F459735

General Info

Members Datasets Scaffolds Average Seq Length
528 272 1056 158

Family's Representative Sequence

Representative Sequence 3300049591|Ga0501075_1324255|Ga0501075_1324255_12_482
Length 156
Sequence MGIIDQSKCPVRTGTIYPEPYASQMAGRSSLRLGDAGGLTQFGANLVILQPGARSSLRHWHANEDEFVMVMQGELVLVQDEGEYAMHPGECAAFPAGSTNGHTFINRTDEEARFLVVGTKAPREVCTHSDVDLVLKVEGRDVSFAYKDGEPWSGPR

Samples

Sample ID Description Type Environment
1 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
186 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
187 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
190 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
194 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
195 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
196 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
197 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
204 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
205 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
206 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
209 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
210 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
213 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
214 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
215 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
219 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
220 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
221 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
222 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
223 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
224 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
229 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
230 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
231 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
232 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
233 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
249 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
250 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
270 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
271 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
272 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0
Rhizoplane 1.33
Rhizosphere 97.54
Stem 0
Stem Tuber 0
Unclassified 18.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501075_1324255 3300049591 Bacteria 546
2 Ga0065712_10001265 3300005290 Bacteria 10182
3 Ga0065712_10017350 3300005290 Bacteria 2004
4 Ga0065715_10017119 3300005293 Bacteria 1622
5 Ga0065715_10128278 3300005293 Bacteria 2064
6 Ga0070658_10042929 3300005327 Unclassified 3653
7 Ga0070690_100020607 3300005330 Bacteria 4018
8 Ga0070690_100021553 3300005330 Unclassified 3935
9 Ga0070690_100474764 3300005330 Bacteria 931
10 Ga0070670_100001720 3300005331 Bacteria 17831
11 Ga0070677_10013541 3300005333 Bacteria 2855
12 Ga0068869_100040509 3300005334 Bacteria 3331
13 Ga0068869_100387661 3300005334 Bacteria 1146
14 Ga0070666_10000383 3300005335 Bacteria 27824
15 Ga0070666_10065461 3300005335 Unclassified 2466
16 Ga0070680_100051739 3300005336 Bacteria 3352
17 Ga0070680_101242051 3300005336 Bacteria 645
18 Ga0070682_100026790 3300005337 Bacteria 3454
19 Ga0070682_100143120 3300005337 Bacteria 1632
20 Ga0070682_100700977 3300005337 Unclassified 812
21 Ga0068868_100065721 3300005338 Unclassified 2882
22 Ga0068868_100101210 3300005338 Unclassified 2332
23 Ga0070660_100552828 3300005339 Bacteria 960
24 Ga0070689_100218984 3300005340 Unclassified 1561
25 Ga0070689_100771589 3300005340 Bacteria 844
26 Ga0070691_10051067 3300005341 Bacteria 1973
27 Ga0070691_10096315 3300005341 Bacteria 1465
28 Ga0070687_100007751 3300005343 Bacteria 4502
29 Ga0070687_100184501 3300005343 Unclassified 1252
30 Ga0070661_100024766 3300005344 Bacteria 4306
31 Ga0070692_10022211 3300005345 Bacteria 3097
32 Ga0070692_10033898 3300005345 Unclassified 2575
33 Ga0070668_100001273 3300005347 Bacteria 18006
34 Ga0070668_100149812 3300005347 Unclassified 1886
35 Ga0070669_100002155 3300005353 Bacteria 14244
36 Ga0070669_100572397 3300005353 Bacteria 944
37 Ga0070675_100009479 3300005354 Bacteria 7577
38 Ga0070675_100139636 3300005354 Bacteria 2070
39 Ga0070671_100328031 3300005355 Unclassified 1304
40 Ga0070674_100005133 3300005356 Bacteria 7529
41 Ga0070674_100137589 3300005356 Unclassified 1829
42 Ga0070673_100647264 3300005364 Bacteria 967
43 Ga0070688_100044666 3300005365 Bacteria 2735
44 Ga0070688_100513091 3300005365 Bacteria 906
45 Ga0070659_100159098 3300005366 Bacteria 1846
46 Ga0070659_100223678 3300005366 Bacteria 1554
47 Ga0070667_100002701 3300005367 Bacteria 15360
48 Ga0070667_100016880 3300005367 Bacteria 6042
49 Ga0070709_10004037 3300005434 Bacteria 7918
50 Ga0070709_10987174 3300005434 Unclassified 669
51 Ga0070714_100331620 3300005435 Unclassified 1425
52 Ga0070701_10000729 3300005438 Bacteria 11644
53 Ga0070705_100160390 3300005440 Unclassified 1503
54 Ga0070705_100378162 3300005440 Bacteria 1041
55 Ga0070705_100444445 3300005440 Bacteria 971
56 Ga0070700_100012321 3300005441 Bacteria 4766
57 Ga0070694_100041668 3300005444 Unclassified 3064
58 Ga0070694_100436694 3300005444 Bacteria 1031
59 Ga0070678_100043163 3300005456 Bacteria 3210
60 Ga0070678_100312400 3300005456 Bacteria 1339
61 Ga0070678_100616939 3300005456 Unclassified 970
62 Ga0070662_100002002 3300005457 Bacteria 12492
63 Ga0070662_100416034 3300005457 Unclassified 1111
64 Ga0070662_100422071 3300005457 Bacteria 1103
65 Ga0070681_10024607 3300005458 Bacteria 6057
66 Ga0070681_10038386 3300005458 Bacteria 4802
67 Ga0068867_100006666 3300005459 Bacteria 8165
68 Ga0068867_100014633 3300005459 Bacteria 5559
69 Ga0068867_100018225 3300005459 Unclassified 4989
70 Ga0068867_101324801 3300005459 Bacteria 665
71 Ga0070685_10024815 3300005466 Bacteria 3295
72 Ga0070699_100018173 3300005518 Bacteria 6040
73 Ga0070679_100038000 3300005530 Unclassified 4784
74 Ga0070679_100137758 3300005530 Unclassified 2422
75 Ga0070679_100620805 3300005530 Bacteria 1024
76 Ga0070679_100691587 3300005530 Bacteria 962
77 Ga0070684_100037898 3300005535 Unclassified 4138
78 Ga0070684_100343819 3300005535 Unclassified 1372
79 Ga0070697_100811696 3300005536 Bacteria 828
80 Ga0068853_100002638 3300005539 Bacteria 13508
81 Ga0068853_100145114 3300005539 Unclassified 2132
82 Ga0068853_100615410 3300005539 Bacteria 1032
83 Ga0070672_100010069 3300005543 Bacteria 6545
84 Ga0070672_100033683 3300005543 Bacteria 3881
85 Ga0070672_100877657 3300005543 Bacteria 792
86 Ga0070686_100004547 3300005544 Bacteria 7652
87 Ga0070686_100032699 3300005544 Bacteria 3190
88 Ga0070686_100151536 3300005544 Bacteria 1624
89 Ga0070695_100004511 3300005545 Bacteria 8176
90 Ga0070695_100118833 3300005545 Bacteria 1805
91 Ga0070695_100137813 3300005545 Bacteria 1688
92 Ga0070695_100151849 3300005545 Bacteria 1617
93 Ga0070695_100177206 3300005545 Bacteria 1508
94 Ga0070695_100327365 3300005545 Bacteria 1141
95 Ga0070696_100000482 3300005546 Bacteria 25020
96 Ga0070696_100018042 3300005546 Bacteria 4766
97 Ga0070693_100057320 3300005547 Bacteria 2251
98 Ga0070665_100206133 3300005548 Bacteria 1967
99 Ga0070665_100938426 3300005548 Bacteria 878
100 Ga0070704_100042459 3300005549 Bacteria 3146
101 Ga0068855_100097295 3300005563 Bacteria 3390
102 Ga0068855_100313129 3300005563 Bacteria 1736
103 Ga0068855_100560177 3300005563 Bacteria 1236
104 Ga0068857_100803825 3300005577 Bacteria 898
105 Ga0068857_100991965 3300005577 Bacteria 808
106 Ga0068854_100021625 3300005578 Unclassified 4367
107 Ga0068856_100053611 3300005614 Unclassified 3976
108 Ga0068856_100160240 3300005614 Bacteria 2260
109 Ga0070702_100033171 3300005615 Bacteria 2837
110 Ga0070702_100080916 3300005615 Unclassified 1945
111 Ga0070702_100203538 3300005615 Bacteria 1312
112 Ga0068852_100022391 3300005616 Bacteria 5067
113 Ga0068852_100348581 3300005616 Bacteria 1445
114 Ga0068859_100151386 3300005617 Bacteria 2395
115 Ga0068859_100232643 3300005617 Bacteria 1931
116 Ga0068859_101165177 3300005617 Bacteria 848
117 Ga0068859_101763782 3300005617 Bacteria 684
118 Ga0068859_101809668 3300005617 Bacteria 674
119 Ga0068864_100029298 3300005618 Unclassified 4660
120 Ga0068866_10186597 3300005718 Bacteria 1229
121 Ga0068866_10839420 3300005718 Unclassified 642
122 Ga0068861_100001459 3300005719 Bacteria 14966
123 Ga0068861_100205909 3300005719 Bacteria 1654
124 Ga0068861_100618599 3300005719 Bacteria 996
125 Ga0068851_10359242 3300005834 Bacteria 849
126 Ga0068870_10322138 3300005840 Bacteria 982
127 Ga0068863_100001611 3300005841 Bacteria 22315
128 Ga0068863_100142776 3300005841 Bacteria 2289
129 Ga0068863_100254938 3300005841 Bacteria 1695
130 Ga0068858_100132782 3300005842 Bacteria 2335
131 Ga0068858_100301474 3300005842 Unclassified 1529
132 Ga0068860_100003919 3300005843 Bacteria 15290
133 Ga0068860_100045968 3300005843 Bacteria 4164
134 Ga0068860_100091393 3300005843 Unclassified 2900
135 Ga0068860_100774110 3300005843 Bacteria 972
136 Ga0068860_100858916 3300005843 Bacteria 922
137 Ga0068862_100002751 3300005844 Bacteria 15426
138 Ga0068862_100066497 3300005844 Bacteria 3107
139 Ga0068862_101657658 3300005844 Bacteria 647
140 Ga0075432_10074377 3300006058 Bacteria 1224
141 Ga0075366_10098218 3300006195 Bacteria 1757
142 Ga0097621_100008547 3300006237 Bacteria 7377
143 Ga0097621_100124392 3300006237 Bacteria 2190
144 Ga0097621_100171512 3300006237 Bacteria 1870
145 Ga0068871_100090341 3300006358 Bacteria 2550
146 Ga0075431_100738758 3300006847 Bacteria 960
147 Ga0075433_10253341 3300006852 Bacteria 1561
148 Ga0075434_100089159 3300006871 Bacteria 3086
149 Ga0075434_100120923 3300006871 Unclassified 2634
150 Ga0075434_100412640 3300006871 Bacteria 1371
151 Ga0068865_100002156 3300006881 Bacteria 11594
152 Ga0068865_100013692 3300006881 Bacteria 5136
153 Ga0097620_100151376 3300006931 Bacteria 2395
154 Ga0097620_100232633 3300006931 Bacteria 1931
155 Ga0097620_101165151 3300006931 Bacteria 848
156 Ga0097620_101763699 3300006931 Bacteria 684
157 Ga0097620_101809747 3300006931 Bacteria 674
158 Ga0075435_100015626 3300007076 Bacteria 5710
159 Ga0075435_100207893 3300007076 Unclassified 1659
160 Ga0111539_10185281 3300009094 Unclassified 2431
161 Ga0105245_10009167 3300009098 Bacteria 8627
162 Ga0105245_10090262 3300009098 Unclassified 2818
163 Ga0105245_10162056 3300009098 Bacteria 2123
164 Ga0105243_10036053 3300009148 Unclassified 3836
165 Ga0105241_10025981 3300009174 Bacteria 4355
166 Ga0105242_10003366 3300009176 Bacteria 12448
167 Ga0105242_10018744 3300009176 Bacteria 5413
168 Ga0105242_10084989 3300009176 Bacteria 2653
169 Ga0105242_10235648 3300009176 Unclassified 1643
170 Ga0105248_10002726 3300009177 Bacteria 19624
171 Ga0105248_10034506 3300009177 Bacteria 5658
172 Ga0105237_10011858 3300009545 Bacteria 9217
173 Ga0105237_10315691 3300009545 Bacteria 1566
174 Ga0105237_10633220 3300009545 Bacteria 1076
175 Ga0105237_12275368 3300009545 Bacteria 552
176 Ga0105238_10081693 3300009551 Bacteria 3221
177 Ga0105249_10008131 3300009553 Bacteria 9148
178 Ga0105249_10355470 3300009553 Bacteria 1485
179 Ga0105249_10759651 3300009553 Bacteria 1032
180 Ga0105239_10293226 3300010375 Unclassified 1832
181 Ga0105246_10006942 3300011119 Bacteria 6926
182 Ga0105246_10641768 3300011119 Bacteria 923
183 Ga0157373_10317752 3300013100 Unclassified 1107
184 Ga0157371_10048348 3300013102 Unclassified 3023
185 Ga0157370_10367882 3300013104 Bacteria 1325
186 Ga0157370_10478345 3300013104 Unclassified 1144
187 Ga0157370_10870963 3300013104 Bacteria 818
188 Ga0157369_10235932 3300013105 Bacteria 1911
189 Ga0157374_10028221 3300013296 Bacteria 5069
190 Ga0157374_11947582 3300013296 Bacteria 614
191 Ga0157374_12478328 3300013296 Bacteria 546
192 Ga0157378_10019937 3300013297 Bacteria 5897
193 Ga0157378_10084677 3300013297 Bacteria 2871
194 Ga0157378_10087696 3300013297 Unclassified 2823
195 Ga0163162_10784105 3300013306 Unclassified 1071
196 Ga0157372_10318150 3300013307 Bacteria 1812
197 Ga0157372_10367407 3300013307 Bacteria 1676
198 Ga0157372_10712875 3300013307 Bacteria 1167
199 Ga0157375_10055929 3300013308 Bacteria 3892
200 Ga0157375_10266792 3300013308 Unclassified 1874
201 Ga0157375_10288901 3300013308 Bacteria 1803
202 Ga0163163_10087616 3300014325 Unclassified 3124
203 Ga0157380_10019963 3300014326 Bacteria 5002
204 Ga0182008_10822603 3300014497 Bacteria 541
205 Ga0157379_10023479 3300014968 Bacteria 5473
206 Ga0157379_10345388 3300014968 Unclassified 1362
207 Ga0157379_10749166 3300014968 Unclassified 919
208 Ga0157376_10015202 3300014969 Bacteria 5806
209 Ga0157376_10023205 3300014969 Unclassified 4853
210 Ga0163161_10000551 3300017792 Bacteria 30373
211 Ga0163161_10555359 3300017792 Bacteria 942
212 Ga0207697_10006297 3300025315 Bacteria 5390
213 Ga0207697_10013464 3300025315 Unclassified 3412
214 Ga0207697_10044777 3300025315 Bacteria 1821
215 Ga0207682_10014703 3300025893 Bacteria 3050
216 Ga0207682_10025015 3300025893 Bacteria 2367
217 Ga0207642_10061541 3300025899 Unclassified 1746
218 Ga0207642_10128840 3300025899 Bacteria 1317
219 Ga0207688_10060009 3300025901 Bacteria 2142
220 Ga0207680_10012679 3300025903 Unclassified 4301
221 Ga0207699_10084545 3300025906 Bacteria 1976
222 Ga0207645_10000390 3300025907 Bacteria 36191
223 Ga0207645_10001381 3300025907 Bacteria 19927
224 Ga0207643_10278188 3300025908 Bacteria 1037
225 Ga0207705_10505149 3300025909 Unclassified 939
226 Ga0207654_10087678 3300025911 Bacteria 1889
227 Ga0207707_10006501 3300025912 Bacteria 10206
228 Ga0207707_10017308 3300025912 Bacteria 6282
229 Ga0207707_10048821 3300025912 Unclassified 3687
230 Ga0207707_10404723 3300025912 Bacteria 1171
231 Ga0207671_10009072 3300025914 Bacteria 8360
232 Ga0207663_10060702 3300025916 Bacteria 2397
233 Ga0207660_10078706 3300025917 Bacteria 2417
234 Ga0207660_11228251 3300025917 Unclassified 609
235 Ga0207662_10029049 3300025918 Unclassified 3201
236 Ga0207662_10043410 3300025918 Bacteria 2652
237 Ga0207657_10043140 3300025919 Unclassified 3975
238 Ga0207657_10506942 3300025919 Bacteria 945
239 Ga0207649_10035417 3300025920 Bacteria 3000
240 Ga0207652_10102958 3300025921 Unclassified 2524
241 Ga0207652_10192188 3300025921 Unclassified 1836
242 Ga0207652_10235879 3300025921 Bacteria 1649
243 Ga0207652_10901996 3300025921 Bacteria 781
244 Ga0207681_10001344 3300025923 Bacteria 15876
245 Ga0207681_10033370 3300025923 Unclassified 3374
246 Ga0207681_10915872 3300025923 Bacteria 734
247 Ga0207694_10045659 3300025924 Bacteria 3384
248 Ga0207694_10632268 3300025924 Bacteria 901
249 Ga0207650_10000851 3300025925 Bacteria 23132
250 Ga0207650_10088507 3300025925 Bacteria 2361
251 Ga0207650_10406926 3300025925 Bacteria 1127
252 Ga0207659_10007942 3300025926 Bacteria 6562
253 Ga0207687_10035466 3300025927 Unclassified 3393
254 Ga0207687_10799513 3300025927 Bacteria 804
255 Ga0207664_10760462 3300025929 Bacteria 871
256 Ga0207644_10125091 3300025931 Unclassified 1961
257 Ga0207644_10264149 3300025931 Bacteria 1377
258 Ga0207690_10005425 3300025932 Bacteria 7512
259 Ga0207690_10194121 3300025932 Bacteria 1537
260 Ga0207690_10533573 3300025932 Bacteria 952
261 Ga0207706_10011456 3300025933 Bacteria 8077
262 Ga0207706_10023930 3300025933 Bacteria 5479
263 Ga0207706_10411650 3300025933 Unclassified 1172
264 Ga0207686_10154187 3300025934 Unclassified 1603
265 Ga0207686_10188870 3300025934 Bacteria 1467
266 Ga0207686_11164451 3300025934 Unclassified 630
267 Ga0207686_11368315 3300025934 Unclassified 582
268 Ga0207709_10014395 3300025935 Bacteria 4367
269 Ga0207670_10053235 3300025936 Bacteria 2726
270 Ga0207670_10421850 3300025936 Bacteria 1070
271 Ga0207670_10784473 3300025936 Bacteria 793
272 Ga0207669_10005373 3300025937 Bacteria 5743
273 Ga0207704_10113239 3300025938 Unclassified 1839
274 Ga0207704_10161038 3300025938 Bacteria 1597
275 Ga0207691_10001079 3300025940 Bacteria 27155
276 Ga0207691_10025737 3300025940 Bacteria 5522
277 Ga0207691_10180696 3300025940 Bacteria 1844
278 Ga0207711_10092397 3300025941 Bacteria 2663
279 Ga0207689_10008976 3300025942 Bacteria 8662
280 Ga0207689_10486523 3300025942 Bacteria 1033
281 Ga0207679_10289203 3300025945 Bacteria 1408
282 Ga0207679_10311784 3300025945 Unclassified 1360
283 Ga0207667_10269537 3300025949 Bacteria 1740
284 Ga0207651_10695312 3300025960 Bacteria 895
285 Ga0207651_10729875 3300025960 Bacteria 874
286 Ga0207651_12087271 3300025960 Bacteria 509
287 Ga0207712_10000987 3300025961 Bacteria 20375
288 Ga0207712_10581419 3300025961 Unclassified 967
289 Ga0207668_10039113 3300025972 Unclassified 3189
290 Ga0207640_11205068 3300025981 Unclassified 673
291 Ga0207658_10051803 3300025986 Unclassified 3026
292 Ga0207677_10063329 3300026023 Bacteria 2570
293 Ga0207677_10080676 3300026023 Unclassified 2332
294 Ga0207703_10004869 3300026035 Bacteria 10920
295 Ga0207703_10083828 3300026035 Unclassified 2664
296 Ga0207703_10419348 3300026035 Unclassified 1245
297 Ga0207639_10004496 3300026041 Bacteria 9406
298 Ga0207639_10059042 3300026041 Unclassified 2953
299 Ga0207639_10280183 3300026041 Bacteria 1466
300 Ga0207639_11138380 3300026041 Unclassified 732
301 Ga0207678_10095923 3300026067 Bacteria 2534
302 Ga0207708_10003954 3300026075 Bacteria 10911
303 Ga0207708_10096225 3300026075 Bacteria 2288
304 Ga0207702_10057940 3300026078 Unclassified 3295
305 Ga0207702_10187291 3300026078 Bacteria 1910
306 Ga0207702_10194505 3300026078 Bacteria 1876
307 Ga0207641_10012611 3300026088 Bacteria 6931
308 Ga0207641_10039686 3300026088 Bacteria 3938
309 Ga0207641_10069627 3300026088 Bacteria 3022
310 Ga0207641_10116627 3300026088 Bacteria 2376
311 Ga0207641_10566942 3300026088 Bacteria 1109
312 Ga0207648_10001878 3300026089 Bacteria 22968
313 Ga0207648_10412635 3300026089 Bacteria 1225
314 Ga0207676_10103285 3300026095 Bacteria 2368
315 Ga0207676_11092288 3300026095 Bacteria 788
316 Ga0207675_100002444 3300026118 Bacteria 18401
317 Ga0207675_100005947 3300026118 Bacteria 11632
318 Ga0207675_100227213 3300026118 Unclassified 1800
319 Ga0207683_10000495 3300026121 Bacteria 36463
320 Ga0207683_10119216 3300026121 Bacteria 2368
321 Ga0207683_11580203 3300026121 Bacteria 605
322 Ga0207698_10366421 3300026142 Bacteria 1366
323 Ga0268266_10657728 3300028379 Bacteria 1009
324 Ga0268265_10006346 3300028380 Bacteria 8014
325 Ga0268265_10066470 3300028380 Bacteria 2787
326 Ga0268265_10438328 3300028380 Bacteria 1217
327 Ga0268264_10035210 3300028381 Bacteria 4121
328 Ga0268264_10177650 3300028381 Unclassified 1931
329 Ga0268264_10216311 3300028381 Unclassified 1762
330 Ga0268264_10907781 3300028381 Bacteria 884
331 Ga0268264_10976326 3300028381 Bacteria 853
332 Ga0265338_10528189 3300028800 Bacteria 828
333 Ga0265320_10008138 3300031240 Bacteria 6442
334 Ga0265327_10308734 3300031251 Bacteria 695
335 Ga0307408_100454200 3300031548 Bacteria 1112
336 Ga0265313_10040469 3300031595 Bacteria 2304
337 Ga0316575_10091489 3300031665 Bacteria 1232
338 Ga0265314_10007555 3300031711 Bacteria 9419
339 Ga0307405_11201408 3300031731 Bacteria 656
340 Ga0307413_10140573 3300031824 Bacteria 1668
341 Ga0307412_10143177 3300031911 Bacteria 1754
342 Ga0307414_11628705 3300032004 Bacteria 602
343 Ga0307411_10025058 3300032005 Bacteria 3567
344 Ga0373962_0297167 3300035242 Bacteria 572
345 Ga0373931_0068282 3300035691 Bacteria 1934
346 Ga0373925_1583960 3300037068 Unclassified 535
347 Ga0395905_0259698 3300037471 Unclassified 1622
348 Ga0439448_0063925 3300042005 Bacteria 1220
349 Ga0466965_0500776 3300044683 Bacteria 681
350 Ga0453684_1307333 3300044712 Unclassified 756
351 Ga0451576_0072330 3300045051 Bacteria 3589
352 Ga0451576_1603675 3300045051 Bacteria 675
353 Ga0495603_0087347 3300046455 Bacteria 1825
354 Ga0495603_0095455 3300046455 Bacteria 1737
355 Ga0495603_0200486 3300046455 Bacteria 1153
356 Ga0495629_0007035 3300046459 Bacteria 8290
357 Ga0495629_0013979 3300046459 Bacteria 5787
358 Ga0495653_0038106 3300046463 Bacteria 3773
359 Ga0495580_0106857 3300046472 Bacteria 1944
360 Ga0495580_0268383 3300046472 Bacteria 1166
361 Ga0495582_0065835 3300046473 Bacteria 2002
362 Ga0495582_0084337 3300046473 Bacteria 1766
363 Ga0495605_0418185 3300046474 Unclassified 555
364 Ga0495584_0002192 3300046491 Bacteria 11134
365 Ga0495585_0001087 3300046492 Bacteria 22389
366 Ga0495585_0010819 3300046492 Bacteria 5421
367 Ga0495585_0040774 3300046492 Bacteria 2606
368 Ga0495585_0049525 3300046492 Bacteria 2332
369 Ga0495585_0103548 3300046492 Bacteria 1520
370 Ga0495585_0108181 3300046492 Bacteria 1481
371 Ga0495594_0000446 3300046499 Bacteria 20938
372 Ga0495594_0019777 3300046499 Bacteria 3581
373 Ga0495594_0082692 3300046499 Bacteria 1794
374 Ga0495594_0170753 3300046499 Bacteria 1237
375 Ga0495596_0219022 3300046500 Bacteria 739
376 Ga0495607_0255373 3300046501 Bacteria 842
377 Ga0495606_0012998 3300046507 Bacteria 6621
378 Ga0495606_0050014 3300046507 Bacteria 2737
379 Ga0495606_0118775 3300046507 Bacteria 1585
380 Ga0495606_0125780 3300046507 Bacteria 1529
381 Ga0495630_0991410 3300046517 Unclassified 639
382 Ga0495631_0008257 3300046518 Bacteria 5248
383 Ga0495631_0010462 3300046518 Bacteria 4588
384 Ga0495631_0023168 3300046518 Unclassified 2880
385 Ga0495644_0036999 3300046523 Bacteria 1841
386 Ga0495663_0069722 3300046525 Bacteria 1117
387 Ga0495663_0214249 3300046525 Bacteria 675
388 Ga0495666_0019971 3300046526 Bacteria 3322
389 Ga0495666_0025871 3300046526 Bacteria 2896
390 Ga0495666_0050977 3300046526 Bacteria 1989
391 Ga0495666_0114985 3300046526 Bacteria 1262
392 Ga0495666_0212040 3300046526 Bacteria 888
393 Ga0495642_0012062 3300046528 Bacteria 3330
394 Ga0495642_0073296 3300046528 Bacteria 1434
395 Ga0495642_0158007 3300046528 Bacteria 982
396 Ga0495652_0086509 3300046529 Bacteria 2573
397 Ga0495665_0006374 3300046531 Bacteria 6366
398 Ga0495665_0147969 3300046531 Bacteria 1226
399 Ga0495665_0175187 3300046531 Bacteria 1115
400 Ga0495640_0205412 3300046533 Bacteria 1247
401 Ga0495586_0000889 3300046535 Bacteria 17093
402 Ga0495587_0587535 3300046536 Bacteria 613
403 Ga0495621_0024866 3300046539 Unclassified 2005
404 Ga0495597_0001100 3300046542 Bacteria 20478
405 Ga0495597_0008939 3300046542 Bacteria 4995
406 Ga0495597_0121810 3300046542 Bacteria 1087
407 Ga0495622_0018444 3300046557 Bacteria 3249
408 Ga0495622_0029152 3300046557 Bacteria 2578
409 Ga0495622_0081588 3300046557 Bacteria 1488
410 Ga0495622_0135440 3300046557 Unclassified 1120
411 Ga0495633_0043247 3300046558 Bacteria 2137
412 Ga0495633_0058388 3300046558 Bacteria 1811
413 Ga0495633_0160861 3300046558 Bacteria 1036
414 Ga0495667_0228999 3300046559 Bacteria 1185
415 Ga0495656_0056652 3300046615 Bacteria 1694
416 Ga0495668_0004272 3300046616 Bacteria 10253
417 Ga0495668_0044335 3300046616 Bacteria 2472
418 Ga0495611_0484908 3300046648 Bacteria 562
419 Ga0495625_0243682 3300046660 Bacteria 1169
420 Ga0495661_0034545 3300046665 Bacteria 3180
421 Ga0495661_0038608 3300046665 Unclassified 2972
422 Ga0495661_0050653 3300046665 Bacteria 2513
423 Ga0495661_0064381 3300046665 Bacteria 2163
424 Ga0495661_0074555 3300046665 Bacteria 1974
425 Ga0495661_0076130 3300046665 Bacteria 1948
426 Ga0495588_0043524 3300046674 Bacteria 2298
427 Ga0495588_0073123 3300046674 Bacteria 1784
428 Ga0495588_0100270 3300046674 Bacteria 1521
429 Ga0495588_0100931 3300046674 Bacteria 1516
430 Ga0495588_0207184 3300046674 Bacteria 1035
431 Ga0495588_0267143 3300046674 Unclassified 901
432 Ga0495588_0317677 3300046674 Bacteria 819
433 Ga0495623_0021479 3300046679 Bacteria 4167
434 Ga0495623_0180117 3300046679 Bacteria 1228
435 Ga0495623_0491970 3300046679 Unclassified 648
436 Ga0495646_0342637 3300046680 Bacteria 784
437 Ga0495669_0565556 3300046684 Bacteria 553
438 Ga0495613_0111843 3300046689 Bacteria 1967
439 Ga0495613_0161488 3300046689 Bacteria 1594
440 Ga0495613_0266932 3300046689 Bacteria 1191
441 Ga0495624_0067585 3300046690 Bacteria 2229
442 Ga0495624_0085977 3300046690 Bacteria 1942
443 Ga0495670_0005381 3300046691 Bacteria 6292
444 Ga0495670_0141551 3300046691 Bacteria 1258
445 Ga0495670_0172775 3300046691 Bacteria 1138
446 Ga0495671_0031779 3300046692 Bacteria 2697
447 Ga0495671_0034093 3300046692 Bacteria 2590
448 Ga0495589_0032771 3300046794 Bacteria 2612
449 Ga0495589_0054320 3300046794 Bacteria 1975
450 Ga0495581_0088730 3300047315 Bacteria 1793
451 Ga0495581_0091448 3300047315 Bacteria 1765
452 Ga0495581_0375052 3300047315 Unclassified 830
453 Ga0495604_0162366 3300047317 Bacteria 1577
454 Ga0495604_0196659 3300047317 Bacteria 1401
455 Ga0495604_0446402 3300047317 Bacteria 845
456 Ga0495636_0004347 3300047318 Bacteria 5560
457 Ga0495674_0002353 3300047319 Bacteria 18542
458 Ga0495676_0669193 3300047321 Bacteria 673
459 Ga0495680_0786158 3300047322 Unclassified 623
460 Ga0495683_0157369 3300047323 Bacteria 1053
461 Ga0495683_0277077 3300047323 Unclassified 727
462 Ga0495675_0018492 3300047444 Bacteria 4423
463 Ga0495675_0213143 3300047444 Bacteria 1171
464 Ga0495677_0006749 3300047445 Bacteria 4318
465 Ga0495677_0020917 3300047445 Bacteria 2372
466 Ga0495677_0052692 3300047445 Bacteria 1500
467 Ga0495677_0060663 3300047445 Bacteria 1402
468 Ga0495681_0027084 3300047470 Bacteria 2971
469 Ga0495681_0033148 3300047470 Bacteria 2591
470 Ga0495593_0018300 3300047673 Bacteria 3938
471 Ga0495593_0046284 3300047673 Bacteria 2318
472 Ga0495626_0001520 3300048091 Bacteria 18229
473 Ga0495626_0417741 3300048091 Bacteria 517
474 Ga0496107_0067620 3300048910 Bacteria 2593
475 Ga0496108_1096267 3300048911 Unclassified 677
476 Ga0496112_0010461 3300048915 Bacteria 8415
477 Ga0496113_0415109 3300048916 Bacteria 1081
478 Ga0496114_0453238 3300048917 Bacteria 1136
479 Ga0496115_0313072 3300048918 Bacteria 1285
480 Ga0496115_0403280 3300048918 Bacteria 1109
481 Ga0501036_0167926 3300049572 Bacteria 1849
482 Ga0501036_0607035 3300049572 Bacteria 907
483 Ga0501037_0134609 3300049573 Bacteria 1771
484 Ga0501039_0461537 3300049575 Bacteria 997
485 Ga0501041_0504950 3300049577 Bacteria 769
486 Ga0501042_0798585 3300049578 Bacteria 687
487 Ga0501043_0502370 3300049579 Bacteria 906
488 Ga0501043_0762040 3300049579 Bacteria 703
489 Ga0501047_0021158 3300049581 Bacteria 6246
490 Ga0501047_0475476 3300049581 Bacteria 1077
491 Ga0501047_0505394 3300049581 Bacteria 1035
492 Ga0501048_0236956 3300049582 Bacteria 1295
493 Ga0501067_0028701 3300049583 Bacteria 3083
494 Ga0501067_0542160 3300049583 Bacteria 651
495 Ga0501068_0057955 3300049584 Bacteria 2349
496 Ga0501069_0001252 3300049585 Bacteria 12431
497 Ga0501070_0000975 3300049586 Bacteria 25701
498 Ga0501071_0051581 3300049587 Bacteria 2965
499 Ga0501072_0108564 3300049588 Bacteria 2208
500 Ga0501073_0002142 3300049589 Bacteria 14774
501 Ga0501074_0001937 3300049590 Bacteria 14220
502 Ga0501075_0020404 3300049591 Bacteria 4821
503 Ga0501076_0092730 3300049592 Bacteria 2430
504 Ga0501076_0620652 3300049592 Bacteria 892
505 Ga0501079_0035476 3300049741 Bacteria 3839
506 Ga0501080_0022112 3300049742 Bacteria 5891
507 Ga0501080_0117900 3300049742 Bacteria 2461
508 Ga0501081_0038131 3300049743 Bacteria 3281
509 Ga0501083_0002623 3300049744 Bacteria 12390
510 Ga0501083_0091513 3300049744 Bacteria 2008
511 Ga0501044_0480717 3300049823 Bacteria 1145
512 nmdc:mga0k408_345616_c1 3300050493 Bacteria 887
513 nmdc:mga0n895_298960_c1 3300050512 Bacteria 1632
514 nmdc:mga0n895_32645_c1 3300050512 Bacteria 4998
515 nmdc:mga0n895_332211_c1 3300050512 Unclassified 1540
516 nmdc:mga0rr50_161442_c1 3300050513 Unclassified 1819
517 nmdc:mga0rr50_190866_c1 3300050513 Bacteria 1679
518 nmdc:mga0rr50_72917_c1 3300050513 Unclassified 2623
519 nmdc:mga0a205_671158_c1 3300050515 Bacteria 887
520 nmdc:mga0a205_736180_c1 3300050515 Bacteria 835
521 Ga0500593_000245 3300053117 Bacteria 22241
522 Ga0501084_0045302 3300054114 Bacteria 3683
523 Ga0501082_0064720 3300060353 Bacteria 3149
524 Ga0501082_0120585 3300060353 Bacteria 2273
525 Ga0530510_0082233 3300061734 Bacteria 2345
526 2870073106 2870068957 Bacteria 8925310
527 2885374715 2885374607 Bacteria 8927485
528 2989394564 2989392574 Bacteria 4554005
529 Ga0501075_1324255
530 Ga0065712_10001265
531 Ga0065712_10017350
532 Ga0065715_10017119
533 Ga0065715_10128278
534 Ga0070658_10042929
535 Ga0070690_100020607
536 Ga0070690_100021553
537 Ga0070690_100474764
538 Ga0070670_100001720
539 Ga0070677_10013541
540 Ga0068869_100040509
541 Ga0068869_100387661
542 Ga0070666_10000383
543 Ga0070666_10065461
544 Ga0070680_100051739
545 Ga0070680_101242051
546 Ga0070682_100026790
547 Ga0070682_100143120
548 Ga0070682_100700977
549 Ga0068868_100065721
550 Ga0068868_100101210
551 Ga0070660_100552828
552 Ga0070689_100218984
553 Ga0070689_100771589
554 Ga0070691_10051067
555 Ga0070691_10096315
556 Ga0070687_100007751
557 Ga0070687_100184501
558 Ga0070661_100024766
559 Ga0070692_10022211
560 Ga0070692_10033898
561 Ga0070668_100001273
562 Ga0070668_100149812
563 Ga0070669_100002155
564 Ga0070669_100572397
565 Ga0070675_100009479
566 Ga0070675_100139636
567 Ga0070671_100328031
568 Ga0070674_100005133
569 Ga0070674_100137589
570 Ga0070673_100647264
571 Ga0070688_100044666
572 Ga0070688_100513091
573 Ga0070659_100159098
574 Ga0070659_100223678
575 Ga0070667_100002701
576 Ga0070667_100016880
577 Ga0070709_10004037
578 Ga0070709_10987174
579 Ga0070714_100331620
580 Ga0070701_10000729
581 Ga0070705_100160390
582 Ga0070705_100378162
583 Ga0070705_100444445
584 Ga0070700_100012321
585 Ga0070694_100041668
586 Ga0070694_100436694
587 Ga0070678_100043163
588 Ga0070678_100312400
589 Ga0070678_100616939
590 Ga0070662_100002002
591 Ga0070662_100416034
592 Ga0070662_100422071
593 Ga0070681_10024607
594 Ga0070681_10038386
595 Ga0068867_100006666
596 Ga0068867_100014633
597 Ga0068867_100018225
598 Ga0068867_101324801
599 Ga0070685_10024815
600 Ga0070699_100018173
601 Ga0070679_100038000
602 Ga0070679_100137758
603 Ga0070679_100620805
604 Ga0070679_100691587
605 Ga0070684_100037898
606 Ga0070684_100343819
607 Ga0070697_100811696
608 Ga0068853_100002638
609 Ga0068853_100145114
610 Ga0068853_100615410
611 Ga0070672_100010069
612 Ga0070672_100033683
613 Ga0070672_100877657
614 Ga0070686_100004547
615 Ga0070686_100032699
616 Ga0070686_100151536
617 Ga0070695_100004511
618 Ga0070695_100118833
619 Ga0070695_100137813
620 Ga0070695_100151849
621 Ga0070695_100177206
622 Ga0070695_100327365
623 Ga0070696_100000482
624 Ga0070696_100018042
625 Ga0070693_100057320
626 Ga0070665_100206133
627 Ga0070665_100938426
628 Ga0070704_100042459
629 Ga0068855_100097295
630 Ga0068855_100313129
631 Ga0068855_100560177
632 Ga0068857_100803825
633 Ga0068857_100991965
634 Ga0068854_100021625
635 Ga0068856_100053611
636 Ga0068856_100160240
637 Ga0070702_100033171
638 Ga0070702_100080916
639 Ga0070702_100203538
640 Ga0068852_100022391
641 Ga0068852_100348581
642 Ga0068859_100151386
643 Ga0068859_100232643
644 Ga0068859_101165177
645 Ga0068859_101763782
646 Ga0068859_101809668
647 Ga0068864_100029298
648 Ga0068866_10186597
649 Ga0068866_10839420
650 Ga0068861_100001459
651 Ga0068861_100205909
652 Ga0068861_100618599
653 Ga0068851_10359242
654 Ga0068870_10322138
655 Ga0068863_100001611
656 Ga0068863_100142776
657 Ga0068863_100254938
658 Ga0068858_100132782
659 Ga0068858_100301474
660 Ga0068860_100003919
661 Ga0068860_100045968
662 Ga0068860_100091393
663 Ga0068860_100774110
664 Ga0068860_100858916
665 Ga0068862_100002751
666 Ga0068862_100066497
667 Ga0068862_101657658
668 Ga0075432_10074377
669 Ga0075366_10098218
670 Ga0097621_100008547
671 Ga0097621_100124392
672 Ga0097621_100171512
673 Ga0068871_100090341
674 Ga0075431_100738758
675 Ga0075433_10253341
676 Ga0075434_100089159
677 Ga0075434_100120923
678 Ga0075434_100412640
679 Ga0068865_100002156
680 Ga0068865_100013692
681 Ga0097620_100151376
682 Ga0097620_100232633
683 Ga0097620_101165151
684 Ga0097620_101763699
685 Ga0097620_101809747
686 Ga0075435_100015626
687 Ga0075435_100207893
688 Ga0111539_10185281
689 Ga0105245_10009167
690 Ga0105245_10090262
691 Ga0105245_10162056
692 Ga0105243_10036053
693 Ga0105241_10025981
694 Ga0105242_10003366
695 Ga0105242_10018744
696 Ga0105242_10084989
697 Ga0105242_10235648
698 Ga0105248_10002726
699 Ga0105248_10034506
700 Ga0105237_10011858
701 Ga0105237_10315691
702 Ga0105237_10633220
703 Ga0105237_12275368
704 Ga0105238_10081693
705 Ga0105249_10008131
706 Ga0105249_10355470
707 Ga0105249_10759651
708 Ga0105239_10293226
709 Ga0105246_10006942
710 Ga0105246_10641768
711 Ga0157373_10317752
712 Ga0157371_10048348
713 Ga0157370_10367882
714 Ga0157370_10478345
715 Ga0157370_10870963
716 Ga0157369_10235932
717 Ga0157374_10028221
718 Ga0157374_11947582
719 Ga0157374_12478328
720 Ga0157378_10019937
721 Ga0157378_10084677
722 Ga0157378_10087696
723 Ga0163162_10784105
724 Ga0157372_10318150
725 Ga0157372_10367407
726 Ga0157372_10712875
727 Ga0157375_10055929
728 Ga0157375_10266792
729 Ga0157375_10288901
730 Ga0163163_10087616
731 Ga0157380_10019963
732 Ga0182008_10822603
733 Ga0157379_10023479
734 Ga0157379_10345388
735 Ga0157379_10749166
736 Ga0157376_10015202
737 Ga0157376_10023205
738 Ga0163161_10000551
739 Ga0163161_10555359
740 Ga0207697_10006297
741 Ga0207697_10013464
742 Ga0207697_10044777
743 Ga0207682_10014703
744 Ga0207682_10025015
745 Ga0207642_10061541
746 Ga0207642_10128840
747 Ga0207688_10060009
748 Ga0207680_10012679
749 Ga0207699_10084545
750 Ga0207645_10000390
751 Ga0207645_10001381
752 Ga0207643_10278188
753 Ga0207705_10505149
754 Ga0207654_10087678
755 Ga0207707_10006501
756 Ga0207707_10017308
757 Ga0207707_10048821
758 Ga0207707_10404723
759 Ga0207671_10009072
760 Ga0207663_10060702
761 Ga0207660_10078706
762 Ga0207660_11228251
763 Ga0207662_10029049
764 Ga0207662_10043410
765 Ga0207657_10043140
766 Ga0207657_10506942
767 Ga0207649_10035417
768 Ga0207652_10102958
769 Ga0207652_10192188
770 Ga0207652_10235879
771 Ga0207652_10901996
772 Ga0207681_10001344
773 Ga0207681_10033370
774 Ga0207681_10915872
775 Ga0207694_10045659
776 Ga0207694_10632268
777 Ga0207650_10000851
778 Ga0207650_10088507
779 Ga0207650_10406926
780 Ga0207659_10007942
781 Ga0207687_10035466
782 Ga0207687_10799513
783 Ga0207664_10760462
784 Ga0207644_10125091
785 Ga0207644_10264149
786 Ga0207690_10005425
787 Ga0207690_10194121
788 Ga0207690_10533573
789 Ga0207706_10011456
790 Ga0207706_10023930
791 Ga0207706_10411650
792 Ga0207686_10154187
793 Ga0207686_10188870
794 Ga0207686_11164451
795 Ga0207686_11368315
796 Ga0207709_10014395
797 Ga0207670_10053235
798 Ga0207670_10421850
799 Ga0207670_10784473
800 Ga0207669_10005373
801 Ga0207704_10113239
802 Ga0207704_10161038
803 Ga0207691_10001079
804 Ga0207691_10025737
805 Ga0207691_10180696
806 Ga0207711_10092397
807 Ga0207689_10008976
808 Ga0207689_10486523
809 Ga0207679_10289203
810 Ga0207679_10311784
811 Ga0207667_10269537
812 Ga0207651_10695312
813 Ga0207651_10729875
814 Ga0207651_12087271
815 Ga0207712_10000987
816 Ga0207712_10581419
817 Ga0207668_10039113
818 Ga0207640_11205068
819 Ga0207658_10051803
820 Ga0207677_10063329
821 Ga0207677_10080676
822 Ga0207703_10004869
823 Ga0207703_10083828
824 Ga0207703_10419348
825 Ga0207639_10004496
826 Ga0207639_10059042
827 Ga0207639_10280183
828 Ga0207639_11138380
829 Ga0207678_10095923
830 Ga0207708_10003954
831 Ga0207708_10096225
832 Ga0207702_10057940
833 Ga0207702_10187291
834 Ga0207702_10194505
835 Ga0207641_10012611
836 Ga0207641_10039686
837 Ga0207641_10069627
838 Ga0207641_10116627
839 Ga0207641_10566942
840 Ga0207648_10001878
841 Ga0207648_10412635
842 Ga0207676_10103285
843 Ga0207676_11092288
844 Ga0207675_100002444
845 Ga0207675_100005947
846 Ga0207675_100227213
847 Ga0207683_10000495
848 Ga0207683_10119216
849 Ga0207683_11580203
850 Ga0207698_10366421
851 Ga0268266_10657728
852 Ga0268265_10006346
853 Ga0268265_10066470
854 Ga0268265_10438328
855 Ga0268264_10035210
856 Ga0268264_10177650
857 Ga0268264_10216311
858 Ga0268264_10907781
859 Ga0268264_10976326
860 Ga0265338_10528189
861 Ga0265320_10008138
862 Ga0265327_10308734
863 Ga0307408_100454200
864 Ga0265313_10040469
865 Ga0316575_10091489
866 Ga0265314_10007555
867 Ga0307405_11201408
868 Ga0307413_10140573
869 Ga0307412_10143177
870 Ga0307414_11628705
871 Ga0307411_10025058
872 Ga0373962_0297167
873 Ga0373931_0068282
874 Ga0373925_1583960
875 Ga0395905_0259698
876 Ga0439448_0063925
877 Ga0466965_0500776
878 Ga0453684_1307333
879 Ga0451576_0072330
880 Ga0451576_1603675
881 Ga0495603_0087347
882 Ga0495603_0095455
883 Ga0495603_0200486
884 Ga0495629_0007035
885 Ga0495629_0013979
886 Ga0495653_0038106
887 Ga0495580_0106857
888 Ga0495580_0268383
889 Ga0495582_0065835
890 Ga0495582_0084337
891 Ga0495605_0418185
892 Ga0495584_0002192
893 Ga0495585_0001087
894 Ga0495585_0010819
895 Ga0495585_0040774
896 Ga0495585_0049525
897 Ga0495585_0103548
898 Ga0495585_0108181
899 Ga0495594_0000446
900 Ga0495594_0019777
901 Ga0495594_0082692
902 Ga0495594_0170753
903 Ga0495596_0219022
904 Ga0495607_0255373
905 Ga0495606_0012998
906 Ga0495606_0050014
907 Ga0495606_0118775
908 Ga0495606_0125780
909 Ga0495630_0991410
910 Ga0495631_0008257
911 Ga0495631_0010462
912 Ga0495631_0023168
913 Ga0495644_0036999
914 Ga0495663_0069722
915 Ga0495663_0214249
916 Ga0495666_0019971
917 Ga0495666_0025871
918 Ga0495666_0050977
919 Ga0495666_0114985
920 Ga0495666_0212040
921 Ga0495642_0012062
922 Ga0495642_0073296
923 Ga0495642_0158007
924 Ga0495652_0086509
925 Ga0495665_0006374
926 Ga0495665_0147969
927 Ga0495665_0175187
928 Ga0495640_0205412
929 Ga0495586_0000889
930 Ga0495587_0587535
931 Ga0495621_0024866
932 Ga0495597_0001100
933 Ga0495597_0008939
934 Ga0495597_0121810
935 Ga0495622_0018444
936 Ga0495622_0029152
937 Ga0495622_0081588
938 Ga0495622_0135440
939 Ga0495633_0043247
940 Ga0495633_0058388
941 Ga0495633_0160861
942 Ga0495667_0228999
943 Ga0495656_0056652
944 Ga0495668_0004272
945 Ga0495668_0044335
946 Ga0495611_0484908
947 Ga0495625_0243682
948 Ga0495661_0034545
949 Ga0495661_0038608
950 Ga0495661_0050653
951 Ga0495661_0064381
952 Ga0495661_0074555
953 Ga0495661_0076130
954 Ga0495588_0043524
955 Ga0495588_0073123
956 Ga0495588_0100270
957 Ga0495588_0100931
958 Ga0495588_0207184
959 Ga0495588_0267143
960 Ga0495588_0317677
961 Ga0495623_0021479
962 Ga0495623_0180117
963 Ga0495623_0491970
964 Ga0495646_0342637
965 Ga0495669_0565556
966 Ga0495613_0111843
967 Ga0495613_0161488
968 Ga0495613_0266932
969 Ga0495624_0067585
970 Ga0495624_0085977
971 Ga0495670_0005381
972 Ga0495670_0141551
973 Ga0495670_0172775
974 Ga0495671_0031779
975 Ga0495671_0034093
976 Ga0495589_0032771
977 Ga0495589_0054320
978 Ga0495581_0088730
979 Ga0495581_0091448
980 Ga0495581_0375052
981 Ga0495604_0162366
982 Ga0495604_0196659
983 Ga0495604_0446402
984 Ga0495636_0004347
985 Ga0495674_0002353
986 Ga0495676_0669193
987 Ga0495680_0786158
988 Ga0495683_0157369
989 Ga0495683_0277077
990 Ga0495675_0018492
991 Ga0495675_0213143
992 Ga0495677_0006749
993 Ga0495677_0020917
994 Ga0495677_0052692
995 Ga0495677_0060663
996 Ga0495681_0027084
997 Ga0495681_0033148
998 Ga0495593_0018300
999 Ga0495593_0046284
1000 Ga0495626_0001520
1001 Ga0495626_0417741
1002 Ga0496107_0067620
1003 Ga0496108_1096267
1004 Ga0496112_0010461
1005 Ga0496113_0415109
1006 Ga0496114_0453238
1007 Ga0496115_0313072
1008 Ga0496115_0403280
1009 Ga0501036_0167926
1010 Ga0501036_0607035
1011 Ga0501037_0134609
1012 Ga0501039_0461537
1013 Ga0501041_0504950
1014 Ga0501042_0798585
1015 Ga0501043_0502370
1016 Ga0501043_0762040
1017 Ga0501047_0021158
1018 Ga0501047_0475476
1019 Ga0501047_0505394
1020 Ga0501048_0236956
1021 Ga0501067_0028701
1022 Ga0501067_0542160
1023 Ga0501068_0057955
1024 Ga0501069_0001252
1025 Ga0501070_0000975
1026 Ga0501071_0051581
1027 Ga0501072_0108564
1028 Ga0501073_0002142
1029 Ga0501074_0001937
1030 Ga0501075_0020404
1031 Ga0501076_0092730
1032 Ga0501076_0620652
1033 Ga0501079_0035476
1034 Ga0501080_0022112
1035 Ga0501080_0117900
1036 Ga0501081_0038131
1037 Ga0501083_0002623
1038 Ga0501083_0091513
1039 Ga0501044_0480717
1040 nmdc:mga0k408_345616_c1
1041 nmdc:mga0n895_298960_c1
1042 nmdc:mga0n895_32645_c1
1043 nmdc:mga0n895_332211_c1
1044 nmdc:mga0rr50_161442_c1
1045 nmdc:mga0rr50_190866_c1
1046 nmdc:mga0rr50_72917_c1
1047 nmdc:mga0a205_671158_c1
1048 nmdc:mga0a205_736180_c1
1049 Ga0500593_000245
1050 Ga0501084_0045302
1051 Ga0501082_0064720
1052 Ga0501082_0120585
1053 Ga0530510_0082233
1054 2870073106
1055 2885374715
1056 2989394564

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

45

118

0.97

PF00190

Cupin_1

Cupin

36

137

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7d-assembly1.cif.gz_A crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution 0.9411 8 158
4rd7-assembly1.cif.gz_A-2 the crystal structure of a cupin 2 conserved barrel domain protein from salinispora arenicola cns-205 0.9044 46 127
3l2h-assembly1.cif.gz_D crystal structure of putative sugar phosphate isomerase (afe_0303) from acidithiobacillus ferrooxidans atcc 23270 at 1.85 a resolution 0.8976 34 158
3i7d-assembly1.cif.gz_A crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution 0.895 8 158
2d40-assembly1.cif.gz_D crystal structure of z3393 from escherichia coli o157:h7 0.888 47 125
ID Description Score Start End Superfamily
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9247 47 125 2.60.120.10
3i7dB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9236 8 158 2.60.120.10
3l2hD01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9227 34 151 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9045 47 127 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9006 47 126 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A0P6V9N3-F1-model_v4 Cupin 0.9962 8 129 GO:0046872
AF-A0A1K2HRM8-F1-model_v4 Cupin domain-containing protein 0.9954 34 137 GO:0046872
AF-A0A2T6KQ38-F1-model_v4 Cupin domain-containing protein 0.9884 50 128 GO:0046872
AF-A0A4Q1TH26-F1-model_v4 deleted 0.9851 34 140
AF-A0A2D5HBH3-F1-model_v4 Transcriptional regulator 0.9834 39 136 GO:0046872

Map