F459736

General Info

Members Datasets Scaffolds Average Seq Length
528 221 528 160

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0002694|Ga0501044_0002694_12219_12788
Length 189
Sequence LRPEFVAPSLMYALYTSLGRSCSGRKISRAAKSEPMTSDLPYRPCVGIMLFNKDGEVFVGKRIDQTVEGWQMPQGGIDEGETPRQAALRELREEVGTSKAEIIGEMDDWVTYDLPPHLIGVAFHGKYKGQRQKWFALRFLGQDADIDLTAHEPEFSAYRWLALEALPHVIVPFKRRTYAAVIAAFRGLA

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
69 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
125 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
136 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
137 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
149 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
150 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
151 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
152 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
160 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
166 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
208 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
209 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
210 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
211 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
212 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
213 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
214 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
215 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
216 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
217 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
218 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
219 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.17
Nodule 0
Rhizoplane 1.7
Rhizosphere 92.42
Stem 0
Stem Tuber 0
Unclassified 1.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000035 3300003214 Bacteria 290723
2 JGI25153J46596_10001230 3300003215 Bacteria 15443
3 Ga0070658_10476598 3300005327 Bacteria 1077
4 Ga0070658_10631670 3300005327 Bacteria 929
5 Ga0070670_100245078 3300005331 Bacteria 1560
6 Ga0070677_10086048 3300005333 Bacteria 1357
7 Ga0068869_100539882 3300005334 Bacteria 978
8 Ga0068869_100904246 3300005334 Bacteria 764
9 Ga0070680_100461394 3300005336 Bacteria 1085
10 Ga0070682_100642173 3300005337 Bacteria 844
11 Ga0068868_100610041 3300005338 Bacteria 968
12 Ga0070660_100110972 3300005339 Bacteria 2182
13 Ga0070661_100010114 3300005344 Bacteria 6552
14 Ga0070661_100496246 3300005344 Bacteria 977
15 Ga0070661_100802057 3300005344 Bacteria 773
16 Ga0070674_100688561 3300005356 Bacteria 873
17 Ga0070674_100719895 3300005356 Bacteria 855
18 Ga0070667_100128627 3300005367 Bacteria 2209
19 Ga0070709_10003569 3300005434 Bacteria 8355
20 Ga0070709_10077723 3300005434 Bacteria 2158
21 Ga0070714_100042367 3300005435 Bacteria 3845
22 Ga0070714_100259178 3300005435 Bacteria 1610
23 Ga0070714_100751218 3300005435 Bacteria 943
24 Ga0070713_100000011 3300005436 Bacteria 146314
25 Ga0070713_100325451 3300005436 Bacteria 1420
26 Ga0070711_100047094 3300005439 Bacteria 2942
27 Ga0070711_100330474 3300005439 Bacteria 1220
28 Ga0070663_100152829 3300005455 Bacteria 1771
29 Ga0070663_100634136 3300005455 Bacteria 902
30 Ga0070678_100009857 3300005456 Bacteria 5807
31 Ga0070678_101276540 3300005456 Bacteria 683
32 Ga0070681_10000002 3300005458 Bacteria 821814
33 Ga0070681_10083094 3300005458 Bacteria 3157
34 Ga0070681_10227245 3300005458 Bacteria 1781
35 Ga0068867_100362411 3300005459 Bacteria 1213
36 Ga0068867_101343761 3300005459 Bacteria 661
37 Ga0070699_100823059 3300005518 Bacteria 850
38 Ga0070679_100000035 3300005530 Bacteria 103095
39 Ga0070679_100084210 3300005530 Bacteria 3168
40 Ga0070679_100185968 3300005530 Bacteria 2048
41 Ga0070679_100486465 3300005530 Bacteria 1178
42 Ga0070684_100106639 3300005535 Bacteria 2509
43 Ga0068853_100002661 3300005539 Bacteria 13465
44 Ga0068853_100051940 3300005539 Bacteria 3530
45 Ga0068853_100126529 3300005539 Bacteria 2283
46 Ga0068853_100267801 3300005539 Bacteria 1572
47 Ga0068853_100412886 3300005539 Bacteria 1265
48 Ga0070695_100001867 3300005545 Bacteria 11898
49 Ga0070695_100417322 3300005545 Bacteria 1021
50 Ga0070693_100561209 3300005547 Bacteria 819
51 Ga0070693_100800145 3300005547 Bacteria 699
52 Ga0070665_100002451 3300005548 Bacteria 20457
53 Ga0070665_100032429 3300005548 Bacteria 5257
54 Ga0070665_100037121 3300005548 Bacteria 4900
55 Ga0070665_100270196 3300005548 Bacteria 1702
56 Ga0070665_100406409 3300005548 Bacteria 1370
57 Ga0068855_100003403 3300005563 Bacteria 19479
58 Ga0068855_100044193 3300005563 Bacteria 5273
59 Ga0068855_100350659 3300005563 Bacteria 1626
60 Ga0068855_100599834 3300005563 Bacteria 1188
61 Ga0068855_100973124 3300005563 Bacteria 893
62 Ga0068857_100018013 3300005577 Bacteria 6195
63 Ga0068857_100340923 3300005577 Bacteria 1386
64 Ga0068854_100452350 3300005578 Bacteria 1073
65 Ga0068856_100000324 3300005614 Bacteria 52557
66 Ga0068856_100011811 3300005614 Bacteria 8465
67 Ga0068856_100129623 3300005614 Bacteria 2526
68 Ga0068856_100166042 3300005614 Bacteria 2219
69 Ga0068856_100441425 3300005614 Bacteria 1322
70 Ga0068856_100463568 3300005614 Bacteria 1288
71 Ga0068852_100203930 3300005616 Bacteria 1872
72 Ga0068852_100292054 3300005616 Unclassified 1575
73 Ga0068864_100093642 3300005618 Bacteria 2654
74 Ga0068864_100249382 3300005618 Bacteria 1648
75 Ga0068863_100014949 3300005841 Bacteria 7455
76 Ga0068863_100564900 3300005841 Bacteria 1124
77 Ga0068860_100172919 3300005843 Bacteria 2087
78 Ga0068862_100090910 3300005844 Bacteria 2658
79 Ga0070716_100240391 3300006173 Bacteria 1228
80 Ga0070712_100000014 3300006175 Bacteria 108668
81 Ga0070712_100006487 3300006175 Bacteria 7256
82 Ga0070712_100819793 3300006175 Bacteria 799
83 Ga0097621_100059380 3300006237 Bacteria 3131
84 Ga0097621_100221544 3300006237 Bacteria 1649
85 Ga0097621_100527251 3300006237 Bacteria 1073
86 Ga0068871_100041650 3300006358 Bacteria 3684
87 Ga0068871_100099636 3300006358 Bacteria 2433
88 Ga0068871_100768651 3300006358 Bacteria 886
89 Ga0068871_100877059 3300006358 Bacteria 831
90 Ga0075434_100063188 3300006871 Bacteria 3685
91 Ga0068865_100004256 3300006881 Bacteria 8632
92 Ga0068865_100067352 3300006881 Bacteria 2529
93 Ga0075436_100000047 3300006914 Bacteria 72907
94 Ga0075435_100038428 3300007076 Bacteria 3816
95 Ga0075435_100131534 3300007076 Bacteria 2094
96 Ga0105240_10000355 3300009093 Bacteria 86025
97 Ga0105240_10070285 3300009093 Bacteria 4331
98 Ga0105240_10106005 3300009093 Bacteria 3411
99 Ga0105240_10107472 3300009093 Bacteria 3382
100 Ga0105240_10202267 3300009093 Bacteria 2327
101 Ga0105240_10266644 3300009093 Bacteria 1973
102 Ga0105240_10335837 3300009093 Bacteria 1718
103 Ga0105240_10359896 3300009093 Bacteria 1649
104 Ga0105240_10800187 3300009093 Bacteria 1021
105 Ga0105240_11530632 3300009093 Bacteria 699
106 Ga0105245_10015475 3300009098 Bacteria 6651
107 Ga0105245_10342868 3300009098 Bacteria 1478
108 Ga0105245_12716642 3300009098 Bacteria 548
109 Ga0105247_10012844 3300009101 Bacteria 5026
110 Ga0105247_10247391 3300009101 Bacteria 1217
111 Ga0105243_11067023 3300009148 Bacteria 814
112 Ga0105241_10020313 3300009174 Bacteria 4908
113 Ga0105241_10023450 3300009174 Bacteria 4577
114 Ga0105241_10887437 3300009174 Bacteria 827
115 Ga0105242_10357032 3300009176 Bacteria 1352
116 Ga0105242_11192801 3300009176 Bacteria 780
117 Ga0105248_10000001 3300009177 Bacteria 1881304
118 Ga0105248_10307484 3300009177 Bacteria 1785
119 Ga0105248_11052145 3300009177 Bacteria 920
120 Ga0105248_12830322 3300009177 Bacteria 553
121 Ga0105237_10005340 3300009545 Bacteria 14538
122 Ga0105237_10022042 3300009545 Bacteria 6538
123 Ga0105237_10106817 3300009545 Bacteria 2791
124 Ga0105237_10623082 3300009545 Bacteria 1086
125 Ga0105237_10849293 3300009545 Bacteria 920
126 Ga0105238_10069257 3300009551 Bacteria 3529
127 Ga0105238_10084922 3300009551 Bacteria 3155
128 Ga0105238_10123753 3300009551 Bacteria 2565
129 Ga0105239_10001057 3300010375 Bacteria 38270
130 Ga0105239_10006571 3300010375 Bacteria 13469
131 Ga0105239_10017199 3300010375 Bacteria 7994
132 Ga0105239_10020157 3300010375 Bacteria 7356
133 Ga0105239_10252675 3300010375 Bacteria 1980
134 Ga0105239_10817019 3300010375 Bacteria 1068
135 Ga0105239_10931588 3300010375 Bacteria 997
136 Ga0157373_10006397 3300013100 Bacteria 8798
137 Ga0157370_10000280 3300013104 Bacteria 64677
138 Ga0157370_10056413 3300013104 Bacteria 3739
139 Ga0157370_10985497 3300013104 Bacteria 763
140 Ga0157369_10003041 3300013105 Bacteria 20018
141 Ga0157369_10017644 3300013105 Bacteria 8020
142 Ga0157369_10023831 3300013105 Bacteria 6814
143 Ga0157369_10085747 3300013105 Bacteria 3365
144 Ga0157369_10827376 3300013105 Bacteria 951
145 Ga0157374_10044703 3300013296 Bacteria 4094
146 Ga0157374_11087418 3300013296 Bacteria 820
147 Ga0163162_10034001 3300013306 Bacteria 5070
148 Ga0163162_10168493 3300013306 Bacteria 2314
149 Ga0163162_10277098 3300013306 Unclassified 1809
150 Ga0157372_10010958 3300013307 Bacteria 9649
151 Ga0157372_10053956 3300013307 Bacteria 4482
152 Ga0157372_10352527 3300013307 Bacteria 1714
153 Ga0157372_11298769 3300013307 Bacteria 840
154 Ga0157375_10107987 3300013308 Bacteria 2877
155 Ga0163163_10000012 3300014325 Bacteria 257369
156 Ga0163163_10233286 3300014325 Bacteria 1889
157 Ga0163163_10615921 3300014325 Bacteria 1149
158 Ga0157380_10154212 3300014326 Bacteria 1989
159 Ga0157379_10003319 3300014968 Bacteria 13629
160 Ga0157379_10006401 3300014968 Bacteria 10142
161 Ga0157379_10016921 3300014968 Bacteria 6417
162 Ga0157379_11326752 3300014968 Unclassified 695
163 Ga0157376_10047243 3300014969 Unclassified 3553
164 Ga0157376_10908698 3300014969 Bacteria 899
165 Ga0163161_10072881 3300017792 Unclassified 2515
166 Ga0209233_1000006 3300025261 Bacteria 1473685
167 Ga0209455_1031713 3300025272 Bacteria 884
168 Ga0209758_1000008 3300025297 Bacteria 1215263
169 Ga0207656_10087211 3300025321 Bacteria 1411
170 Ga0207656_10306404 3300025321 Bacteria 787
171 Ga0207682_10302327 3300025893 Bacteria 750
172 Ga0207642_10042800 3300025899 Bacteria 1993
173 Ga0207710_10013129 3300025900 Bacteria 3489
174 Ga0207680_10093835 3300025903 Bacteria 1915
175 Ga0207647_10153845 3300025904 Bacteria 1343
176 Ga0207699_10002659 3300025906 Bacteria 8437
177 Ga0207643_10054904 3300025908 Bacteria 2265
178 Ga0207705_10006878 3300025909 Bacteria 8407
179 Ga0207705_10338524 3300025909 Bacteria 1158
180 Ga0207705_10377207 3300025909 Bacteria 1095
181 Ga0207705_10525496 3300025909 Bacteria 919
182 Ga0207705_11038643 3300025909 Bacteria 632
183 Ga0207654_10018924 3300025911 Bacteria 3623
184 Ga0207654_10074310 3300025911 Bacteria 2028
185 Ga0207654_10085862 3300025911 Bacteria 1906
186 Ga0207654_10103822 3300025911 Bacteria 1756
187 Ga0207654_10197576 3300025911 Bacteria 1322
188 Ga0207654_10217069 3300025911 Bacteria 1266
189 Ga0207654_10415096 3300025911 Bacteria 938
190 Ga0207707_10000002 3300025912 Bacteria 1142054
191 Ga0207707_10134541 3300025912 Bacteria 2161
192 Ga0207707_10490914 3300025912 Bacteria 1048
193 Ga0207695_10002894 3300025913 Bacteria 24873
194 Ga0207695_10005924 3300025913 Bacteria 16020
195 Ga0207695_10006894 3300025913 Bacteria 14614
196 Ga0207695_10029731 3300025913 Bacteria 6029
197 Ga0207695_10043072 3300025913 Bacteria 4814
198 Ga0207695_10081411 3300025913 Bacteria 3276
199 Ga0207695_10083200 3300025913 Bacteria 3233
200 Ga0207695_10176231 3300025913 Bacteria 2061
201 Ga0207695_10228886 3300025913 Bacteria 1764
202 Ga0207671_10010766 3300025914 Bacteria 7510
203 Ga0207671_10075170 3300025914 Bacteria 2526
204 Ga0207671_10099310 3300025914 Bacteria 2203
205 Ga0207671_10173351 3300025914 Bacteria 1676
206 Ga0207671_10380355 3300025914 Bacteria 1122
207 Ga0207671_10393440 3300025914 Bacteria 1102
208 Ga0207693_10001808 3300025915 Bacteria 18752
209 Ga0207693_10082686 3300025915 Bacteria 2515
210 Ga0207663_10003432 3300025916 Bacteria 7758
211 Ga0207663_10473129 3300025916 Bacteria 969
212 Ga0207660_10012316 3300025917 Bacteria 5593
213 Ga0207660_10123799 3300025917 Bacteria 1961
214 Ga0207657_10045169 3300025919 Bacteria 3868
215 Ga0207649_10082871 3300025920 Bacteria 2080
216 Ga0207649_10123402 3300025920 Bacteria 1749
217 Ga0207649_10959613 3300025920 Bacteria 672
218 Ga0207652_10000505 3300025921 Bacteria 39729
219 Ga0207652_10073741 3300025921 Bacteria 2970
220 Ga0207652_10128433 3300025921 Bacteria 2259
221 Ga0207694_10034227 3300025924 Bacteria 3895
222 Ga0207694_10058716 3300025924 Bacteria 2992
223 Ga0207694_10108851 3300025924 Bacteria 2202
224 Ga0207694_10172556 3300025924 Bacteria 1751
225 Ga0207650_10121551 3300025925 Bacteria 2034
226 Ga0207659_10057262 3300025926 Bacteria 2794
227 Ga0207687_10055378 3300025927 Bacteria 2779
228 Ga0207687_10083729 3300025927 Bacteria 2310
229 Ga0207687_10322184 3300025927 Bacteria 1251
230 Ga0207700_10000005 3300025928 Bacteria 394836
231 Ga0207700_10092783 3300025928 Bacteria 2388
232 Ga0207700_10342671 3300025928 Bacteria 1300
233 Ga0207700_10657682 3300025928 Bacteria 934
234 Ga0207700_10865288 3300025928 Bacteria 809
235 Ga0207664_10005058 3300025929 Bacteria 8978
236 Ga0207664_10019354 3300025929 Bacteria 5030
237 Ga0207664_10457356 3300025929 Bacteria 1140
238 Ga0207664_10906001 3300025929 Bacteria 792
239 Ga0207686_10055672 3300025934 Bacteria 2483
240 Ga0207686_10064909 3300025934 Bacteria 2326
241 Ga0207670_10213921 3300025936 Bacteria 1472
242 Ga0207704_10107182 3300025938 Bacteria 1879
243 Ga0207704_10127682 3300025938 Unclassified 1754
244 Ga0207665_10190276 3300025939 Bacteria 1490
245 Ga0207691_10137580 3300025940 Bacteria 2154
246 Ga0207691_10591196 3300025940 Bacteria 940
247 Ga0207711_10000001 3300025941 Bacteria 1325674
248 Ga0207711_10007394 3300025941 Bacteria 9190
249 Ga0207689_10380798 3300025942 Bacteria 1175
250 Ga0207689_10484941 3300025942 Bacteria 1035
251 Ga0207661_10022224 3300025944 Bacteria 4772
252 Ga0207661_10161221 3300025944 Bacteria 1946
253 Ga0207661_10447730 3300025944 Bacteria 1176
254 Ga0207667_10002638 3300025949 Bacteria 22170
255 Ga0207667_10013610 3300025949 Bacteria 9299
256 Ga0207667_10291968 3300025949 Bacteria 1666
257 Ga0207667_10324439 3300025949 Bacteria 1572
258 Ga0207667_10345664 3300025949 Bacteria 1517
259 Ga0207667_10621922 3300025949 Bacteria 1087
260 Ga0207667_10812031 3300025949 Bacteria 931
261 Ga0207651_10148271 3300025960 Bacteria 1822
262 Ga0207712_10886995 3300025961 Bacteria 788
263 Ga0207640_10100272 3300025981 Bacteria 2029
264 Ga0207640_10221218 3300025981 Bacteria 1450
265 Ga0207640_10311411 3300025981 Bacteria 1250
266 Ga0207677_10393652 3300026023 Bacteria 1173
267 Ga0207677_10407435 3300026023 Bacteria 1155
268 Ga0207703_10004691 3300026035 Bacteria 11162
269 Ga0207639_10000177 3300026041 Bacteria 49899
270 Ga0207639_10051967 3300026041 Bacteria 3120
271 Ga0207639_10091289 3300026041 Bacteria 2438
272 Ga0207639_10111022 3300026041 Bacteria 2234
273 Ga0207639_10296858 3300026041 Bacteria 1427
274 Ga0207639_10377580 3300026041 Bacteria 1272
275 Ga0207639_10405199 3300026041 Bacteria 1229
276 Ga0207639_10753091 3300026041 Bacteria 906
277 Ga0207639_11456908 3300026041 Bacteria 643
278 Ga0207678_10409795 3300026067 Bacteria 1174
279 Ga0207702_10000173 3300026078 Bacteria 77458
280 Ga0207702_10001957 3300026078 Bacteria 20052
281 Ga0207702_10063041 3300026078 Bacteria 3169
282 Ga0207702_10136329 3300026078 Bacteria 2215
283 Ga0207702_11089609 3300026078 Bacteria 793
284 Ga0207641_10545362 3300026088 Bacteria 1130
285 Ga0207648_10002710 3300026089 Bacteria 18821
286 Ga0207648_10004158 3300026089 Bacteria 14970
287 Ga0207648_10609893 3300026089 Bacteria 1006
288 Ga0207648_11425880 3300026089 Bacteria 651
289 Ga0207676_10110609 3300026095 Bacteria 2298
290 Ga0207674_10000112 3300026116 Bacteria 94220
291 Ga0207683_10012382 3300026121 Bacteria 7279
292 Ga0207683_10085041 3300026121 Bacteria 2812
293 Ga0207698_10017098 3300026142 Unclassified 4911
294 Ga0207698_10102985 3300026142 Bacteria 2371
295 Ga0207698_10306776 3300026142 Bacteria 1480
296 Ga0207698_10679454 3300026142 Bacteria 1023
297 Ga0268266_10000463 3300028379 Bacteria 59089
298 Ga0268266_10028386 3300028379 Bacteria 4757
299 Ga0268266_10051941 3300028379 Bacteria 3519
300 Ga0268266_10226067 3300028379 Bacteria 1722
301 Ga0268266_10830101 3300028379 Bacteria 893
302 Ga0268265_10095776 3300028380 Bacteria 2384
303 Ga0268265_12359601 3300028380 Bacteria 538
304 Ga0268264_10092261 3300028381 Bacteria 2614
305 Ga0268264_11011090 3300028381 Bacteria 838
306 Ga0265318_10020432 3300028577 Bacteria 2673
307 Ga0265318_10173886 3300028577 Bacteria 789
308 Ga0265338_10000649 3300028800 Bacteria 60084
309 Ga0265338_10025110 3300028800 Bacteria 6062
310 Ga0265338_10042395 3300028800 Bacteria 4238
311 Ga0265338_10101580 3300028800 Bacteria 2341
312 Ga0265338_10107996 3300028800 Bacteria 2249
313 Ga0265330_10021948 3300031235 Bacteria 2909
314 Ga0265330_10076589 3300031235 Bacteria 1444
315 Ga0265330_10123028 3300031235 Bacteria 1105
316 Ga0265330_10182896 3300031235 Bacteria 888
317 Ga0265330_10248317 3300031235 Bacteria 750
318 Ga0265330_10351148 3300031235 Unclassified 623
319 Ga0265332_10028452 3300031238 Bacteria 2446
320 Ga0265332_10036942 3300031238 Bacteria 2120
321 Ga0265332_10048166 3300031238 Bacteria 1834
322 Ga0265332_10193705 3300031238 Bacteria 845
323 Ga0265332_10333762 3300031238 Bacteria 626
324 Ga0265320_10228807 3300031240 Bacteria 827
325 Ga0265320_10233401 3300031240 Bacteria 818
326 Ga0265325_10000118 3300031241 Bacteria 54374
327 Ga0265325_10026364 3300031241 Bacteria 3148
328 Ga0265325_10087782 3300031241 Bacteria 1537
329 Ga0265325_10207150 3300031241 Bacteria 902
330 Ga0265340_10004919 3300031247 Bacteria 7430
331 Ga0265340_10014528 3300031247 Bacteria 4110
332 Ga0265339_10006488 3300031249 Bacteria 7671
333 Ga0265339_10007455 3300031249 Bacteria 7069
334 Ga0265339_10032724 3300031249 Bacteria 2932
335 Ga0265331_10008800 3300031250 Bacteria 5717
336 Ga0265331_10102867 3300031250 Bacteria 1313
337 Ga0265316_10089652 3300031344 Bacteria 2346
338 Ga0265316_10104106 3300031344 Bacteria 2154
339 Ga0265316_10148198 3300031344 Bacteria 1759
340 Ga0265316_10163518 3300031344 Bacteria 1663
341 Ga0265316_10176209 3300031344 Bacteria 1593
342 Ga0265313_10002149 3300031595 Bacteria 17538
343 Ga0265313_10067381 3300031595 Bacteria 1656
344 Ga0265313_10315098 3300031595 Bacteria 626
345 Ga0265314_10016220 3300031711 Bacteria 5896
346 Ga0265314_10022799 3300031711 Bacteria 4791
347 Ga0265314_10029548 3300031711 Bacteria 4071
348 Ga0265314_10050575 3300031711 Bacteria 2901
349 Ga0265314_10054187 3300031711 Bacteria 2777
350 Ga0265314_10072550 3300031711 Bacteria 2299
351 Ga0265314_10176936 3300031711 Bacteria 1282
352 Ga0265342_10100494 3300031712 Bacteria 1648
353 Ga0265342_10159100 3300031712 Bacteria 1249
354 Ga0307516_10028137 3300031730 Bacteria 5691
355 Ga0373926_0201779 3300035083 Bacteria 765
356 Ga0373932_0033289 3300035112 Bacteria 1446
357 Ga0373943_0252068 3300035170 Bacteria 991
358 Ga0373931_0064534 3300035691 Bacteria 1982
359 Ga0373931_0068585 3300035691 Bacteria 1931
360 Ga0373931_0436211 3300035691 Bacteria 835
361 Ga0373935_0294390 3300035692 Bacteria 1146
362 Ga0373935_0338874 3300035692 Bacteria 1070
363 Ga0373927_0156825 3300035695 Bacteria 1491
364 Ga0373927_0441764 3300035695 Bacteria 859
365 Ga0373937_0000718 3300036401 Bacteria 28861
366 Ga0373937_0362897 3300036401 Bacteria 1373
367 Ga0373925_0049971 3300037068 Bacteria 3118
368 Ga0395900_0020747 3300037418 Bacteria 6716
369 Ga0395900_0422855 3300037418 Bacteria 1293
370 Ga0395898_0026449 3300037466 Bacteria 5837
371 Ga0395898_0028738 3300037466 Bacteria 5572
372 Ga0395901_0006983 3300038443 Bacteria 11411
373 Ga0395901_0258884 3300038443 Bacteria 1811
374 Ga0436365_0412683 3300039437 Bacteria 137628
375 Ga0436365_0756597 3300039437 Bacteria 13478
376 Ga0436365_0795057 3300039437 Bacteria 592
377 Ga0436360_0138325 3300039438 Bacteria 1355
378 Ga0436360_0736524 3300039438 Bacteria 1126
379 Ga0436363_0947660 3300039450 Bacteria 667
380 Ga0451789_0025799 3300041443 Bacteria 584
381 Ga0451807_1118758 3300041486 Bacteria 662
382 Ga0451839_1107899 3300041496 Bacteria 630
383 Ga0451577_0346840 3300042876 Unclassified 1347
384 Ga0466971_0450817 3300044719 Bacteria 631
385 Ga0466957_0231450 3300044842 Bacteria 1223
386 Ga0495608_0254680 3300046511 Bacteria 1094
387 Ga0495652_0175691 3300046529 Bacteria 1649
388 Ga0495645_0097545 3300046543 Unclassified 2093
389 Ga0495622_0005015 3300046557 Bacteria 6135
390 Ga0495611_0057480 3300046648 Bacteria 1763
391 Ga0495657_0108857 3300046675 Bacteria 1758
392 Ga0495599_0043524 3300046678 Bacteria 2818
393 Ga0495600_0678393 3300046809 Bacteria 621
394 Ga0495604_0379618 3300047317 Bacteria 934
395 Ga0495672_0180582 3300047320 Bacteria 1069
396 Ga0495681_0067520 3300047470 Bacteria 1629
397 Ga0496101_0925960 3300048904 Bacteria 686
398 Ga0496102_0079458 3300048905 Bacteria 3021
399 Ga0496106_0319118 3300048909 Bacteria 1247
400 Ga0496106_0696862 3300048909 Unclassified 810
401 Ga0496107_0674734 3300048910 Bacteria 761
402 Ga0496110_0873247 3300048913 Unclassified 805
403 Ga0496111_0209887 3300048914 Bacteria 1447
404 Ga0496121_0001374 3300048924 Bacteria 41288
405 Ga0496126_0055539 3300048929 Bacteria 3583
406 Ga0496126_0104617 3300048929 Bacteria 2473
407 Ga0495682_0159016 3300049460 Bacteria 805
408 Ga0501031_0005444 3300049568 Bacteria 8288
409 Ga0501031_0078158 3300049568 Bacteria 2156
410 Ga0501031_0289476 3300049568 Bacteria 1062
411 Ga0501032_0058487 3300049569 Bacteria 2588
412 Ga0501032_0097502 3300049569 Bacteria 1948
413 Ga0501032_0430144 3300049569 Bacteria 847
414 Ga0501033_0022454 3300049570 Bacteria 4760
415 Ga0501033_0025572 3300049570 Bacteria 4448
416 Ga0501033_0122185 3300049570 Bacteria 1889
417 Ga0501033_0433562 3300049570 Bacteria 914
418 Ga0501033_0634340 3300049570 Bacteria 731
419 Ga0501034_0007300 3300049571 Bacteria 11783
420 Ga0501034_0014188 3300049571 Bacteria 8213
421 Ga0501034_0045399 3300049571 Bacteria 4440
422 Ga0501034_0070233 3300049571 Bacteria 3514
423 Ga0501034_0114672 3300049571 Bacteria 2683
424 Ga0501034_0224299 3300049571 Bacteria 1831
425 Ga0501036_0000558 3300049572 Bacteria 26755
426 Ga0501036_0014512 3300049572 Bacteria 6563
427 Ga0501036_0101111 3300049572 Bacteria 2439
428 Ga0501036_0139977 3300049572 Bacteria 2042
429 Ga0501037_0004950 3300049573 Bacteria 9687
430 Ga0501037_0015524 3300049573 Bacteria 5605
431 Ga0501037_0042538 3300049573 Bacteria 3338
432 Ga0501037_0650188 3300049573 Bacteria 705
433 Ga0501038_0016521 3300049574 Bacteria 6690
434 Ga0501038_0024321 3300049574 Bacteria 5405
435 Ga0501038_0071389 3300049574 Bacteria 2945
436 Ga0501038_0154418 3300049574 Bacteria 1870
437 Ga0501038_0195944 3300049574 Bacteria 1624
438 Ga0501039_0018130 3300049575 Bacteria 5402
439 Ga0501040_0179597 3300049576 Bacteria 1500
440 Ga0501042_0041796 3300049578 Bacteria 3261
441 Ga0501043_0014171 3300049579 Bacteria 6237
442 Ga0501043_0027321 3300049579 Bacteria 4481
443 Ga0501043_0030978 3300049579 Bacteria 4206
444 Ga0501043_0064808 3300049579 Bacteria 2869
445 Ga0501043_0111009 3300049579 Bacteria 2153
446 Ga0501043_0364648 3300049579 Bacteria 1096
447 Ga0501046_0002604 3300049580 Bacteria 16849
448 Ga0501046_0002663 3300049580 Bacteria 16652
449 Ga0501046_0037462 3300049580 Bacteria 3897
450 Ga0501046_0060433 3300049580 Bacteria 2965
451 Ga0501046_0943620 3300049580 Bacteria 600
452 Ga0501047_0007737 3300049581 Bacteria 10118
453 Ga0501047_0010417 3300049581 Bacteria 8796
454 Ga0501047_0013962 3300049581 Bacteria 7633
455 Ga0501047_0018085 3300049581 Bacteria 6754
456 Ga0501047_0066185 3300049581 Bacteria 3483
457 Ga0501047_0127743 3300049581 Bacteria 2422
458 Ga0501047_0576872 3300049581 Bacteria 948
459 Ga0501048_0001789 3300049582 Bacteria 16336
460 Ga0501048_0033129 3300049582 Bacteria 3734
461 Ga0501067_0004055 3300049583 Bacteria 8078
462 Ga0501067_0042667 3300049583 Bacteria 2518
463 Ga0501067_0614261 3300049583 Bacteria 610
464 Ga0501068_0009446 3300049584 Bacteria 5459
465 Ga0501068_0479124 3300049584 Bacteria 806
466 Ga0501069_0004628 3300049585 Bacteria 7118
467 Ga0501069_0005812 3300049585 Bacteria 6423
468 Ga0501070_0003030 3300049586 Bacteria 14629
469 Ga0501070_0117328 3300049586 Bacteria 2198
470 Ga0501072_0064417 3300049588 Bacteria 2890
471 Ga0501073_0007843 3300049589 Bacteria 7925
472 Ga0501073_0010669 3300049589 Bacteria 6727
473 Ga0501073_0030051 3300049589 Bacteria 3881
474 Ga0501073_0106868 3300049589 Bacteria 1942
475 Ga0501074_0001185 3300049590 Bacteria 17126
476 Ga0501074_0049193 3300049590 Bacteria 3043
477 Ga0501079_0003589 3300049741 Bacteria 11407
478 Ga0501079_0005218 3300049741 Bacteria 9652
479 Ga0501080_0021202 3300049742 Bacteria 6013
480 Ga0501080_0172012 3300049742 Bacteria 1997
481 Ga0501080_0291497 3300049742 Bacteria 1482
482 Ga0501083_0009000 3300049744 Bacteria 7047
483 Ga0501083_0132593 3300049744 Bacteria 1633
484 Ga0501083_0132664 3300049744 Bacteria 1633
485 Ga0501035_0004255 3300049822 Bacteria 13585
486 Ga0501035_0027400 3300049822 Bacteria 5208
487 Ga0501035_0032219 3300049822 Bacteria 4770
488 Ga0501035_0061541 3300049822 Bacteria 3341
489 Ga0501035_0130572 3300049822 Bacteria 2190
490 Ga0501035_0510977 3300049822 Bacteria 988
491 Ga0501044_0002694 3300049823 Bacteria 20192
492 Ga0501044_0019396 3300049823 Bacteria 7276
493 Ga0501044_0020825 3300049823 Bacteria 7000
494 Ga0501044_0045119 3300049823 Bacteria 4570
495 Ga0501044_0059095 3300049823 Bacteria 3930
496 Ga0501044_0118644 3300049823 Bacteria 2648
497 Ga0501044_0295927 3300049823 Bacteria 1549
498 Ga0501044_0650274 3300049823 Bacteria 943
499 Ga0501044_0692107 3300049823 Bacteria 905
500 Ga0501044_0728233 3300049823 Bacteria 875
501 Ga0501045_0067708 3300049824 Bacteria 2623
502 nmdc:mga0n895_95957_c1 3300050512 Bacteria 2970
503 nmdc:mga0rr50_158750_c1 3300050513 Bacteria 1834
504 nmdc:mga0rr50_24751_c1 3300050513 Bacteria 4163
505 nmdc:mga08x19_119546_c1 3300050514 Bacteria 1765
506 nmdc:mga08x19_62_c1 3300050514 Bacteria 114601
507 Ga0495601_0286548 3300053077 Bacteria 1074
508 Ga0500643_000027 3300053087 Bacteria 251062
509 Ga0500646_0024524 3300053090 Bacteria 1624
510 Ga0500650_0442624 3300053098 Bacteria 558
511 Ga0500555_028111 3300053103 Bacteria 1603
512 Ga0500595_001613 3300053119 Bacteria 11882
513 Ga0500595_002881 3300053119 Bacteria 8246
514 Ga0500595_061104 3300053119 Bacteria 1138
515 Ga0500614_236329 3300053123 Bacteria 568
516 Ga0500655_003054 3300053133 Bacteria 3037
517 Ga0500559_0021837 3300053136 Bacteria 2715
518 Ga0500559_0033420 3300053136 Bacteria 2214
519 Ga0500559_0160260 3300053136 Bacteria 1057
520 Ga0500568_0337175 3300053139 Bacteria 547
521 Ga0500573_0000032 3300053140 Bacteria 131098
522 Ga0500619_001906 3300053154 Unclassified 3864
523 Ga0500645_080719 3300053730 Bacteria 928
524 Ga0500587_004331 3300053739 Bacteria 1952
525 Ga0501084_0004252 3300054114 Bacteria 11649
526 Ga0501084_0035851 3300054114 Bacteria 4146
527 Ga0501082_0098901 3300060353 Bacteria 2522
528 Ga0501082_0681208 3300060353 Bacteria 900

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005841 Ga0068863_100014949 Ga0068863_1000149495 149
2 3300005331 Ga0070670_100245078 Ga0070670_1002450782 153
3 3300005456 Ga0070678_101276540 Ga0070678_1012765401 153
4 3300009098 Ga0105245_10015475 Ga0105245_100154752 153
5 3300009176 Ga0105242_11192801 Ga0105242_111928012 153
6 3300039437 Ga0436365_0756597 Ga0436365_0756597_3882_4355 153
7 3300003214 JGI25165J46597_1000035 JGI25165J46597_1000035246 154
8 3300003215 JGI25153J46596_10001230 JGI25153J46596_1000123012 154
9 3300005327 Ga0070658_10476598 Ga0070658_104765981 154
10 3300005327 Ga0070658_10631670 Ga0070658_106316702 154
11 3300005333 Ga0070677_10086048 Ga0070677_100860481 154
12 3300005334 Ga0068869_100539882 Ga0068869_1005398822 154
13 3300005334 Ga0068869_100904246 Ga0068869_1009042462 154
14 3300005336 Ga0070680_100461394 Ga0070680_1004613942 154
15 3300005337 Ga0070682_100642173 Ga0070682_1006421732 154
16 3300005338 Ga0068868_100610041 Ga0068868_1006100412 154
17 3300005339 Ga0070660_100110972 Ga0070660_1001109722 154
18 3300005344 Ga0070661_100010114 Ga0070661_1000101143 154
19 3300005344 Ga0070661_100496246 Ga0070661_1004962461 154
20 3300005344 Ga0070661_100802057 Ga0070661_1008020571 154
21 3300005356 Ga0070674_100688561 Ga0070674_1006885611 154
22 3300005356 Ga0070674_100719895 Ga0070674_1007198952 154
23 3300005367 Ga0070667_100128627 Ga0070667_1001286273 154
24 3300005434 Ga0070709_10003569 Ga0070709_100035696 154
25 3300005434 Ga0070709_10077723 Ga0070709_100777232 154
26 3300005435 Ga0070714_100042367 Ga0070714_1000423675 154
27 3300005435 Ga0070714_100259178 Ga0070714_1002591782 154
28 3300005435 Ga0070714_100751218 Ga0070714_1007512182 154
29 3300005436 Ga0070713_100000011 Ga0070713_100000011115 154
30 3300005436 Ga0070713_100325451 Ga0070713_1003254512 154
31 3300005439 Ga0070711_100047094 Ga0070711_1000470942 154
32 3300005439 Ga0070711_100330474 Ga0070711_1003304742 154
33 3300005455 Ga0070663_100152829 Ga0070663_1001528292 154
34 3300005455 Ga0070663_100634136 Ga0070663_1006341362 154
35 3300005456 Ga0070678_100009857 Ga0070678_1000098574 154
36 3300005458 Ga0070681_10000002 Ga0070681_10000002575 154
37 3300005458 Ga0070681_10083094 Ga0070681_100830942 154
38 3300005458 Ga0070681_10227245 Ga0070681_102272452 154
39 3300005459 Ga0068867_100362411 Ga0068867_1003624112 154
40 3300005459 Ga0068867_101343761 Ga0068867_1013437611 154
41 3300005518 Ga0070699_100823059 Ga0070699_1008230592 154
42 3300005530 Ga0070679_100000035 Ga0070679_10000003510 154
43 3300005530 Ga0070679_100084210 Ga0070679_1000842102 154
44 3300005530 Ga0070679_100185968 Ga0070679_1001859682 154
45 3300005530 Ga0070679_100486465 Ga0070679_1004864652 154
46 3300005535 Ga0070684_100106639 Ga0070684_1001066393 154
47 3300005539 Ga0068853_100002661 Ga0068853_1000026618 154
48 3300005539 Ga0068853_100051940 Ga0068853_1000519403 154
49 3300005539 Ga0068853_100126529 Ga0068853_1001265292 154
50 3300005539 Ga0068853_100267801 Ga0068853_1002678012 154
51 3300005539 Ga0068853_100412886 Ga0068853_1004128862 154
52 3300005545 Ga0070695_100001867 Ga0070695_1000018677 154
53 3300005545 Ga0070695_100417322 Ga0070695_1004173222 154
54 3300005547 Ga0070693_100561209 Ga0070693_1005612091 154
55 3300005547 Ga0070693_100800145 Ga0070693_1008001451 154
56 3300005548 Ga0070665_100002451 Ga0070665_1000024514 154
57 3300005548 Ga0070665_100032429 Ga0070665_1000324293 154
58 3300005548 Ga0070665_100037121 Ga0070665_1000371213 154
59 3300005548 Ga0070665_100270196 Ga0070665_1002701962 154
60 3300005548 Ga0070665_100406409 Ga0070665_1004064092 154
61 3300005563 Ga0068855_100003403 Ga0068855_1000034036 154
62 3300005563 Ga0068855_100044193 Ga0068855_1000441933 154
63 3300005563 Ga0068855_100350659 Ga0068855_1003506592 154
64 3300005563 Ga0068855_100599834 Ga0068855_1005998341 154
65 3300005563 Ga0068855_100973124 Ga0068855_1009731242 154
66 3300005577 Ga0068857_100018013 Ga0068857_1000180135 154
67 3300005577 Ga0068857_100340923 Ga0068857_1003409232 154
68 3300005578 Ga0068854_100452350 Ga0068854_1004523502 154
69 3300005614 Ga0068856_100000324 Ga0068856_10000032413 154
70 3300005614 Ga0068856_100011811 Ga0068856_1000118117 154
71 3300005614 Ga0068856_100129623 Ga0068856_1001296232 154
72 3300005614 Ga0068856_100166042 Ga0068856_1001660423 154
73 3300005614 Ga0068856_100441425 Ga0068856_1004414251 154
74 3300005614 Ga0068856_100463568 Ga0068856_1004635682 154
75 3300005616 Ga0068852_100203930 Ga0068852_1002039302 154
76 3300005616 Ga0068852_100292054 Ga0068852_1002920542 154
77 3300005618 Ga0068864_100093642 Ga0068864_1000936423 154
78 3300005618 Ga0068864_100249382 Ga0068864_1002493822 154
79 3300005841 Ga0068863_100564900 Ga0068863_1005649002 154
80 3300005843 Ga0068860_100172919 Ga0068860_1001729193 154
81 3300005844 Ga0068862_100090910 Ga0068862_1000909103 154
82 3300006173 Ga0070716_100240391 Ga0070716_1002403912 154
83 3300006175 Ga0070712_100000014 Ga0070712_10000001447 154
84 3300006175 Ga0070712_100006487 Ga0070712_1000064875 154
85 3300006175 Ga0070712_100819793 Ga0070712_1008197932 154
86 3300006237 Ga0097621_100059380 Ga0097621_1000593802 154
87 3300006237 Ga0097621_100221544 Ga0097621_1002215442 154
88 3300006237 Ga0097621_100527251 Ga0097621_1005272512 154
89 3300006358 Ga0068871_100041650 Ga0068871_1000416503 154
90 3300006358 Ga0068871_100099636 Ga0068871_1000996363 154
91 3300006358 Ga0068871_100768651 Ga0068871_1007686512 154
92 3300006358 Ga0068871_100877059 Ga0068871_1008770592 154
93 3300006871 Ga0075434_100063188 Ga0075434_1000631886 154
94 3300006881 Ga0068865_100004256 Ga0068865_1000042563 154
95 3300006881 Ga0068865_100067352 Ga0068865_1000673522 154
96 3300006914 Ga0075436_100000047 Ga0075436_10000004782 154
97 3300007076 Ga0075435_100038428 Ga0075435_1000384284 154
98 3300007076 Ga0075435_100131534 Ga0075435_1001315342 154
99 3300009093 Ga0105240_10000355 Ga0105240_1000035573 154
100 3300009093 Ga0105240_10070285 Ga0105240_100702852 154
101 3300009093 Ga0105240_10106005 Ga0105240_101060053 154
102 3300009093 Ga0105240_10107472 Ga0105240_101074722 154
103 3300009093 Ga0105240_10202267 Ga0105240_102022673 154
104 3300009093 Ga0105240_10266644 Ga0105240_102666442 154
105 3300009093 Ga0105240_10335837 Ga0105240_103358372 154
106 3300009093 Ga0105240_10359896 Ga0105240_103598962 154
107 3300009093 Ga0105240_10800187 Ga0105240_108001872 154
108 3300009093 Ga0105240_11530632 Ga0105240_115306322 154
109 3300009098 Ga0105245_10342868 Ga0105245_103428681 154
110 3300009098 Ga0105245_12716642 Ga0105245_127166421 154
111 3300009101 Ga0105247_10012844 Ga0105247_100128444 154
112 3300009101 Ga0105247_10247391 Ga0105247_102473912 154
113 3300009148 Ga0105243_11067023 Ga0105243_110670231 154
114 3300009174 Ga0105241_10020313 Ga0105241_100203133 154
115 3300009174 Ga0105241_10023450 Ga0105241_100234504 154
116 3300009174 Ga0105241_10887437 Ga0105241_108874372 154
117 3300009176 Ga0105242_10357032 Ga0105242_103570321 154
118 3300009177 Ga0105248_10000001 Ga0105248_100000011742 154
119 3300009177 Ga0105248_10307484 Ga0105248_103074844 154
120 3300009177 Ga0105248_11052145 Ga0105248_110521452 154
121 3300009177 Ga0105248_12830322 Ga0105248_128303221 154
122 3300009545 Ga0105237_10005340 Ga0105237_1000534010 154
123 3300009545 Ga0105237_10022042 Ga0105237_100220424 154
124 3300009545 Ga0105237_10106817 Ga0105237_101068173 154
125 3300009545 Ga0105237_10623082 Ga0105237_106230821 154
126 3300009545 Ga0105237_10849293 Ga0105237_108492932 154
127 3300009551 Ga0105238_10069257 Ga0105238_100692573 154
128 3300009551 Ga0105238_10084922 Ga0105238_100849222 154
129 3300009551 Ga0105238_10123753 Ga0105238_101237534 154
130 3300010375 Ga0105239_10001057 Ga0105239_1000105740 154
131 3300010375 Ga0105239_10006571 Ga0105239_1000657110 154
132 3300010375 Ga0105239_10017199 Ga0105239_100171992 154
133 3300010375 Ga0105239_10020157 Ga0105239_100201573 154
134 3300010375 Ga0105239_10252675 Ga0105239_102526753 154
135 3300010375 Ga0105239_10817019 Ga0105239_108170192 154
136 3300010375 Ga0105239_10931588 Ga0105239_109315882 154
137 3300013100 Ga0157373_10006397 Ga0157373_100063974 154
138 3300013104 Ga0157370_10000280 Ga0157370_1000028050 154
139 3300013104 Ga0157370_10056413 Ga0157370_100564132 154
140 3300013104 Ga0157370_10985497 Ga0157370_109854971 154
141 3300013105 Ga0157369_10003041 Ga0157369_100030412 154
142 3300013105 Ga0157369_10017644 Ga0157369_100176443 154
143 3300013105 Ga0157369_10023831 Ga0157369_100238315 154
144 3300013105 Ga0157369_10085747 Ga0157369_100857472 154
145 3300013105 Ga0157369_10827376 Ga0157369_108273762 154
146 3300013296 Ga0157374_10044703 Ga0157374_100447032 154
147 3300013296 Ga0157374_11087418 Ga0157374_110874182 154
148 3300013306 Ga0163162_10034001 Ga0163162_100340014 154
149 3300013306 Ga0163162_10168493 Ga0163162_101684932 154
150 3300013306 Ga0163162_10277098 Ga0163162_102770982 154
151 3300013307 Ga0157372_10010958 Ga0157372_100109586 154
152 3300013307 Ga0157372_10053956 Ga0157372_100539564 154
153 3300013307 Ga0157372_10352527 Ga0157372_103525272 154
154 3300013307 Ga0157372_11298769 Ga0157372_112987692 154
155 3300013308 Ga0157375_10107987 Ga0157375_101079873 154
156 3300014325 Ga0163163_10000012 Ga0163163_10000012246 154
157 3300014325 Ga0163163_10233286 Ga0163163_102332863 154
158 3300014325 Ga0163163_10615921 Ga0163163_106159212 154
159 3300014326 Ga0157380_10154212 Ga0157380_101542122 154
160 3300014968 Ga0157379_10003319 Ga0157379_1000331911 154
161 3300014968 Ga0157379_10006401 Ga0157379_100064014 154
162 3300014968 Ga0157379_10016921 Ga0157379_100169219 154
163 3300014968 Ga0157379_11326752 Ga0157379_113267522 154
164 3300014969 Ga0157376_10047243 Ga0157376_100472433 154
165 3300014969 Ga0157376_10908698 Ga0157376_109086982 154
166 3300017792 Ga0163161_10072881 Ga0163161_100728812 154
167 3300025261 Ga0209233_1000006 Ga0209233_1000006741 154
168 3300025272 Ga0209455_1031713 Ga0209455_10317131 154
169 3300025297 Ga0209758_1000008 Ga0209758_1000008182 154
170 3300025321 Ga0207656_10087211 Ga0207656_100872112 154
171 3300025321 Ga0207656_10306404 Ga0207656_103064041 154
172 3300025893 Ga0207682_10302327 Ga0207682_103023271 154
173 3300025899 Ga0207642_10042800 Ga0207642_100428002 154
174 3300025900 Ga0207710_10013129 Ga0207710_100131292 154
175 3300025903 Ga0207680_10093835 Ga0207680_100938352 154
176 3300025904 Ga0207647_10153845 Ga0207647_101538451 154
177 3300025906 Ga0207699_10002659 Ga0207699_100026596 154
178 3300025908 Ga0207643_10054904 Ga0207643_100549043 154
179 3300025909 Ga0207705_10006878 Ga0207705_100068789 154
180 3300025909 Ga0207705_10338524 Ga0207705_103385242 154
181 3300025909 Ga0207705_10377207 Ga0207705_103772072 154
182 3300025909 Ga0207705_10525496 Ga0207705_105254962 154
183 3300025909 Ga0207705_11038643 Ga0207705_110386431 154
184 3300025911 Ga0207654_10018924 Ga0207654_100189244 154
185 3300025911 Ga0207654_10074310 Ga0207654_100743103 154
186 3300025911 Ga0207654_10085862 Ga0207654_100858622 154
187 3300025911 Ga0207654_10103822 Ga0207654_101038222 154
188 3300025911 Ga0207654_10197576 Ga0207654_101975762 154
189 3300025911 Ga0207654_10217069 Ga0207654_102170692 154
190 3300025911 Ga0207654_10415096 Ga0207654_104150962 154
191 3300025912 Ga0207707_10000002 Ga0207707_10000002383 154
192 3300025912 Ga0207707_10134541 Ga0207707_101345413 154
193 3300025912 Ga0207707_10490914 Ga0207707_104909142 154
194 3300025913 Ga0207695_10002894 Ga0207695_100028947 154
195 3300025913 Ga0207695_10005924 Ga0207695_100059247 154
196 3300025913 Ga0207695_10006894 Ga0207695_100068946 154
197 3300025913 Ga0207695_10029731 Ga0207695_100297313 154
198 3300025913 Ga0207695_10043072 Ga0207695_100430723 154
199 3300025913 Ga0207695_10081411 Ga0207695_100814113 154
200 3300025913 Ga0207695_10083200 Ga0207695_100832002 154
201 3300025913 Ga0207695_10176231 Ga0207695_101762313 154
202 3300025913 Ga0207695_10228886 Ga0207695_102288862 154
203 3300025914 Ga0207671_10010766 Ga0207671_100107666 154
204 3300025914 Ga0207671_10075170 Ga0207671_100751702 154
205 3300025914 Ga0207671_10099310 Ga0207671_100993102 154
206 3300025914 Ga0207671_10173351 Ga0207671_101733512 154
207 3300025914 Ga0207671_10380355 Ga0207671_103803552 154
208 3300025914 Ga0207671_10393440 Ga0207671_103934402 154
209 3300025915 Ga0207693_10001808 Ga0207693_1000180818 154
210 3300025915 Ga0207693_10082686 Ga0207693_100826864 154
211 3300025916 Ga0207663_10003432 Ga0207663_100034326 154
212 3300025916 Ga0207663_10473129 Ga0207663_104731292 154
213 3300025917 Ga0207660_10012316 Ga0207660_100123165 154
214 3300025917 Ga0207660_10123799 Ga0207660_101237992 154
215 3300025919 Ga0207657_10045169 Ga0207657_100451693 154
216 3300025920 Ga0207649_10082871 Ga0207649_100828712 154
217 3300025920 Ga0207649_10123402 Ga0207649_101234022 154
218 3300025920 Ga0207649_10959613 Ga0207649_109596131 154
219 3300025921 Ga0207652_10000505 Ga0207652_100005053 154
220 3300025921 Ga0207652_10073741 Ga0207652_100737414 154
221 3300025921 Ga0207652_10128433 Ga0207652_101284332 154
222 3300025924 Ga0207694_10034227 Ga0207694_100342273 154
223 3300025924 Ga0207694_10058716 Ga0207694_100587165 154
224 3300025924 Ga0207694_10108851 Ga0207694_101088514 154
225 3300025924 Ga0207694_10172556 Ga0207694_101725562 154
226 3300025925 Ga0207650_10121551 Ga0207650_101215512 154
227 3300025926 Ga0207659_10057262 Ga0207659_100572623 154
228 3300025927 Ga0207687_10055378 Ga0207687_100553782 154
229 3300025927 Ga0207687_10083729 Ga0207687_100837293 154
230 3300025927 Ga0207687_10322184 Ga0207687_103221842 154
231 3300025928 Ga0207700_10000005 Ga0207700_1000000580 154
232 3300025928 Ga0207700_10092783 Ga0207700_100927833 154
233 3300025928 Ga0207700_10342671 Ga0207700_103426712 154
234 3300025928 Ga0207700_10657682 Ga0207700_106576822 154
235 3300025928 Ga0207700_10865288 Ga0207700_108652881 154
236 3300025929 Ga0207664_10005058 Ga0207664_100050583 154
237 3300025929 Ga0207664_10019354 Ga0207664_100193546 154
238 3300025929 Ga0207664_10457356 Ga0207664_104573562 154
239 3300025929 Ga0207664_10906001 Ga0207664_109060012 154
240 3300025934 Ga0207686_10055672 Ga0207686_100556723 154
241 3300025934 Ga0207686_10064909 Ga0207686_100649092 154
242 3300025936 Ga0207670_10213921 Ga0207670_102139211 154
243 3300025938 Ga0207704_10107182 Ga0207704_101071823 154
244 3300025938 Ga0207704_10127682 Ga0207704_101276822 154
245 3300025939 Ga0207665_10190276 Ga0207665_101902762 154
246 3300025940 Ga0207691_10137580 Ga0207691_101375804 154
247 3300025940 Ga0207691_10591196 Ga0207691_105911962 154
248 3300025941 Ga0207711_10000001 Ga0207711_10000001130 154
249 3300025941 Ga0207711_10007394 Ga0207711_100073943 154
250 3300025942 Ga0207689_10380798 Ga0207689_103807982 154
251 3300025942 Ga0207689_10484941 Ga0207689_104849412 154
252 3300025944 Ga0207661_10022224 Ga0207661_100222243 154
253 3300025944 Ga0207661_10161221 Ga0207661_101612212 154
254 3300025944 Ga0207661_10447730 Ga0207661_104477302 154
255 3300025949 Ga0207667_10002638 Ga0207667_1000263817 154
256 3300025949 Ga0207667_10013610 Ga0207667_100136102 154
257 3300025949 Ga0207667_10291968 Ga0207667_102919682 154
258 3300025949 Ga0207667_10324439 Ga0207667_103244393 154
259 3300025949 Ga0207667_10345664 Ga0207667_103456642 154
260 3300025949 Ga0207667_10621922 Ga0207667_106219222 154
261 3300025949 Ga0207667_10812031 Ga0207667_108120312 154
262 3300025960 Ga0207651_10148271 Ga0207651_101482712 154
263 3300025961 Ga0207712_10886995 Ga0207712_108869951 154
264 3300025981 Ga0207640_10100272 Ga0207640_101002722 154
265 3300025981 Ga0207640_10221218 Ga0207640_102212182 154
266 3300025981 Ga0207640_10311411 Ga0207640_103114112 154
267 3300026023 Ga0207677_10393652 Ga0207677_103936522 154
268 3300026023 Ga0207677_10407435 Ga0207677_104074352 154
269 3300026035 Ga0207703_10004691 Ga0207703_100046913 154
270 3300026041 Ga0207639_10000177 Ga0207639_1000017739 154
271 3300026041 Ga0207639_10051967 Ga0207639_100519672 154
272 3300026041 Ga0207639_10091289 Ga0207639_100912894 154
273 3300026041 Ga0207639_10111022 Ga0207639_101110223 154
274 3300026041 Ga0207639_10296858 Ga0207639_102968582 154
275 3300026041 Ga0207639_10377580 Ga0207639_103775802 154
276 3300026041 Ga0207639_10405199 Ga0207639_104051992 154
277 3300026041 Ga0207639_10753091 Ga0207639_107530912 154
278 3300026041 Ga0207639_11456908 Ga0207639_114569081 154
279 3300026067 Ga0207678_10409795 Ga0207678_104097952 154
280 3300026078 Ga0207702_10000173 Ga0207702_1000017338 154
281 3300026078 Ga0207702_10001957 Ga0207702_100019575 154
282 3300026078 Ga0207702_10063041 Ga0207702_100630413 154
283 3300026078 Ga0207702_10136329 Ga0207702_101363293 154
284 3300026078 Ga0207702_11089609 Ga0207702_110896092 154
285 3300026088 Ga0207641_10545362 Ga0207641_105453621 154
286 3300026089 Ga0207648_10002710 Ga0207648_1000271010 154
287 3300026089 Ga0207648_10004158 Ga0207648_1000415811 154
288 3300026089 Ga0207648_10609893 Ga0207648_106098932 154
289 3300026089 Ga0207648_11425880 Ga0207648_114258801 154
290 3300026095 Ga0207676_10110609 Ga0207676_101106092 154
291 3300026116 Ga0207674_10000112 Ga0207674_100001125 154
292 3300026121 Ga0207683_10012382 Ga0207683_100123823 154
293 3300026121 Ga0207683_10085041 Ga0207683_100850413 154
294 3300026142 Ga0207698_10017098 Ga0207698_100170984 154
295 3300026142 Ga0207698_10102985 Ga0207698_101029853 154
296 3300026142 Ga0207698_10306776 Ga0207698_103067762 154
297 3300026142 Ga0207698_10679454 Ga0207698_106794542 154
298 3300028379 Ga0268266_10000463 Ga0268266_1000046350 154
299 3300028379 Ga0268266_10028386 Ga0268266_100283863 154
300 3300028379 Ga0268266_10051941 Ga0268266_100519413 154
301 3300028379 Ga0268266_10226067 Ga0268266_102260672 154
302 3300028379 Ga0268266_10830101 Ga0268266_108301012 154
303 3300028380 Ga0268265_10095776 Ga0268265_100957762 154
304 3300028380 Ga0268265_12359601 Ga0268265_123596011 154
305 3300028381 Ga0268264_10092261 Ga0268264_100922611 154
306 3300028381 Ga0268264_11011090 Ga0268264_110110901 154
307 3300028577 Ga0265318_10020432 Ga0265318_100204322 154
308 3300028577 Ga0265318_10173886 Ga0265318_101738862 154
309 3300028800 Ga0265338_10000649 Ga0265338_100006493 154
310 3300028800 Ga0265338_10025110 Ga0265338_100251105 154
311 3300028800 Ga0265338_10042395 Ga0265338_100423952 154
312 3300028800 Ga0265338_10101580 Ga0265338_101015802 154
313 3300028800 Ga0265338_10107996 Ga0265338_101079963 154
314 3300031235 Ga0265330_10021948 Ga0265330_100219484 154
315 3300031235 Ga0265330_10076589 Ga0265330_100765892 154
316 3300031235 Ga0265330_10123028 Ga0265330_101230282 154
317 3300031235 Ga0265330_10182896 Ga0265330_101828961 154
318 3300031235 Ga0265330_10248317 Ga0265330_102483171 154
319 3300031235 Ga0265330_10351148 Ga0265330_103511481 154
320 3300031238 Ga0265332_10028452 Ga0265332_100284523 154
321 3300031238 Ga0265332_10036942 Ga0265332_100369422 154
322 3300031238 Ga0265332_10048166 Ga0265332_100481662 154
323 3300031238 Ga0265332_10193705 Ga0265332_101937052 154
324 3300031238 Ga0265332_10333762 Ga0265332_103337621 154
325 3300031240 Ga0265320_10228807 Ga0265320_102288071 154
326 3300031240 Ga0265320_10233401 Ga0265320_102334012 154
327 3300031241 Ga0265325_10000118 Ga0265325_1000011810 154
328 3300031241 Ga0265325_10026364 Ga0265325_100263643 154
329 3300031241 Ga0265325_10087782 Ga0265325_100877822 154
330 3300031241 Ga0265325_10207150 Ga0265325_102071502 154
331 3300031247 Ga0265340_10004919 Ga0265340_100049193 154
332 3300031247 Ga0265340_10014528 Ga0265340_100145284 154
333 3300031249 Ga0265339_10006488 Ga0265339_100064884 154
334 3300031249 Ga0265339_10007455 Ga0265339_100074552 154
335 3300031249 Ga0265339_10032724 Ga0265339_100327243 154
336 3300031250 Ga0265331_10008800 Ga0265331_100088003 154
337 3300031250 Ga0265331_10102867 Ga0265331_101028672 154
338 3300031344 Ga0265316_10089652 Ga0265316_100896523 154
339 3300031344 Ga0265316_10104106 Ga0265316_101041063 154
340 3300031344 Ga0265316_10148198 Ga0265316_101481983 154
341 3300031344 Ga0265316_10163518 Ga0265316_101635182 154
342 3300031344 Ga0265316_10176209 Ga0265316_101762092 154
343 3300031595 Ga0265313_10002149 Ga0265313_100021493 154
344 3300031595 Ga0265313_10067381 Ga0265313_100673812 154
345 3300031595 Ga0265313_10315098 Ga0265313_103150981 154
346 3300031711 Ga0265314_10016220 Ga0265314_100162204 154
347 3300031711 Ga0265314_10022799 Ga0265314_100227993 154
348 3300031711 Ga0265314_10029548 Ga0265314_100295484 154
349 3300031711 Ga0265314_10050575 Ga0265314_100505753 154
350 3300031711 Ga0265314_10054187 Ga0265314_100541873 154
351 3300031711 Ga0265314_10072550 Ga0265314_100725503 154
352 3300031711 Ga0265314_10176936 Ga0265314_101769362 154
353 3300031712 Ga0265342_10100494 Ga0265342_101004942 154
354 3300031712 Ga0265342_10159100 Ga0265342_101591002 154
355 3300031730 Ga0307516_10028137 Ga0307516_100281375 154
356 3300035083 Ga0373926_0201779 Ga0373926_0201779_72_572 154
357 3300035112 Ga0373932_0033289 Ga0373932_0033289_783_1283 154
358 3300035170 Ga0373943_0252068 Ga0373943_0252068_106_606 154
359 3300035691 Ga0373931_0064534 Ga0373931_0064534_1042_1542 154
360 3300035691 Ga0373931_0068585 Ga0373931_0068585_1255_1755 154
361 3300035691 Ga0373931_0436211 Ga0373931_0436211_40_546 154
362 3300035692 Ga0373935_0294390 Ga0373935_0294390_382_882 154
363 3300035692 Ga0373935_0338874 Ga0373935_0338874_171_671 154
364 3300035695 Ga0373927_0156825 Ga0373927_0156825_314_814 154
365 3300035695 Ga0373927_0441764 Ga0373927_0441764_217_717 154
366 3300036401 Ga0373937_0000718 Ga0373937_0000718_24739_25239 154
367 3300036401 Ga0373937_0362897 Ga0373937_0362897_288_767 154
368 3300037068 Ga0373925_0049971 Ga0373925_0049971_2281_2781 154
369 3300037418 Ga0395900_0020747 Ga0395900_0020747_3276_3740 154
370 3300037418 Ga0395900_0422855 Ga0395900_0422855_264_737 154
371 3300037466 Ga0395898_0026449 Ga0395898_0026449_5064_5537 154
372 3300037466 Ga0395898_0028738 Ga0395898_0028738_4540_5004 154
373 3300038443 Ga0395901_0006983 Ga0395901_0006983_1850_2314 154
374 3300038443 Ga0395901_0258884 Ga0395901_0258884_979_1452 154
375 3300039437 Ga0436365_0412683 Ga0436365_0412683_32508_33008 154
376 3300039437 Ga0436365_0795057 Ga0436365_0795057_94_558 154
377 3300039438 Ga0436360_0138325 Ga0436360_0138325_823_1299 154
378 3300039438 Ga0436360_0736524 Ga0436360_0736524_410_880 154
379 3300039450 Ga0436363_0947660 Ga0436363_0947660_87_566 154
380 3300041443 Ga0451789_0025799 Ga0451789_0025799_68_535 154
381 3300041486 Ga0451807_1118758 Ga0451807_1118758_27_512 154
382 3300041496 Ga0451839_1107899 Ga0451839_1107899_113_589 154
383 3300042876 Ga0451577_0346840 Ga0451577_0346840_836_1315 154
384 3300044719 Ga0466971_0450817 Ga0466971_0450817_116_580 154
385 3300044842 Ga0466957_0231450 Ga0466957_0231450_280_744 154
386 3300046511 Ga0495608_0254680 Ga0495608_0254680_383_871 154
387 3300046529 Ga0495652_0175691 Ga0495652_0175691_684_1181 154
388 3300046543 Ga0495645_0097545 Ga0495645_0097545_831_1328 154
389 3300046557 Ga0495622_0005015 Ga0495622_0005015_5648_6115 154
390 3300046648 Ga0495611_0057480 Ga0495611_0057480_798_1271 154
391 3300046675 Ga0495657_0108857 Ga0495657_0108857_902_1369 154
392 3300046678 Ga0495599_0043524 Ga0495599_0043524_1650_2138 154
393 3300046809 Ga0495600_0678393 Ga0495600_0678393_131_595 154
394 3300047317 Ga0495604_0379618 Ga0495604_0379618_88_576 154
395 3300047320 Ga0495672_0180582 Ga0495672_0180582_555_1019 154
396 3300047470 Ga0495681_0067520 Ga0495681_0067520_1035_1502 154
397 3300048904 Ga0496101_0925960 Ga0496101_0925960_86_586 154
398 3300048905 Ga0496102_0079458 Ga0496102_0079458_2195_2695 154
399 3300048909 Ga0496106_0319118 Ga0496106_0319118_169_669 154
400 3300048909 Ga0496106_0696862 Ga0496106_0696862_24_524 154
401 3300048910 Ga0496107_0674734 Ga0496107_0674734_71_568 154
402 3300048913 Ga0496110_0873247 Ga0496110_0873247_263_763 154
403 3300048914 Ga0496111_0209887 Ga0496111_0209887_833_1333 154
404 3300048924 Ga0496121_0001374 Ga0496121_0001374_16837_17307 154
405 3300048929 Ga0496126_0055539 Ga0496126_0055539_789_1259 154
406 3300048929 Ga0496126_0104617 Ga0496126_0104617_754_1239 154
407 3300049460 Ga0495682_0159016 Ga0495682_0159016_96_572 154
408 3300049568 Ga0501031_0005444 Ga0501031_0005444_3930_4418 154
409 3300049568 Ga0501031_0078158 Ga0501031_0078158_951_1490 154
410 3300049568 Ga0501031_0289476 Ga0501031_0289476_512_997 154
411 3300049569 Ga0501032_0058487 Ga0501032_0058487_1723_2187 154
412 3300049569 Ga0501032_0097502 Ga0501032_0097502_293_778 154
413 3300049569 Ga0501032_0430144 Ga0501032_0430144_260_724 154
414 3300049570 Ga0501033_0022454 Ga0501033_0022454_1741_2280 154
415 3300049570 Ga0501033_0025572 Ga0501033_0025572_2735_3199 154
416 3300049570 Ga0501033_0122185 Ga0501033_0122185_224_763 154
417 3300049570 Ga0501033_0433562 Ga0501033_0433562_94_558 154
418 3300049570 Ga0501033_0634340 Ga0501033_0634340_244_717 154
419 3300049571 Ga0501034_0007300 Ga0501034_0007300_5159_5647 154
420 3300049571 Ga0501034_0014188 Ga0501034_0014188_2488_2964 154
421 3300049571 Ga0501034_0045399 Ga0501034_0045399_1709_2173 154
422 3300049571 Ga0501034_0070233 Ga0501034_0070233_1486_1950 154
423 3300049571 Ga0501034_0114672 Ga0501034_0114672_1682_2167 154
424 3300049571 Ga0501034_0224299 Ga0501034_0224299_332_808 154
425 3300049572 Ga0501036_0000558 Ga0501036_0000558_23086_23574 154
426 3300049572 Ga0501036_0014512 Ga0501036_0014512_1827_2312 154
427 3300049572 Ga0501036_0101111 Ga0501036_0101111_567_1031 154
428 3300049572 Ga0501036_0139977 Ga0501036_0139977_1409_1873 154
429 3300049573 Ga0501037_0004950 Ga0501037_0004950_5121_5609 154
430 3300049573 Ga0501037_0015524 Ga0501037_0015524_3448_3933 154
431 3300049573 Ga0501037_0042538 Ga0501037_0042538_414_878 154
432 3300049573 Ga0501037_0650188 Ga0501037_0650188_41_505 154
433 3300049574 Ga0501038_0016521 Ga0501038_0016521_747_1235 154
434 3300049574 Ga0501038_0024321 Ga0501038_0024321_3195_3659 154
435 3300049574 Ga0501038_0071389 Ga0501038_0071389_1493_2032 154
436 3300049574 Ga0501038_0154418 Ga0501038_0154418_946_1413 154
437 3300049574 Ga0501038_0195944 Ga0501038_0195944_371_907 154
438 3300049575 Ga0501039_0018130 Ga0501039_0018130_4337_4825 154
439 3300049576 Ga0501040_0179597 Ga0501040_0179597_509_997 154
440 3300049578 Ga0501042_0041796 Ga0501042_0041796_1704_2192 154
441 3300049579 Ga0501043_0014171 Ga0501043_0014171_4678_5166 154
442 3300049579 Ga0501043_0027321 Ga0501043_0027321_470_934 154
443 3300049579 Ga0501043_0030978 Ga0501043_0030978_910_1374 154
444 3300049579 Ga0501043_0064808 Ga0501043_0064808_1487_1951 154
445 3300049579 Ga0501043_0111009 Ga0501043_0111009_1271_1738 154
446 3300049579 Ga0501043_0364648 Ga0501043_0364648_264_749 154
447 3300049580 Ga0501046_0002604 Ga0501046_0002604_8073_8540 154
448 3300049580 Ga0501046_0002663 Ga0501046_0002663_4041_4529 154
449 3300049580 Ga0501046_0037462 Ga0501046_0037462_1638_2102 154
450 3300049580 Ga0501046_0060433 Ga0501046_0060433_856_1320 154
451 3300049580 Ga0501046_0943620 Ga0501046_0943620_41_505 154
452 3300049581 Ga0501047_0007737 Ga0501047_0007737_9446_9913 154
453 3300049581 Ga0501047_0010417 Ga0501047_0010417_3179_3664 154
454 3300049581 Ga0501047_0013962 Ga0501047_0013962_3591_4079 154
455 3300049581 Ga0501047_0018085 Ga0501047_0018085_1984_2523 154
456 3300049581 Ga0501047_0066185 Ga0501047_0066185_1811_2275 154
457 3300049581 Ga0501047_0127743 Ga0501047_0127743_1479_1943 154
458 3300049581 Ga0501047_0576872 Ga0501047_0576872_160_624 154
459 3300049582 Ga0501048_0001789 Ga0501048_0001789_3776_4264 154
460 3300049582 Ga0501048_0033129 Ga0501048_0033129_1530_2015 154
461 3300049583 Ga0501067_0004055 Ga0501067_0004055_6513_6998 154
462 3300049583 Ga0501067_0042667 Ga0501067_0042667_1105_1593 154
463 3300049583 Ga0501067_0614261 Ga0501067_0614261_118_585 154
464 3300049584 Ga0501068_0009446 Ga0501068_0009446_3461_3949 154
465 3300049584 Ga0501068_0479124 Ga0501068_0479124_132_596 154
466 3300049585 Ga0501069_0004628 Ga0501069_0004628_1864_2349 154
467 3300049585 Ga0501069_0005812 Ga0501069_0005812_3299_3787 154
468 3300049586 Ga0501070_0003030 Ga0501070_0003030_8994_9482 154
469 3300049586 Ga0501070_0117328 Ga0501070_0117328_1074_1559 154
470 3300049588 Ga0501072_0064417 Ga0501072_0064417_1591_2079 154
471 3300049589 Ga0501073_0007843 Ga0501073_0007843_6292_6780 154
472 3300049589 Ga0501073_0010669 Ga0501073_0010669_2959_3426 154
473 3300049589 Ga0501073_0030051 Ga0501073_0030051_1248_1712 154
474 3300049589 Ga0501073_0106868 Ga0501073_0106868_397_861 154
475 3300049590 Ga0501074_0001185 Ga0501074_0001185_5112_5600 154
476 3300049590 Ga0501074_0049193 Ga0501074_0049193_707_1192 154
477 3300049741 Ga0501079_0003589 Ga0501079_0003589_1674_2162 154
478 3300049741 Ga0501079_0005218 Ga0501079_0005218_7015_7500 154
479 3300049742 Ga0501080_0021202 Ga0501080_0021202_2290_2775 154
480 3300049742 Ga0501080_0172012 Ga0501080_0172012_1122_1610 154
481 3300049742 Ga0501080_0291497 Ga0501080_0291497_609_1103 154
482 3300049744 Ga0501083_0009000 Ga0501083_0009000_4698_5186 154
483 3300049744 Ga0501083_0132593 Ga0501083_0132593_353_817 154
484 3300049744 Ga0501083_0132664 Ga0501083_0132664_670_1146 154
485 3300049822 Ga0501035_0004255 Ga0501035_0004255_5590_6129 154
486 3300049822 Ga0501035_0027400 Ga0501035_0027400_1661_2146 154
487 3300049822 Ga0501035_0032219 Ga0501035_0032219_811_1299 154
488 3300049822 Ga0501035_0061541 Ga0501035_0061541_320_784 154
489 3300049822 Ga0501035_0130572 Ga0501035_0130572_495_959 154
490 3300049822 Ga0501035_0510977 Ga0501035_0510977_26_490 154
491 3300049823 Ga0501044_0002694 Ga0501044_0002694_12219_12788 154
492 3300049823 Ga0501044_0019396 Ga0501044_0019396_1662_2147 154
493 3300049823 Ga0501044_0020825 Ga0501044_0020825_4685_5149 154
494 3300049823 Ga0501044_0045119 Ga0501044_0045119_375_839 154
495 3300049823 Ga0501044_0059095 Ga0501044_0059095_966_1430 154
496 3300049823 Ga0501044_0118644 Ga0501044_0118644_615_1082 154
497 3300049823 Ga0501044_0295927 Ga0501044_0295927_250_714 154
498 3300049823 Ga0501044_0650274 Ga0501044_0650274_185_658 154
499 3300049823 Ga0501044_0692107 Ga0501044_0692107_336_872 154
500 3300049823 Ga0501044_0728233 Ga0501044_0728233_282_821 154
501 3300049824 Ga0501045_0067708 Ga0501045_0067708_1738_2226 154
502 3300050512 nmdc:mga0n895_95957_c1 nmdc:mga0n895_95957_c1_2322_2822 154
503 3300050513 nmdc:mga0rr50_158750_c1 nmdc:mga0rr50_158750_c1_103_603 154
504 3300050513 nmdc:mga0rr50_24751_c1 nmdc:mga0rr50_24751_c1_1199_1699 154
505 3300050514 nmdc:mga08x19_119546_c1 nmdc:mga08x19_119546_c1_1025_1525 154
506 3300050514 nmdc:mga08x19_62_c1 nmdc:mga08x19_62_c1_42019_42519 154
507 3300053077 Ga0495601_0286548 Ga0495601_0286548_479_967 154
508 3300053087 Ga0500643_000027 Ga0500643_000027_143738_144202 154
509 3300053090 Ga0500646_0024524 Ga0500646_0024524_98_562 154
510 3300053098 Ga0500650_0442624 Ga0500650_0442624_77_544 154
511 3300053103 Ga0500555_028111 Ga0500555_028111_420_887 154
512 3300053119 Ga0500595_001613 Ga0500595_001613_10105_10581 154
513 3300053119 Ga0500595_002881 Ga0500595_002881_2006_2470 154
514 3300053119 Ga0500595_061104 Ga0500595_061104_554_1024 154
515 3300053123 Ga0500614_236329 Ga0500614_236329_25_495 154
516 3300053133 Ga0500655_003054 Ga0500655_003054_1720_2217 154
517 3300053136 Ga0500559_0021837 Ga0500559_0021837_921_1388 154
518 3300053136 Ga0500559_0033420 Ga0500559_0033420_574_1038 154
519 3300053136 Ga0500559_0160260 Ga0500559_0160260_18_506 154
520 3300053139 Ga0500568_0337175 Ga0500568_0337175_20_520 154
521 3300053140 Ga0500573_0000032 Ga0500573_0000032_57730_58206 154
522 3300053154 Ga0500619_001906 Ga0500619_001906_1068_1565 154
523 3300053730 Ga0500645_080719 Ga0500645_080719_325_789 154
524 3300053739 Ga0500587_004331 Ga0500587_004331_1281_1763 154
525 3300054114 Ga0501084_0004252 Ga0501084_0004252_1988_2476 154
526 3300054114 Ga0501084_0035851 Ga0501084_0035851_1547_2032 154
527 3300060353 Ga0501082_0098901 Ga0501082_0098901_393_878 154
528 3300060353 Ga0501082_0681208 Ga0501082_0681208_14_478 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

41

181

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7sp3-assembly1.cif.gz_A e. coli rpph bound to ap4a 0.9447 7 153
4s2y-assembly1.cif.gz_A structure of e. coli rpph bound to rna and three magnesium ions 0.9359 7 153
4s2x-assembly1.cif.gz_A structure of e. coli rpph bound to rna and two magnesium ions 0.9312 7 153
6vcp-assembly1.cif.gz_A crystal structure of e.coli rpph in complex with utp 0.9288 7 153
6d1v-assembly1.cif.gz_B crystal structure of e. coli rpph-dapf complex, monomer bound to rna 0.9276 7 153
ID Description Score Start End Superfamily
4s2yA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9359 7 153 3.90.79.10
af_C6SXU5_1_159_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9357 5 154 3.90.79.10
af_A0A0R0I796_20_164_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9176 21 154 3.90.79.10
af_C6SXU5_1_159_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9063 5 154 3.90.79.10
af_Q54FR0_1_169_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8947 4 153 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A2U0SD55-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9837 3 153 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A850H202-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9837 2 154 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A7C9HA00-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9832 3 154 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A7Y0E1Y1-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9831 4 153 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A2L0AEG9-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.983 1 154 GO:0006753
GO:0008893
GO:0019693
GO:0034432

Feature Viewer

pLDDT pTM Quality
91.8 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map