0070660_1001109722 | 154 |
| 18 | 3300005344 | Ga0070661_100010114 | Ga0070661_1000101143 | 154 |
| 19 | 3300005344 | Ga0070661_100496246 | Ga0070661_1004962461 | 154 |
| 20 | 3300005344 | Ga0070661_100802057 | Ga0070661_1008020571 | 154 |
| 21 | 3300005356 | Ga0070674_100688561 | Ga0070674_1006885611 | 154 |
| 22 | 3300005356 | Ga0070674_100719895 | Ga0070674_1007198952 | 154 |
| 23 | 3300005367 | Ga0070667_100128627 | Ga0070667_1001286273 | 154 |
| 24 | 3300005434 | Ga0070709_10003569 | Ga0070709_100035696 | 154 |
| 25 | 3300005434 | Ga0070709_10077723 | Ga0070709_100777232 | 154 |
| 26 | 3300005435 | Ga0070714_100042367 | Ga0070714_1000423675 | 154 |
| 27 | 3300005435 | Ga0070714_100259178 | Ga0070714_1002591782 | 154 |
| 28 | 3300005435 | Ga0070714_100751218 | Ga0070714_1007512182 | 154 |
| 29 | 3300005436 | Ga0070713_100000011 | Ga0070713_100000011115 | 154 |
| 30 | 3300005436 | Ga0070713_100325451 | Ga0070713_1003254512 | 154 |
| 31 | 3300005439 | Ga0070711_100047094 | Ga0070711_1000470942 | 154 |
| 32 | 3300005439 | Ga0070711_100330474 | Ga0070711_1003304742 | 154 |
| 33 | 3300005455 | Ga0070663_100152829 | Ga0070663_1001528292 | 154 |
| 34 | 3300005455 | Ga0070663_100634136 | Ga0070663_1006341362 | 154 |
| 35 | 3300005456 | Ga0070678_100009857 | Ga0070678_1000098574 | 154 |
| 36 | 3300005458 | Ga0070681_10000002 | Ga0070681_10000002575 | 154 |
| 37 | 3300005458 | Ga0070681_10083094 | Ga0070681_100830942 | 154 |
| 38 | 3300005458 | Ga0070681_10227245 | Ga0070681_102272452 | 154 |
| 39 | 3300005459 | Ga0068867_100362411 | Ga0068867_1003624112 | 154 |
| 40 | 3300005459 | Ga0068867_101343761 | Ga0068867_1013437611 | 154 |
| 41 | 3300005518 | Ga0070699_100823059 | Ga0070699_1008230592 | 154 |
| 42 | 3300005530 | Ga0070679_100000035 | Ga0070679_10000003510 | 154 |
| 43 | 3300005530 | Ga0070679_100084210 | Ga0070679_1000842102 | 154 |
| 44 | 3300005530 | Ga0070679_100185968 | Ga0070679_1001859682 | 154 |
| 45 | 3300005530 | Ga0070679_100486465 | Ga0070679_1004864652 | 154 |
| 46 | 3300005535 | Ga0070684_100106639 | Ga0070684_1001066393 | 154 |
| 47 | 3300005539 | Ga0068853_100002661 | Ga0068853_1000026618 | 154 |
| 48 | 3300005539 | Ga0068853_100051940 | Ga0068853_1000519403 | 154 |
| 49 | 3300005539 | Ga0068853_100126529 | Ga0068853_1001265292 | 154 |
| 50 | 3300005539 | Ga0068853_100267801 | Ga0068853_1002678012 | 154 |
| 51 | 3300005539 | Ga0068853_100412886 | Ga0068853_1004128862 | 154 |
| 52 | 3300005545 | Ga0070695_100001867 | Ga0070695_1000018677 | 154 |
| 53 | 3300005545 | Ga0070695_100417322 | Ga0070695_1004173222 | 154 |
| 54 | 3300005547 | Ga0070693_100561209 | Ga0070693_1005612091 | 154 |
| 55 | 3300005547 | Ga0070693_100800145 | Ga0070693_1008001451 | 154 |
| 56 | 3300005548 | Ga0070665_100002451 | Ga0070665_1000024514 | 154 |
| 57 | 3300005548 | Ga0070665_100032429 | Ga0070665_1000324293 | 154 |
| 58 | 3300005548 | Ga0070665_100037121 | Ga0070665_1000371213 | 154 |
| 59 | 3300005548 | Ga0070665_100270196 | Ga0070665_1002701962 | 154 |
| 60 | 3300005548 | Ga0070665_100406409 | Ga0070665_1004064092 | 154 |
| 61 | 3300005563 | Ga0068855_100003403 | Ga0068855_1000034036 | 154 |
| 62 | 3300005563 | Ga0068855_100044193 | Ga0068855_1000441933 | 154 |
| 63 | 3300005563 | Ga0068855_100350659 | Ga0068855_1003506592 | 154 |
| 64 | 3300005563 | Ga0068855_100599834 | Ga0068855_1005998341 | 154 |
| 65 | 3300005563 | Ga0068855_100973124 | Ga0068855_1009731242 | 154 |
| 66 | 3300005577 | Ga0068857_100018013 | Ga0068857_1000180135 | 154 |
| 67 | 3300005577 | Ga0068857_100340923 | Ga0068857_1003409232 | 154 |
| 68 | 3300005578 | Ga0068854_100452350 | Ga0068854_1004523502 | 154 |
| 69 | 3300005614 | Ga0068856_100000324 | Ga0068856_10000032413 | 154 |
| 70 | 3300005614 | Ga0068856_100011811 | Ga0068856_1000118117 | 154 |
| 71 | 3300005614 | Ga0068856_100129623 | Ga0068856_1001296232 | 154 |
| 72 | 3300005614 | Ga0068856_100166042 | Ga0068856_1001660423 | 154 |
| 73 | 3300005614 | Ga0068856_100441425 | Ga0068856_1004414251 | 154 |
| 74 | 3300005614 | Ga0068856_100463568 | Ga0068856_1004635682 | 154 |
| 75 | 3300005616 | Ga0068852_100203930 | Ga0068852_1002039302 | 154 |
| 76 | 3300005616 | Ga0068852_100292054 | Ga0068852_1002920542 | 154 |
| 77 | 3300005618 | Ga0068864_100093642 | Ga0068864_1000936423 | 154 |
| 78 | 3300005618 | Ga0068864_100249382 | Ga0068864_1002493822 | 154 |
| 79 | 3300005841 | Ga0068863_100564900 | Ga0068863_1005649002 | 154 |
| 80 | 3300005843 | Ga0068860_100172919 | Ga0068860_1001729193 | 154 |
| 81 | 3300005844 | Ga0068862_100090910 | Ga0068862_1000909103 | 154 |
| 82 | 3300006173 | Ga0070716_100240391 | Ga0070716_1002403912 | 154 |
| 83 | 3300006175 | Ga0070712_100000014 | Ga0070712_10000001447 | 154 |
| 84 | 3300006175 | Ga0070712_100006487 | Ga0070712_1000064875 | 154 |
| 85 | 3300006175 | Ga0070712_100819793 | Ga0070712_1008197932 | 154 |
| 86 | 3300006237 | Ga0097621_100059380 | Ga0097621_1000593802 | 154 |
| 87 | 3300006237 | Ga0097621_100221544 | Ga0097621_1002215442 | 154 |
| 88 | 3300006237 | Ga0097621_100527251 | Ga0097621_1005272512 | 154 |
| 89 | 3300006358 | Ga0068871_100041650 | Ga0068871_1000416503 | 154 |
| 90 | 3300006358 | Ga0068871_100099636 | Ga0068871_1000996363 | 154 |
| 91 | 3300006358 | Ga0068871_100768651 | Ga0068871_1007686512 | 154 |
| 92 | 3300006358 | Ga0068871_100877059 | Ga0068871_1008770592 | 154 |
| 93 | 3300006871 | Ga0075434_100063188 | Ga0075434_1000631886 | 154 |
| 94 | 3300006881 | Ga0068865_100004256 | Ga0068865_1000042563 | 154 |
| 95 | 3300006881 | Ga0068865_100067352 | Ga0068865_1000673522 | 154 |
| 96 | 3300006914 | Ga0075436_100000047 | Ga0075436_10000004782 | 154 |
| 97 | 3300007076 | Ga0075435_100038428 | Ga0075435_1000384284 | 154 |
| 98 | 3300007076 | Ga0075435_100131534 | Ga0075435_1001315342 | 154 |
| 99 | 3300009093 | Ga0105240_10000355 | Ga0105240_1000035573 | 154 |
| 100 | 3300009093 | Ga0105240_10070285 | Ga0105240_100702852 | 154 |
| 101 | 3300009093 | Ga0105240_10106005 | Ga0105240_101060053 | 154 |
| 102 | 3300009093 | Ga0105240_10107472 | Ga0105240_101074722 | 154 |
| 103 | 3300009093 | Ga0105240_10202267 | Ga0105240_102022673 | 154 |
| 104 | 3300009093 | Ga0105240_10266644 | Ga0105240_102666442 | 154 |
| 105 | 3300009093 | Ga0105240_10335837 | Ga0105240_103358372 | 154 |
| 106 | 3300009093 | Ga0105240_10359896 | Ga0105240_103598962 | 154 |
| 107 | 3300009093 | Ga0105240_10800187 | Ga0105240_108001872 | 154 |
| 108 | 3300009093 | Ga0105240_11530632 | Ga0105240_115306322 | 154 |
| 109 | 3300009098 | Ga0105245_10342868 | Ga0105245_103428681 | 154 |
| 110 | 3300009098 | Ga0105245_12716642 | Ga0105245_127166421 | 154 |
| 111 | 3300009101 | Ga0105247_10012844 | Ga0105247_100128444 | 154 |
| 112 | 3300009101 | Ga0105247_10247391 | Ga0105247_102473912 | 154 |
| 113 | 3300009148 | Ga0105243_11067023 | Ga0105243_110670231 | 154 |
| 114 | 3300009174 | Ga0105241_10020313 | Ga0105241_100203133 | 154 |
| 115 | 3300009174 | Ga0105241_10023450 | Ga0105241_100234504 | 154 |
| 116 | 3300009174 | Ga0105241_10887437 | Ga0105241_108874372 | 154 |
| 117 | 3300009176 | Ga0105242_10357032 | Ga0105242_103570321 | 154 |
| 118 | 3300009177 | Ga0105248_10000001 | Ga0105248_100000011742 | 154 |
| 119 | 3300009177 | Ga0105248_10307484 | Ga0105248_103074844 | 154 |
| 120 | 3300009177 | Ga0105248_11052145 | Ga0105248_110521452 | 154 |
| 121 | 3300009177 | Ga0105248_12830322 | Ga0105248_128303221 | 154 |
| 122 | 3300009545 | Ga0105237_10005340 | Ga0105237_1000534010 | 154 |
| 123 | 3300009545 | Ga0105237_10022042 | Ga0105237_100220424 | 154 |
| 124 | 3300009545 | Ga0105237_10106817 | Ga0105237_101068173 | 154 |
| 125 | 3300009545 | Ga0105237_10623082 | Ga0105237_106230821 | 154 |
| 126 | 3300009545 | Ga0105237_10849293 | Ga0105237_108492932 | 154 |
| 127 | 3300009551 | Ga0105238_10069257 | Ga0105238_100692573 | 154 |
| 128 | 3300009551 | Ga0105238_10084922 | Ga0105238_100849222 | 154 |
| 129 | 3300009551 | Ga0105238_10123753 | Ga0105238_101237534 | 154 |
| 130 | 3300010375 | Ga0105239_10001057 | Ga0105239_1000105740 | 154 |
| 131 | 3300010375 | Ga0105239_10006571 | Ga0105239_1000657110 | 154 |
| 132 | 3300010375 | Ga0105239_10017199 | Ga0105239_100171992 | 154 |
| 133 | 3300010375 | Ga0105239_10020157 | Ga0105239_100201573 | 154 |
| 134 | 3300010375 | Ga0105239_10252675 | Ga0105239_102526753 | 154 |
| 135 | 3300010375 | Ga0105239_10817019 | Ga0105239_108170192 | 154 |
| 136 | 3300010375 | Ga0105239_10931588 | Ga0105239_109315882 | 154 |
| 137 | 3300013100 | Ga0157373_10006397 | Ga0157373_100063974 | 154 |
| 138 | 3300013104 | Ga0157370_10000280 | Ga0157370_1000028050 | 154 |
| 139 | 3300013104 | Ga0157370_10056413 | Ga0157370_100564132 | 154 |
| 140 | 3300013104 | Ga0157370_10985497 | Ga0157370_109854971 | 154 |
| 141 | 3300013105 | Ga0157369_10003041 | Ga0157369_100030412 | 154 |
| 142 | 3300013105 | Ga0157369_10017644 | Ga0157369_100176443 | 154 |
| 143 | 3300013105 | Ga0157369_10023831 | Ga0157369_100238315 | 154 |
| 144 | 3300013105 | Ga0157369_10085747 | Ga0157369_100857472 | 154 |
| 145 | 3300013105 | Ga0157369_10827376 | Ga0157369_108273762 | 154 |
| 146 | 3300013296 | Ga0157374_10044703 | Ga0157374_100447032 | 154 |
| 147 | 3300013296 | Ga0157374_11087418 | Ga0157374_110874182 | 154 |
| 148 | 3300013306 | Ga0163162_10034001 | Ga0163162_100340014 | 154 |
| 149 | 3300013306 | Ga0163162_10168493 | Ga0163162_101684932 | 154 |
| 150 | 3300013306 | Ga0163162_10277098 | Ga0163162_102770982 | 154 |
| 151 | 3300013307 | Ga0157372_10010958 | Ga0157372_100109586 | 154 |
| 152 | 3300013307 | Ga0157372_10053956 | Ga0157372_100539564 | 154 |
| 153 | 3300013307 | Ga0157372_10352527 | Ga0157372_103525272 | 154 |
| 154 | 3300013307 | Ga0157372_11298769 | Ga0157372_112987692 | 154 |
| 155 | 3300013308 | Ga0157375_10107987 | Ga0157375_101079873 | 154 |
| 156 | 3300014325 | Ga0163163_10000012 | Ga0163163_10000012246 | 154 |
| 157 | 3300014325 | Ga0163163_10233286 | Ga0163163_102332863 | 154 |
| 158 | 3300014325 | Ga0163163_10615921 | Ga0163163_106159212 | 154 |
| 159 | 3300014326 | Ga0157380_10154212 | Ga0157380_101542122 | 154 |
| 160 | 3300014968 | Ga0157379_10003319 | Ga0157379_1000331911 | 154 |
| 161 | 3300014968 | Ga0157379_10006401 | Ga0157379_100064014 | 154 |
| 162 | 3300014968 | Ga0157379_10016921 | Ga0157379_100169219 | 154 |
| 163 | 3300014968 | Ga0157379_11326752 | Ga0157379_113267522 | 154 |
| 164 | 3300014969 | Ga0157376_10047243 | Ga0157376_100472433 | 154 |
| 165 | 3300014969 | Ga0157376_10908698 | Ga0157376_109086982 | 154 |
| 166 | 3300017792 | Ga0163161_10072881 | Ga0163161_100728812 | 154 |
| 167 | 3300025261 | Ga0209233_1000006 | Ga0209233_1000006741 | 154 |
| 168 | 3300025272 | Ga0209455_1031713 | Ga0209455_10317131 | 154 |
| 169 | 3300025297 | Ga0209758_1000008 | Ga0209758_1000008182 | 154 |
| 170 | 3300025321 | Ga0207656_10087211 | Ga0207656_100872112 | 154 |
| 171 | 3300025321 | Ga0207656_10306404 | Ga0207656_103064041 | 154 |
| 172 | 3300025893 | Ga0207682_10302327 | Ga0207682_103023271 | 154 |
| 173 | 3300025899 | Ga0207642_10042800 | Ga0207642_100428002 | 154 |
| 174 | 3300025900 | Ga0207710_10013129 | Ga0207710_100131292 | 154 |
| 175 | 3300025903 | Ga0207680_10093835 | Ga0207680_100938352 | 154 |
| 176 | 3300025904 | Ga0207647_10153845 | Ga0207647_101538451 | 154 |
| 177 | 3300025906 | Ga0207699_10002659 | Ga0207699_100026596 | 154 |
| 178 | 3300025908 | Ga0207643_10054904 | Ga0207643_100549043 | 154 |
| 179 | 3300025909 | Ga0207705_10006878 | Ga0207705_100068789 | 154 |
| 180 | 3300025909 | Ga0207705_10338524 | Ga0207705_103385242 | 154 |
| 181 | 3300025909 | Ga0207705_10377207 | Ga0207705_103772072 | 154 |
| 182 | 3300025909 | Ga0207705_10525496 | Ga0207705_105254962 | 154 |
| 183 | 3300025909 | Ga0207705_11038643 | Ga0207705_110386431 | 154 |
| 184 | 3300025911 | Ga0207654_10018924 | Ga0207654_100189244 | 154 |
| 185 | 3300025911 | Ga0207654_10074310 | Ga0207654_100743103 | 154 |
| 186 | 3300025911 | Ga0207654_10085862 | Ga0207654_100858622 | 154 |
| 187 | 3300025911 | Ga0207654_10103822 | Ga0207654_101038222 | 154 |
| 188 | 3300025911 | Ga0207654_10197576 | Ga0207654_101975762 | 154 |
| 189 | 3300025911 | Ga0207654_10217069 | Ga0207654_102170692 | 154 |
| 190 | 3300025911 | Ga0207654_10415096 | Ga0207654_104150962 | 154 |
| 191 | 3300025912 | Ga0207707_10000002 | Ga0207707_10000002383 | 154 |
| 192 | 3300025912 | Ga0207707_10134541 | Ga0207707_101345413 | 154 |
| 193 | 3300025912 | Ga0207707_10490914 | Ga0207707_104909142 | 154 |
| 194 | 3300025913 | Ga0207695_10002894 | Ga0207695_100028947 | 154 |
| 195 | 3300025913 | Ga0207695_10005924 | Ga0207695_100059247 | 154 |
| 196 | 3300025913 | Ga0207695_10006894 | Ga0207695_100068946 | 154 |
| 197 | 3300025913 | Ga0207695_10029731 | Ga0207695_100297313 | 154 |
| 198 | 3300025913 | Ga0207695_10043072 | Ga0207695_100430723 | 154 |
| 199 | 3300025913 | Ga0207695_10081411 | Ga0207695_100814113 | 154 |
| 200 | 3300025913 | Ga0207695_10083200 | Ga0207695_100832002 | 154 |
| 201 | 3300025913 | Ga0207695_10176231 | Ga0207695_101762313 | 154 |
| 202 | 3300025913 | Ga0207695_10228886 | Ga0207695_102288862 | 154 |
| 203 | 3300025914 | Ga0207671_10010766 | Ga0207671_100107666 | 154 |
| 204 | 3300025914 | Ga0207671_10075170 | Ga0207671_100751702 | 154 |
| 205 | 3300025914 | Ga0207671_10099310 | Ga0207671_100993102 | 154 |
| 206 | 3300025914 | Ga0207671_10173351 | Ga0207671_101733512 | 154 |
| 207 | 3300025914 | Ga0207671_10380355 | Ga0207671_103803552 | 154 |
| 208 | 3300025914 | Ga0207671_10393440 | Ga0207671_103934402 | 154 |
| 209 | 3300025915 | Ga0207693_10001808 | Ga0207693_1000180818 | 154 |
| 210 | 3300025915 | Ga0207693_10082686 | Ga0207693_100826864 | 154 |
| 211 | 3300025916 | Ga0207663_10003432 | Ga0207663_100034326 | 154 |
| 212 | 3300025916 | Ga0207663_10473129 | Ga0207663_104731292 | 154 |
| 213 | 3300025917 | Ga0207660_10012316 | Ga0207660_100123165 | 154 |
| 214 | 3300025917 | Ga0207660_10123799 | Ga0207660_101237992 | 154 |
| 215 | 3300025919 | Ga0207657_10045169 | Ga0207657_100451693 | 154 |
| 216 | 3300025920 | Ga0207649_10082871 | Ga0207649_100828712 | 154 |
| 217 | 3300025920 | Ga0207649_10123402 | Ga0207649_101234022 | 154 |
| 218 | 3300025920 | Ga0207649_10959613 | Ga0207649_109596131 | 154 |
| 219 | 3300025921 | Ga0207652_10000505 | Ga0207652_100005053 | 154 |
| 220 | 3300025921 | Ga0207652_10073741 | Ga0207652_100737414 | 154 |
| 221 | 3300025921 | Ga0207652_10128433 | Ga0207652_101284332 | 154 |
| 222 | 3300025924 | Ga0207694_10034227 | Ga0207694_100342273 | 154 |
| 223 | 3300025924 | Ga0207694_10058716 | Ga0207694_100587165 | 154 |
| 224 | 3300025924 | Ga0207694_10108851 | Ga0207694_101088514 | 154 |
| 225 | 3300025924 | Ga0207694_10172556 | Ga0207694_101725562 | 154 |
| 226 | 3300025925 | Ga0207650_10121551 | Ga0207650_101215512 | 154 |
| 227 | 3300025926 | Ga0207659_10057262 | Ga0207659_100572623 | 154 |
| 228 | 3300025927 | Ga0207687_10055378 | Ga0207687_100553782 | 154 |
| 229 | 3300025927 | Ga0207687_10083729 | Ga0207687_100837293 | 154 |
| 230 | 3300025927 | Ga0207687_10322184 | Ga0207687_103221842 | 154 |
| 231 | 3300025928 | Ga0207700_10000005 | Ga0207700_1000000580 | 154 |
| 232 | 3300025928 | Ga0207700_10092783 | Ga0207700_100927833 | 154 |
| 233 | 3300025928 | Ga0207700_10342671 | Ga0207700_103426712 | 154 |
| 234 | 3300025928 | Ga0207700_10657682 | Ga0207700_106576822 | 154 |
| 235 | 3300025928 | Ga0207700_10865288 | Ga0207700_108652881 | 154 |
| 236 | 3300025929 | Ga0207664_10005058 | Ga0207664_100050583 | 154 |
| 237 | 3300025929 | Ga0207664_10019354 | Ga0207664_100193546 | 154 |
| 238 | 3300025929 | Ga0207664_10457356 | Ga0207664_104573562 | 154 |
| 239 | 3300025929 | Ga0207664_10906001 | Ga0207664_109060012 | 154 |
| 240 | 3300025934 | Ga0207686_10055672 | Ga0207686_100556723 | 154 |
| 241 | 3300025934 | Ga0207686_10064909 | Ga0207686_100649092 | 154 |
| 242 | 3300025936 | Ga0207670_10213921 | Ga0207670_102139211 | 154 |
| 243 | 3300025938 | Ga0207704_10107182 | Ga0207704_101071823 | 154 |
| 244 | 3300025938 | Ga0207704_10127682 | Ga0207704_101276822 | 154 |
| 245 | 3300025939 | Ga0207665_10190276 | Ga0207665_101902762 | 154 |
| 246 | 3300025940 | Ga0207691_10137580 | Ga0207691_101375804 | 154 |
| 247 | 3300025940 | Ga0207691_10591196 | Ga0207691_105911962 | 154 |
| 248 | 3300025941 | Ga0207711_10000001 | Ga0207711_10000001130 | 154 |
| 249 | 3300025941 | Ga0207711_10007394 | Ga0207711_100073943 | 154 |
| 250 | 3300025942 | Ga0207689_10380798 | Ga0207689_103807982 | 154 |
| 251 | 3300025942 | Ga0207689_10484941 | Ga0207689_104849412 | 154 |
| 252 | 3300025944 | Ga0207661_10022224 | Ga0207661_100222243 | 154 |
| 253 | 3300025944 | Ga0207661_10161221 | Ga0207661_101612212 | 154 |
| 254 | 3300025944 | Ga0207661_10447730 | Ga0207661_104477302 | 154 |
| 255 | 3300025949 | Ga0207667_10002638 | Ga0207667_1000263817 | 154 |
| 256 | 3300025949 | Ga0207667_10013610 | Ga0207667_100136102 | 154 |
| 257 | 3300025949 | Ga0207667_10291968 | Ga0207667_102919682 | 154 |
| 258 | 3300025949 | Ga0207667_10324439 | Ga0207667_103244393 | 154 |
| 259 | 3300025949 | Ga0207667_10345664 | Ga0207667_103456642 | 154 |
| 260 | 3300025949 | Ga0207667_10621922 | Ga0207667_106219222 | 154 |
| 261 | 3300025949 | Ga0207667_10812031 | Ga0207667_108120312 | 154 |
| 262 | 3300025960 | Ga0207651_10148271 | Ga0207651_101482712 | 154 |
| 263 | 3300025961 | Ga0207712_10886995 | Ga0207712_108869951 | 154 |
| 264 | 3300025981 | Ga0207640_10100272 | Ga0207640_101002722 | 154 |
| 265 | 3300025981 | Ga0207640_10221218 | Ga0207640_102212182 | 154 |
| 266 | 3300025981 | Ga0207640_10311411 | Ga0207640_103114112 | 154 |
| 267 | 3300026023 | Ga0207677_10393652 | Ga0207677_103936522 | 154 |
| 268 | 3300026023 | Ga0207677_10407435 | Ga0207677_104074352 | 154 |
| 269 | 3300026035 | Ga0207703_10004691 | Ga0207703_100046913 | 154 |
| 270 | 3300026041 | Ga0207639_10000177 | Ga0207639_1000017739 | 154 |
| 271 | 3300026041 | Ga0207639_10051967 | Ga0207639_100519672 | 154 |
| 272 | 3300026041 | Ga0207639_10091289 | Ga0207639_100912894 | 154 |
| 273 | 3300026041 | Ga0207639_10111022 | Ga0207639_101110223 | 154 |
| 274 | 3300026041 | Ga0207639_10296858 | Ga0207639_102968582 | 154 |
| 275 | 3300026041 | Ga0207639_10377580 | Ga0207639_103775802 | 154 |
| 276 | 3300026041 | Ga0207639_10405199 | Ga0207639_104051992 | 154 |
| 277 | 3300026041 | Ga0207639_10753091 | Ga0207639_107530912 | 154 |
| 278 | 3300026041 | Ga0207639_11456908 | Ga0207639_114569081 | 154 |
| 279 | 3300026067 | Ga0207678_10409795 | Ga0207678_104097952 | 154 |
| 280 | 3300026078 | Ga0207702_10000173 | Ga0207702_1000017338 | 154 |
| 281 | 3300026078 | Ga0207702_10001957 | Ga0207702_100019575 | 154 |
| 282 | 3300026078 | Ga0207702_10063041 | Ga0207702_100630413 | 154 |
| 283 | 3300026078 | Ga0207702_10136329 | Ga0207702_101363293 | 154 |
| 284 | 3300026078 | Ga0207702_11089609 | Ga0207702_110896092 | 154 |
| 285 | 3300026088 | Ga0207641_10545362 | Ga0207641_105453621 | 154 |
| 286 | 3300026089 | Ga0207648_10002710 | Ga0207648_1000271010 | 154 |
| 287 | 3300026089 | Ga0207648_10004158 | Ga0207648_1000415811 | 154 |
| 288 | 3300026089 | Ga0207648_10609893 | Ga0207648_106098932 | 154 |
| 289 | 3300026089 | Ga0207648_11425880 | Ga0207648_114258801 | 154 |
| 290 | 3300026095 | Ga0207676_10110609 | Ga0207676_101106092 | 154 |
| 291 | 3300026116 | Ga0207674_10000112 | Ga0207674_100001125 | 154 |
| 292 | 3300026121 | Ga0207683_10012382 | Ga0207683_100123823 | 154 |
| 293 | 3300026121 | Ga0207683_10085041 | Ga0207683_100850413 | 154 |
| 294 | 3300026142 | Ga0207698_10017098 | Ga0207698_100170984 | 154 |
| 295 | 3300026142 | Ga0207698_10102985 | Ga0207698_101029853 | 154 |
| 296 | 3300026142 | Ga0207698_10306776 | Ga0207698_103067762 | 154 |
| 297 | 3300026142 | Ga0207698_10679454 | Ga0207698_106794542 | 154 |
| 298 | 3300028379 | Ga0268266_10000463 | Ga0268266_1000046350 | 154 |
| 299 | 3300028379 | Ga0268266_10028386 | Ga0268266_100283863 | 154 |
| 300 | 3300028379 | Ga0268266_10051941 | Ga0268266_100519413 | 154 |
| 301 | 3300028379 | Ga0268266_10226067 | Ga0268266_102260672 | 154 |
| 302 | 3300028379 | Ga0268266_10830101 | Ga0268266_108301012 | 154 |
| 303 | 3300028380 | Ga0268265_10095776 | Ga0268265_100957762 | 154 |
| 304 | 3300028380 | Ga0268265_12359601 | Ga0268265_123596011 | 154 |
| 305 | 3300028381 | Ga0268264_10092261 | Ga0268264_100922611 | 154 |
| 306 | 3300028381 | Ga0268264_11011090 | Ga0268264_110110901 | 154 |
| 307 | 3300028577 | Ga0265318_10020432 | Ga0265318_100204322 | 154 |
| 308 | 3300028577 | Ga0265318_10173886 | Ga0265318_101738862 | 154 |
| 309 | 3300028800 | Ga0265338_10000649 | Ga0265338_100006493 | 154 |
| 310 | 3300028800 | Ga0265338_10025110 | Ga0265338_100251105 | 154 |
| 311 | 3300028800 | Ga0265338_10042395 | Ga0265338_100423952 | 154 |
| 312 | 3300028800 | Ga0265338_10101580 | Ga0265338_101015802 | 154 |
| 313 | 3300028800 | Ga0265338_10107996 | Ga0265338_101079963 | 154 |
| 314 | 3300031235 | Ga0265330_10021948 | Ga0265330_100219484 | 154 |
| 315 | 3300031235 | Ga0265330_10076589 | Ga0265330_100765892 | 154 |
| 316 | 3300031235 | Ga0265330_10123028 | Ga0265330_101230282 | 154 |
| 317 | 3300031235 | Ga0265330_10182896 | Ga0265330_101828961 | 154 |
| 318 | 3300031235 | Ga0265330_10248317 | Ga0265330_102483171 | 154 |
| 319 | 3300031235 | Ga0265330_10351148 | Ga0265330_103511481 | 154 |
| 320 | 3300031238 | Ga0265332_10028452 | Ga0265332_100284523 | 154 |
| 321 | 3300031238 | Ga0265332_10036942 | Ga0265332_100369422 | 154 |
| 322 | 3300031238 | Ga0265332_10048166 | Ga0265332_100481662 | 154 |
| 323 | 3300031238 | Ga0265332_10193705 | Ga0265332_101937052 | 154 |
| 324 | 3300031238 | Ga0265332_10333762 | Ga0265332_103337621 | 154 |
| 325 | 3300031240 | Ga0265320_10228807 | Ga0265320_102288071 | 154 |
| 326 | 3300031240 | Ga0265320_10233401 | Ga0265320_102334012 | 154 |
| 327 | 3300031241 | Ga0265325_10000118 | Ga0265325_1000011810 | 154 |
| 328 | 3300031241 | Ga0265325_10026364 | Ga0265325_100263643 | 154 |
| 329 | 3300031241 | Ga0265325_10087782 | Ga0265325_100877822 | 154 |
| 330 | 3300031241 | Ga0265325_10207150 | Ga0265325_102071502 | 154 |
| 331 | 3300031247 | Ga0265340_10004919 | Ga0265340_100049193 | 154 |
| 332 | 3300031247 | Ga0265340_10014528 | Ga0265340_100145284 | 154 |
| 333 | 3300031249 | Ga0265339_10006488 | Ga0265339_100064884 | 154 |
| 334 | 3300031249 | Ga0265339_10007455 | Ga0265339_100074552 | 154 |
| 335 | 3300031249 | Ga0265339_10032724 | Ga0265339_100327243 | 154 |
| 336 | 3300031250 | Ga0265331_10008800 | Ga0265331_100088003 | 154 |
| 337 | 3300031250 | Ga0265331_10102867 | Ga0265331_101028672 | 154 |
| 338 | 3300031344 | Ga0265316_10089652 | Ga0265316_100896523 | 154 |
| 339 | 3300031344 | Ga0265316_10104106 | Ga0265316_101041063 | 154 |
| 340 | 3300031344 | Ga0265316_10148198 | Ga0265316_101481983 | 154 |
| 341 | 3300031344 | Ga0265316_10163518 | Ga0265316_101635182 | 154 |
| 342 | 3300031344 | Ga0265316_10176209 | Ga0265316_101762092 | 154 |
| 343 | 3300031595 | Ga0265313_10002149 | Ga0265313_100021493 | 154 |
| 344 | 3300031595 | Ga0265313_10067381 | Ga0265313_100673812 | 154 |
| 345 | 3300031595 | Ga0265313_10315098 | Ga0265313_103150981 | 154 |
| 346 | 3300031711 | Ga0265314_10016220 | Ga0265314_100162204 | 154 |
| 347 | 3300031711 | Ga0265314_10022799 | Ga0265314_100227993 | 154 |
| 348 | 3300031711 | Ga0265314_10029548 | Ga0265314_100295484 | 154 |
| 349 | 3300031711 | Ga0265314_10050575 | Ga0265314_100505753 | 154 |
| 350 | 3300031711 | Ga0265314_10054187 | Ga0265314_100541873 | 154 |
| 351 | 3300031711 | Ga0265314_10072550 | Ga0265314_100725503 | 154 |
| 352 | 3300031711 | Ga0265314_10176936 | Ga0265314_101769362 | 154 |
| 353 | 3300031712 | Ga0265342_10100494 | Ga0265342_101004942 | 154 |
| 354 | 3300031712 | Ga0265342_10159100 | Ga0265342_101591002 | 154 |
| 355 | 3300031730 | Ga0307516_10028137 | Ga0307516_100281375 | 154 |
| 356 | 3300035083 | Ga0373926_0201779 | Ga0373926_0201779_72_572 | 154 |
| 357 | 3300035112 | Ga0373932_0033289 | Ga0373932_0033289_783_1283 | 154 |
| 358 | 3300035170 | Ga0373943_0252068 | Ga0373943_0252068_106_606 | 154 |
| 359 | 3300035691 | Ga0373931_0064534 | Ga0373931_0064534_1042_1542 | 154 |
| 360 | 3300035691 | Ga0373931_0068585 | Ga0373931_0068585_1255_1755 | 154 |
| 361 | 3300035691 | Ga0373931_0436211 | Ga0373931_0436211_40_546 | 154 |
| 362 | 3300035692 | Ga0373935_0294390 | Ga0373935_0294390_382_882 | 154 |
| 363 | 3300035692 | Ga0373935_0338874 | Ga0373935_0338874_171_671 | 154 |
| 364 | 3300035695 | Ga0373927_0156825 | Ga0373927_0156825_314_814 | 154 |
| 365 | 3300035695 | Ga0373927_0441764 | Ga0373927_0441764_217_717 | 154 |
| 366 | 3300036401 | Ga0373937_0000718 | Ga0373937_0000718_24739_25239 | 154 |
| 367 | 3300036401 | Ga0373937_0362897 | Ga0373937_0362897_288_767 | 154 |
| 368 | 3300037068 | Ga0373925_0049971 | Ga0373925_0049971_2281_2781 | 154 |
| 369 | 3300037418 | Ga0395900_0020747 | Ga0395900_0020747_3276_3740 | 154 |
| 370 | 3300037418 | Ga0395900_0422855 | Ga0395900_0422855_264_737 | 154 |
| 371 | 3300037466 | Ga0395898_0026449 | Ga0395898_0026449_5064_5537 | 154 |
| 372 | 3300037466 | Ga0395898_0028738 | Ga0395898_0028738_4540_5004 | 154 |
| 373 | 3300038443 | Ga0395901_0006983 | Ga0395901_0006983_1850_2314 | 154 |
| 374 | 3300038443 | Ga0395901_0258884 | Ga0395901_0258884_979_1452 | 154 |
| 375 | 3300039437 | Ga0436365_0412683 | Ga0436365_0412683_32508_33008 | 154 |
| 376 | 3300039437 | Ga0436365_0795057 | Ga0436365_0795057_94_558 | 154 |
| 377 | 3300039438 | Ga0436360_0138325 | Ga0436360_0138325_823_1299 | 154 |
| 378 | 3300039438 | Ga0436360_0736524 | Ga0436360_0736524_410_880 | 154 |
| 379 | 3300039450 | Ga0436363_0947660 | Ga0436363_0947660_87_566 | 154 |
| 380 | 3300041443 | Ga0451789_0025799 | Ga0451789_0025799_68_535 | 154 |
| 381 | 3300041486 | Ga0451807_1118758 | Ga0451807_1118758_27_512 | 154 |
| 382 | 3300041496 | Ga0451839_1107899 | Ga0451839_1107899_113_589 | 154 |
| 383 | 3300042876 | Ga0451577_0346840 | Ga0451577_0346840_836_1315 | 154 |
| 384 | 3300044719 | Ga0466971_0450817 | Ga0466971_0450817_116_580 | 154 |
| 385 | 3300044842 | Ga0466957_0231450 | Ga0466957_0231450_280_744 | 154 |
| 386 | 3300046511 | Ga0495608_0254680 | Ga0495608_0254680_383_871 | 154 |
| 387 | 3300046529 | Ga0495652_0175691 | Ga0495652_0175691_684_1181 | 154 |
| 388 | 3300046543 | Ga0495645_0097545 | Ga0495645_0097545_831_1328 | 154 |
| 389 | 3300046557 | Ga0495622_0005015 | Ga0495622_0005015_5648_6115 | 154 |
| 390 | 3300046648 | Ga0495611_0057480 | Ga0495611_0057480_798_1271 | 154 |
| 391 | 3300046675 | Ga0495657_0108857 | Ga0495657_0108857_902_1369 | 154 |
| 392 | 3300046678 | Ga0495599_0043524 | Ga0495599_0043524_1650_2138 | 154 |
| 393 | 3300046809 | Ga0495600_0678393 | Ga0495600_0678393_131_595 | 154 |
| 394 | 3300047317 | Ga0495604_0379618 | Ga0495604_0379618_88_576 | 154 |
| 395 | 3300047320 | Ga0495672_0180582 | Ga0495672_0180582_555_1019 | 154 |
| 396 | 3300047470 | Ga0495681_0067520 | Ga0495681_0067520_1035_1502 | 154 |
| 397 | 3300048904 | Ga0496101_0925960 | Ga0496101_0925960_86_586 | 154 |
| 398 | 3300048905 | Ga0496102_0079458 | Ga0496102_0079458_2195_2695 | 154 |
| 399 | 3300048909 | Ga0496106_0319118 | Ga0496106_0319118_169_669 | 154 |
| 400 | 3300048909 | Ga0496106_0696862 | Ga0496106_0696862_24_524 | 154 |
| 401 | 3300048910 | Ga0496107_0674734 | Ga0496107_0674734_71_568 | 154 |
| 402 | 3300048913 | Ga0496110_0873247 | Ga0496110_0873247_263_763 | 154 |
| 403 | 3300048914 | Ga0496111_0209887 | Ga0496111_0209887_833_1333 | 154 |
| 404 | 3300048924 | Ga0496121_0001374 | Ga0496121_0001374_16837_17307 | 154 |
| 405 | 3300048929 | Ga0496126_0055539 | Ga0496126_0055539_789_1259 | 154 |
| 406 | 3300048929 | Ga0496126_0104617 | Ga0496126_0104617_754_1239 | 154 |
| 407 | 3300049460 | Ga0495682_0159016 | Ga0495682_0159016_96_572 | 154 |
| 408 | 3300049568 | Ga0501031_0005444 | Ga0501031_0005444_3930_4418 | 154 |
| 409 | 3300049568 | Ga0501031_0078158 | Ga0501031_0078158_951_1490 | 154 |
| 410 | 3300049568 | Ga0501031_0289476 | Ga0501031_0289476_512_997 | 154 |
| 411 | 3300049569 | Ga0501032_0058487 | Ga0501032_0058487_1723_2187 | 154 |
| 412 | 3300049569 | Ga0501032_0097502 | Ga0501032_0097502_293_778 | 154 |
| 413 | 3300049569 | Ga0501032_0430144 | Ga0501032_0430144_260_724 | 154 |
| 414 | 3300049570 | Ga0501033_0022454 | Ga0501033_0022454_1741_2280 | 154 |
| 415 | 3300049570 | Ga0501033_0025572 | Ga0501033_0025572_2735_3199 | 154 |
| 416 | 3300049570 | Ga0501033_0122185 | Ga0501033_0122185_224_763 | 154 |
| 417 | 3300049570 | Ga0501033_0433562 | Ga0501033_0433562_94_558 | 154 |
| 418 | 3300049570 | Ga0501033_0634340 | Ga0501033_0634340_244_717 | 154 |
| 419 | 3300049571 | Ga0501034_0007300 | Ga0501034_0007300_5159_5647 | 154 |
| 420 | 3300049571 | Ga0501034_0014188 | Ga0501034_0014188_2488_2964 | 154 |
| 421 | 3300049571 | Ga0501034_0045399 | Ga0501034_0045399_1709_2173 | 154 |
| 422 | 3300049571 | Ga0501034_0070233 | Ga0501034_0070233_1486_1950 | 154 |
| 423 | 3300049571 | Ga0501034_0114672 | Ga0501034_0114672_1682_2167 | 154 |
| 424 | 3300049571 | Ga0501034_0224299 | Ga0501034_0224299_332_808 | 154 |
| 425 | 3300049572 | Ga0501036_0000558 | Ga0501036_0000558_23086_23574 | 154 |
| 426 | 3300049572 | Ga0501036_0014512 | Ga0501036_0014512_1827_2312 | 154 |
| 427 | 3300049572 | Ga0501036_0101111 | Ga0501036_0101111_567_1031 | 154 |
| 428 | 3300049572 | Ga0501036_0139977 | Ga0501036_0139977_1409_1873 | 154 |
| 429 | 3300049573 | Ga0501037_0004950 | Ga0501037_0004950_5121_5609 | 154 |
| 430 | 3300049573 | Ga0501037_0015524 | Ga0501037_0015524_3448_3933 | 154 |
| 431 | 3300049573 | Ga0501037_0042538 | Ga0501037_0042538_414_878 | 154 |
| 432 | 3300049573 | Ga0501037_0650188 | Ga0501037_0650188_41_505 | 154 |
| 433 | 3300049574 | Ga0501038_0016521 | Ga0501038_0016521_747_1235 | 154 |
| 434 | 3300049574 | Ga0501038_0024321 | Ga0501038_0024321_3195_3659 | 154 |
| 435 | 3300049574 | Ga0501038_0071389 | Ga0501038_0071389_1493_2032 | 154 |
| 436 | 3300049574 | Ga0501038_0154418 | Ga0501038_0154418_946_1413 | 154 |
| 437 | 3300049574 | Ga0501038_0195944 | Ga0501038_0195944_371_907 | 154 |
| 438 | 3300049575 | Ga0501039_0018130 | Ga0501039_0018130_4337_4825 | 154 |
| 439 | 3300049576 | Ga0501040_0179597 | Ga0501040_0179597_509_997 | 154 |
| 440 | 3300049578 | Ga0501042_0041796 | Ga0501042_0041796_1704_2192 | 154 |
| 441 | 3300049579 | Ga0501043_0014171 | Ga0501043_0014171_4678_5166 | 154 |
| 442 | 3300049579 | Ga0501043_0027321 | Ga0501043_0027321_470_934 | 154 |
| 443 | 3300049579 | Ga0501043_0030978 | Ga0501043_0030978_910_1374 | 154 |
| 444 | 3300049579 | Ga0501043_0064808 | Ga0501043_0064808_1487_1951 | 154 |
| 445 | 3300049579 | Ga0501043_0111009 | Ga0501043_0111009_1271_1738 | 154 |
| 446 | 3300049579 | Ga0501043_0364648 | Ga0501043_0364648_264_749 | 154 |
| 447 | 3300049580 | Ga0501046_0002604 | Ga0501046_0002604_8073_8540 | 154 |
| 448 | 3300049580 | Ga0501046_0002663 | Ga0501046_0002663_4041_4529 | 154 |
| 449 | 3300049580 | Ga0501046_0037462 | Ga0501046_0037462_1638_2102 | 154 |
| 450 | 3300049580 | Ga0501046_0060433 | Ga0501046_0060433_856_1320 | 154 |
| 451 | 3300049580 | Ga0501046_0943620 | Ga0501046_0943620_41_505 | 154 |
| 452 | 3300049581 | Ga0501047_0007737 | Ga0501047_0007737_9446_9913 | 154 |
| 453 | 3300049581 | Ga0501047_0010417 | Ga0501047_0010417_3179_3664 | 154 |
| 454 | 3300049581 | Ga0501047_0013962 | Ga0501047_0013962_3591_4079 | 154 |
| 455 | 3300049581 | Ga0501047_0018085 | Ga0501047_0018085_1984_2523 | 154 |
| 456 | 3300049581 | Ga0501047_0066185 | Ga0501047_0066185_1811_2275 | 154 |
| 457 | 3300049581 | Ga0501047_0127743 | Ga0501047_0127743_1479_1943 | 154 |
| 458 | 3300049581 | Ga0501047_0576872 | Ga0501047_0576872_160_624 | 154 |
| 459 | 3300049582 | Ga0501048_0001789 | Ga0501048_0001789_3776_4264 | 154 |
| 460 | 3300049582 | Ga0501048_0033129 | Ga0501048_0033129_1530_2015 | 154 |
| 461 | 3300049583 | Ga0501067_0004055 | Ga0501067_0004055_6513_6998 | 154 |
| 462 | 3300049583 | Ga0501067_0042667 | Ga0501067_0042667_1105_1593 | 154 |
| 463 | 3300049583 | Ga0501067_0614261 | Ga0501067_0614261_118_585 | 154 |
| 464 | 3300049584 | Ga0501068_0009446 | Ga0501068_0009446_3461_3949 | 154 |
| 465 | 3300049584 | Ga0501068_0479124 | Ga0501068_0479124_132_596 | 154 |
| 466 | 3300049585 | Ga0501069_0004628 | Ga0501069_0004628_1864_2349 | 154 |
| 467 | 3300049585 | Ga0501069_0005812 | Ga0501069_0005812_3299_3787 | 154 |
| 468 | 3300049586 | Ga0501070_0003030 | Ga0501070_0003030_8994_9482 | 154 |
| 469 | 3300049586 | Ga0501070_0117328 | Ga0501070_0117328_1074_1559 | 154 |
| 470 | 3300049588 | Ga0501072_0064417 | Ga0501072_0064417_1591_2079 | 154 |
| 471 | 3300049589 | Ga0501073_0007843 | Ga0501073_0007843_6292_6780 | 154 |
| 472 | 3300049589 | Ga0501073_0010669 | Ga0501073_0010669_2959_3426 | 154 |
| 473 | 3300049589 | Ga0501073_0030051 | Ga0501073_0030051_1248_1712 | 154 |
| 474 | 3300049589 | Ga0501073_0106868 | Ga0501073_0106868_397_861 | 154 |
| 475 | 3300049590 | Ga0501074_0001185 | Ga0501074_0001185_5112_5600 | 154 |
| 476 | 3300049590 | Ga0501074_0049193 | Ga0501074_0049193_707_1192 | 154 |
| 477 | 3300049741 | Ga0501079_0003589 | Ga0501079_0003589_1674_2162 | 154 |
| 478 | 3300049741 | Ga0501079_0005218 | Ga0501079_0005218_7015_7500 | 154 |
| 479 | 3300049742 | Ga0501080_0021202 | Ga0501080_0021202_2290_2775 | 154 |
| 480 | 3300049742 | Ga0501080_0172012 | Ga0501080_0172012_1122_1610 | 154 |
| 481 | 3300049742 | Ga0501080_0291497 | Ga0501080_0291497_609_1103 | 154 |
| 482 | 3300049744 | Ga0501083_0009000 | Ga0501083_0009000_4698_5186 | 154 |
| 483 | 3300049744 | Ga0501083_0132593 | Ga0501083_0132593_353_817 | 154 |
| 484 | 3300049744 | Ga0501083_0132664 | Ga0501083_0132664_670_1146 | 154 |
| 485 | 3300049822 | Ga0501035_0004255 | Ga0501035_0004255_5590_6129 | 154 |
| 486 | 3300049822 | Ga0501035_0027400 | Ga0501035_0027400_1661_2146 | 154 |
| 487 | 3300049822 | Ga0501035_0032219 | Ga0501035_0032219_811_1299 | 154 |
| 488 | 3300049822 | Ga0501035_0061541 | Ga0501035_0061541_320_784 | 154 |
| 489 | 3300049822 | Ga0501035_0130572 | Ga0501035_0130572_495_959 | 154 |
| 490 | 3300049822 | Ga0501035_0510977 | Ga0501035_0510977_26_490 | 154 |
| 491 | 3300049823 | Ga0501044_0002694 | Ga0501044_0002694_12219_12788 | 154 |
| 492 | 3300049823 | Ga0501044_0019396 | Ga0501044_0019396_1662_2147 | 154 |
| 493 | 3300049823 | Ga0501044_0020825 | Ga0501044_0020825_4685_5149 | 154 |
| 494 | 3300049823 | Ga0501044_0045119 | Ga0501044_0045119_375_839 | 154 |
| 495 | 3300049823 | Ga0501044_0059095 | Ga0501044_0059095_966_1430 | 154 |
| 496 | 3300049823 | Ga0501044_0118644 | Ga0501044_0118644_615_1082 | 154 |
| 497 | 3300049823 | Ga0501044_0295927 | Ga0501044_0295927_250_714 | 154 |
| 498 | 3300049823 | Ga0501044_0650274 | Ga0501044_0650274_185_658 | 154 |
| 499 | 3300049823 | Ga0501044_0692107 | Ga0501044_0692107_336_872 | 154 |
| 500 | 3300049823 | Ga0501044_0728233 | Ga0501044_0728233_282_821 | 154 |
| 501 | 3300049824 | Ga0501045_0067708 | Ga0501045_0067708_1738_2226 | 154 |
| 502 | 3300050512 | nmdc:mga0n895_95957_c1 | nmdc:mga0n895_95957_c1_2322_2822 | 154 |
| 503 | 3300050513 | nmdc:mga0rr50_158750_c1 | nmdc:mga0rr50_158750_c1_103_603 | 154 |
| 504 | 3300050513 | nmdc:mga0rr50_24751_c1 | nmdc:mga0rr50_24751_c1_1199_1699 | 154 |
| 505 | 3300050514 | nmdc:mga08x19_119546_c1 | nmdc:mga08x19_119546_c1_1025_1525 | 154 |
| 506 | 3300050514 | nmdc:mga08x19_62_c1 | nmdc:mga08x19_62_c1_42019_42519 | 154 |
| 507 | 3300053077 | Ga0495601_0286548 | Ga0495601_0286548_479_967 | 154 |
| 508 | 3300053087 | Ga0500643_000027 | Ga0500643_000027_143738_144202 | 154 |
| 509 | 3300053090 | Ga0500646_0024524 | Ga0500646_0024524_98_562 | 154 |
| 510 | 3300053098 | Ga0500650_0442624 | Ga0500650_0442624_77_544 | 154 |
| 511 | 3300053103 | Ga0500555_028111 | Ga0500555_028111_420_887 | 154 |
| 512 | 3300053119 | Ga0500595_001613 | Ga0500595_001613_10105_10581 | 154 |
| 513 | 3300053119 | Ga0500595_002881 | Ga0500595_002881_2006_2470 | 154 |
| 514 | 3300053119 | Ga0500595_061104 | Ga0500595_061104_554_1024 | 154 |
| 515 | 3300053123 | Ga0500614_236329 | Ga0500614_236329_25_495 | 154 |
| 516 | 3300053133 | Ga0500655_003054 | Ga0500655_003054_1720_2217 | 154 |
| 517 | 3300053136 | Ga0500559_0021837 | Ga0500559_0021837_921_1388 | 154 |
| 518 | 3300053136 | Ga0500559_0033420 | Ga0500559_0033420_574_1038 | 154 |
| 519 | 3300053136 | Ga0500559_0160260 | Ga0500559_0160260_18_506 | 154 |
| 520 | 3300053139 | Ga0500568_0337175 | Ga0500568_0337175_20_520 | 154 |
| 521 | 3300053140 | Ga0500573_0000032 | Ga0500573_0000032_57730_58206 | 154 |
| 522 | 3300053154 | Ga0500619_001906 | Ga0500619_001906_1068_1565 | 154 |
| 523 | 3300053730 | Ga0500645_080719 | Ga0500645_080719_325_789 | 154 |
| 524 | 3300053739 | Ga0500587_004331 | Ga0500587_004331_1281_1763 | 154 |
| 525 | 3300054114 | Ga0501084_0004252 | Ga0501084_0004252_1988_2476 | 154 |
| 526 | 3300054114 | Ga0501084_0035851 | Ga0501084_0035851_1547_2032 | 154 |
| 527 | 3300060353 | Ga0501082_0098901 | Ga0501082_0098901_393_878 | 154 |
| 528 | 3300060353 | Ga0501082_0681208 | Ga0501082_0681208_14_478 | 154 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7sp3-assembly1.cif.gz_A | e. coli rpph bound to ap4a | 0.9447 | 7 | 153 |
| 4s2y-assembly1.cif.gz_A | structure of e. coli rpph bound to rna and three magnesium ions | 0.9359 | 7 | 153 |
| 4s2x-assembly1.cif.gz_A | structure of e. coli rpph bound to rna and two magnesium ions | 0.9312 | 7 | 153 |
| 6vcp-assembly1.cif.gz_A | crystal structure of e.coli rpph in complex with utp | 0.9288 | 7 | 153 |
| 6d1v-assembly1.cif.gz_B | crystal structure of e. coli rpph-dapf complex, monomer bound to rna | 0.9276 | 7 | 153 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4s2yA00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9359 | 7 | 153 | 3.90.79.10 |
| af_C6SXU5_1_159_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9357 | 5 | 154 | 3.90.79.10 |
| af_A0A0R0I796_20_164_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9176 | 21 | 154 | 3.90.79.10 |
| af_C6SXU5_1_159_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9063 | 5 | 154 | 3.90.79.10 |
| af_Q54FR0_1_169_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8947 | 4 | 153 | 3.90.79.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U0SD55-F1-model_v4 | RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) | 0.9837 | 3 | 153 |
GO:0006753
GO:0008893 GO:0019693 GO:0034432 |
| AF-A0A850H202-F1-model_v4 | RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) | 0.9837 | 2 | 154 |
GO:0006753
GO:0008893 GO:0019693 GO:0034432 |
| AF-A0A7C9HA00-F1-model_v4 | RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) | 0.9832 | 3 | 154 |
GO:0006753
GO:0008893 GO:0019693 GO:0034432 |
| AF-A0A7Y0E1Y1-F1-model_v4 | RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) | 0.9831 | 4 | 153 |
GO:0006753
GO:0008893 GO:0019693 GO:0034432 |
| AF-A0A2L0AEG9-F1-model_v4 | RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) | 0.983 | 1 | 154 |
GO:0006753
GO:0008893 GO:0019693 GO:0034432 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar