F459684

General Info

Members Datasets Scaffolds Average Seq Length
528 257 1056 210

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10236270|Ga0207678_102362702
Length 232
Sequence MSEARAPGLDVFYPIVPDATWVARIVPLGVRTLQLRVKDASSSDVRRQIAESLETARRHGCQLIVNDFWREAIDAGADYVHLGQEDLAAADVAAIKAAGLRLGVSTHSEEELEIALAAGPDYVALGPIYETKLKAMKWAPQGLGRIGAWKARVGALPLVAIGGITPERADGVVAAGADSVAVITDFMTAQHPEARIETWLAWAESRSRADLAKADCRLACNCRVRRWPKSNC

Samples

Sample ID Description Type Environment
1 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
89 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
90 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
91 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
130 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
136 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
137 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
138 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
139 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
140 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
141 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
154 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
155 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
156 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
168 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
184 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
236 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
248 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
251 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
252 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
253 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
257 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.19
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.68
Nodule 0
Rhizoplane 7.39
Rhizosphere 84.47
Stem 0
Stem Tuber 0
Unclassified 3.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207678_10236270 3300026067 Bacteria 1565
2 JGI25156J39149_1000007 3300002705 Bacteria 252108
3 JGI25154J39366_1000013 3300002738 Bacteria 268260
4 JGI25157J39369_1000012 3300002741 Bacteria 205167
5 JGI25157J39369_1000099 3300002741 Bacteria 73678
6 rootH2_10060175 3300003320 Bacteria 1714
7 Ga0070676_10082611 3300005328 Bacteria 1952
8 Ga0068869_100121173 3300005334 Bacteria 2001
9 Ga0068869_100446206 3300005334 Bacteria 1072
10 Ga0070680_100013897 3300005336 Bacteria 6281
11 Ga0070682_100011897 3300005337 Bacteria 4977
12 Ga0070682_100252392 3300005337 Bacteria 1272
13 Ga0070689_100163536 3300005340 Bacteria 1800
14 Ga0070689_100407790 3300005340 Bacteria 1150
15 Ga0070691_10011181 3300005341 Bacteria 4096
16 Ga0070691_10033541 3300005341 Bacteria 2416
17 Ga0070691_10112125 3300005341 Bacteria 1365
18 Ga0070661_100123627 3300005344 Bacteria 1940
19 Ga0070692_10060013 3300005345 Bacteria 2001
20 Ga0070668_100059948 3300005347 Bacteria 2946
21 Ga0070668_100234313 3300005347 Bacteria 1519
22 Ga0070668_100320575 3300005347 Bacteria 1305
23 Ga0070675_100370795 3300005354 Bacteria 1273
24 Ga0070674_100280775 3300005356 Bacteria 1320
25 Ga0070673_100413305 3300005364 Bacteria 1208
26 Ga0070673_100458687 3300005364 Bacteria 1147
27 Ga0070688_100452624 3300005365 Bacteria 960
28 Ga0070659_100008905 3300005366 Bacteria 7357
29 Ga0070667_100527201 3300005367 Bacteria 1084
30 Ga0070703_10048394 3300005406 Bacteria 1350
31 Ga0070703_10120720 3300005406 Bacteria 950
32 Ga0070701_10098422 3300005438 Bacteria 1615
33 Ga0070700_100016937 3300005441 Bacteria 4159
34 Ga0070700_100078951 3300005441 Bacteria 2120
35 Ga0070700_100473258 3300005441 Bacteria 958
36 Ga0070694_100033837 3300005444 Bacteria 3367
37 Ga0070694_100039843 3300005444 Bacteria 3129
38 Ga0070694_100082888 3300005444 Bacteria 2234
39 Ga0070694_100308267 3300005444 Bacteria 1215
40 Ga0070708_100104572 3300005445 Bacteria 2596
41 Ga0070663_100024966 3300005455 Bacteria 4030
42 Ga0070663_100041570 3300005455 Bacteria 3225
43 Ga0070663_100194976 3300005455 Bacteria 1578
44 Ga0070663_100654048 3300005455 Bacteria 889
45 Ga0070663_101047482 3300005455 Bacteria 711
46 Ga0070678_100011483 3300005456 Bacteria 5468
47 Ga0070678_100904130 3300005456 Bacteria 807
48 Ga0070662_100087959 3300005457 Bacteria 2327
49 Ga0070662_100270814 3300005457 Bacteria 1371
50 Ga0070662_100561509 3300005457 Bacteria 957
51 Ga0070662_100578161 3300005457 Bacteria 943
52 Ga0070681_10100680 3300005458 Bacteria 2835
53 Ga0068867_100290387 3300005459 Bacteria 1344
54 Ga0070706_100175998 3300005467 Bacteria 1998
55 Ga0070707_100304273 3300005468 Bacteria 1549
56 Ga0070699_100015213 3300005518 Bacteria 6611
57 Ga0070679_100066132 3300005530 Bacteria 3603
58 Ga0070697_100030901 3300005536 Bacteria 4305
59 Ga0068853_100044798 3300005539 Bacteria 3788
60 Ga0070695_100000774 3300005545 Bacteria 17193
61 Ga0070695_100001145 3300005545 Bacteria 14543
62 Ga0070696_100074252 3300005546 Bacteria 2397
63 Ga0070696_100640333 3300005546 Unclassified 861
64 Ga0070693_100167520 3300005547 Bacteria 1404
65 Ga0070704_100008998 3300005549 Bacteria 6019
66 Ga0070704_100324635 3300005549 Bacteria 1291
67 Ga0068855_100148941 3300005563 Bacteria 2662
68 Ga0070664_100179504 3300005564 Bacteria 1881
69 Ga0070664_100343453 3300005564 Bacteria 1356
70 Ga0068857_100091768 3300005577 Bacteria 2719
71 Ga0068857_100106947 3300005577 Bacteria 2512
72 Ga0068852_100192939 3300005616 Bacteria 1923
73 Ga0068859_100009400 3300005617 Bacteria 9872
74 Ga0068864_100297152 3300005618 Bacteria 1511
75 Ga0068861_100158005 3300005719 Bacteria 1867
76 Ga0068861_100234132 3300005719 Bacteria 1559
77 Ga0068861_100256142 3300005719 Bacteria 1496
78 Ga0068863_100592194 3300005841 Bacteria 1097
79 Ga0068858_100619925 3300005842 Bacteria 1050
80 Ga0068860_100063001 3300005843 Bacteria 3523
81 Ga0068860_100867402 3300005843 Bacteria 918
82 Ga0068862_100139953 3300005844 Bacteria 2147
83 Ga0081455_10000334 3300005937 Bacteria 61844
84 Ga0081455_10029756 3300005937 Bacteria 4974
85 Ga0081540_1000179 3300005983 Bacteria 65936
86 Ga0075365_10036488 3300006038 Bacteria 3185
87 Ga0075368_10000723 3300006042 Bacteria 10112
88 Ga0075368_10236539 3300006042 Bacteria 778
89 Ga0075363_100032318 3300006048 Bacteria 2718
90 Ga0075363_100079119 3300006048 Bacteria 1796
91 Ga0075364_10042404 3300006051 Bacteria 2956
92 Ga0070715_10040215 3300006163 Bacteria 1953
93 Ga0075367_10000521 3300006178 Bacteria 14465
94 Ga0075367_10002168 3300006178 Bacteria 8843
95 Ga0075367_10004325 3300006178 Bacteria 6912
96 Ga0075366_10042560 3300006195 Bacteria 2689
97 Ga0075428_100152654 3300006844 Bacteria 2509
98 Ga0075428_100195467 3300006844 Bacteria 2187
99 Ga0075428_100533682 3300006844 Bacteria 1255
100 Ga0075428_100898182 3300006844 Bacteria 940
101 Ga0075428_101001116 3300006844 Bacteria 885
102 Ga0075430_100120893 3300006846 Bacteria 2183
103 Ga0075430_100385123 3300006846 Bacteria 1157
104 Ga0075430_100629991 3300006846 Bacteria 885
105 Ga0075431_100032482 3300006847 Bacteria 5379
106 Ga0075431_100051005 3300006847 Bacteria 4267
107 Ga0075431_100366542 3300006847 Bacteria 1446
108 Ga0075431_100366978 3300006847 Bacteria 1445
109 Ga0075431_100460261 3300006847 Bacteria 1267
110 Ga0075431_100770443 3300006847 Bacteria 937
111 Ga0075434_100005901 3300006871 Bacteria 11197
112 Ga0075434_100039291 3300006871 Bacteria 4688
113 Ga0075434_100146372 3300006871 Bacteria 2383
114 Ga0075434_100168546 3300006871 Bacteria 2210
115 Ga0075429_100189478 3300006880 Bacteria 1802
116 Ga0075429_100511990 3300006880 Bacteria 1052
117 Ga0068865_100246886 3300006881 Bacteria 1407
118 Ga0097620_100009401 3300006931 Bacteria 9872
119 Ga0075435_100156378 3300007076 Bacteria 1918
120 Ga0075435_100701381 3300007076 Bacteria 880
121 Ga0111539_10124731 3300009094 Bacteria 3018
122 Ga0111539_10152147 3300009094 Bacteria 2708
123 Ga0111539_10292323 3300009094 Bacteria 1896
124 Ga0111539_10410910 3300009094 Bacteria 1576
125 Ga0105245_10049468 3300009098 Bacteria 3764
126 Ga0105247_10753094 3300009101 Bacteria 738
127 Ga0114129_10029243 3300009147 Bacteria 7803
128 Ga0114129_10044273 3300009147 Bacteria 6261
129 Ga0114129_10186621 3300009147 Bacteria 2818
130 Ga0114129_10537949 3300009147 Bacteria 1521
131 Ga0114129_10558290 3300009147 Bacteria 1488
132 Ga0105243_10046920 3300009148 Bacteria 3400
133 Ga0105243_10144706 3300009148 Bacteria 2032
134 Ga0105243_10366324 3300009148 Bacteria 1328
135 Ga0105241_10032861 3300009174 Bacteria 3892
136 Ga0105241_10913723 3300009174 Bacteria 816
137 Ga0105237_10382025 3300009545 Bacteria 1413
138 Ga0105249_10154057 3300009553 Bacteria 2215
139 Ga0105249_11414483 3300009553 Bacteria 767
140 Ga0105239_10306004 3300010375 Bacteria 1790
141 Ga0105246_10012000 3300011119 Bacteria 5396
142 Ga0105246_10173485 3300011119 Bacteria 1654
143 Ga0105246_10698111 3300011119 Bacteria 889
144 Ga0105246_10974829 3300011119 Bacteria 766
145 Ga0157326_1014078 3300012513 Unclassified 928
146 Ga0157369_10239594 3300013105 Bacteria 1895
147 Ga0157378_10153197 3300013297 Bacteria 2149
148 Ga0163162_10197792 3300013306 Bacteria 2139
149 Ga0157375_10526077 3300013308 Bacteria 1345
150 Ga0163163_10112034 3300014325 Bacteria 2757
151 Ga0157380_10076265 3300014326 Bacteria 2728
152 Ga0157380_10926626 3300014326 Bacteria 899
153 Ga0157380_11034681 3300014326 Bacteria 857
154 Ga0157379_10028672 3300014968 Bacteria 4951
155 Ga0157379_10031757 3300014968 Bacteria 4705
156 Ga0157379_10152900 3300014968 Bacteria 2082
157 Ga0157379_10293201 3300014968 Bacteria 1482
158 Ga0157379_10810640 3300014968 Bacteria 884
159 Ga0157376_10162568 3300014969 Bacteria 2026
160 Ga0209435_100006 3300025206 Bacteria 542459
161 Ga0209646_1000015 3300025246 Bacteria 542459
162 Ga0209026_1000046 3300025250 Bacteria 262031
163 Ga0209759_1000005 3300025256 Bacteria 542459
164 Ga0207647_10021766 3300025904 Bacteria 4273
165 Ga0207645_10172008 3300025907 Bacteria 1420
166 Ga0207643_10114978 3300025908 Bacteria 1588
167 Ga0207643_10221051 3300025908 Bacteria 1159
168 Ga0207684_10224097 3300025910 Bacteria 1623
169 Ga0207654_10105590 3300025911 Bacteria 1743
170 Ga0207707_10037615 3300025912 Bacteria 4230
171 Ga0207660_10086200 3300025917 Bacteria 2318
172 Ga0207660_10135735 3300025917 Bacteria 1877
173 Ga0207652_10065317 3300025921 Bacteria 3151
174 Ga0207646_10289609 3300025922 Bacteria 1480
175 Ga0207681_10777479 3300025923 Bacteria 799
176 Ga0207694_10139841 3300025924 Bacteria 1946
177 Ga0207659_10308366 3300025926 Bacteria 1302
178 Ga0207690_10013300 3300025932 Bacteria 4943
179 Ga0207706_10261858 3300025933 Bacteria 1510
180 Ga0207706_10283207 3300025933 Bacteria 1445
181 Ga0207706_10580254 3300025933 Bacteria 964
182 Ga0207709_10037927 3300025935 Bacteria 2866
183 Ga0207709_10132047 3300025935 Bacteria 1703
184 Ga0207669_10306596 3300025937 Bacteria 1209
185 Ga0207669_10678556 3300025937 Bacteria 845
186 Ga0207704_10306494 3300025938 Bacteria 1219
187 Ga0207704_10490574 3300025938 Unclassified 988
188 Ga0207689_10031028 3300025942 Bacteria 4452
189 Ga0207679_10187720 3300025945 Bacteria 1715
190 Ga0207679_10678101 3300025945 Bacteria 934
191 Ga0207667_10215552 3300025949 Bacteria 1967
192 Ga0207651_10297975 3300025960 Bacteria 1340
193 Ga0207712_10135532 3300025961 Bacteria 1882
194 Ga0207668_10149042 3300025972 Bacteria 1809
195 Ga0207658_10237579 3300025986 Bacteria 1542
196 Ga0207658_11057915 3300025986 Bacteria 741
197 Ga0207639_10019140 3300026041 Bacteria 4878
198 Ga0207678_10000550 3300026067 Bacteria 34309
199 Ga0207678_10027306 3300026067 Bacteria 4978
200 Ga0207678_10114448 3300026067 Bacteria 2301
201 Ga0207708_10018634 3300026075 Bacteria 5227
202 Ga0207708_10126363 3300026075 Bacteria 1996
203 Ga0207708_10152550 3300026075 Bacteria 1820
204 Ga0207641_11006210 3300026088 Bacteria 830
205 Ga0207648_10192931 3300026089 Bacteria 1806
206 Ga0207676_10375440 3300026095 Bacteria 1322
207 Ga0207674_10031659 3300026116 Bacteria 5553
208 Ga0207675_100122765 3300026118 Bacteria 2459
209 Ga0207675_100233939 3300026118 Bacteria 1773
210 Ga0207675_100321720 3300026118 Bacteria 1510
211 Ga0207683_10105196 3300026121 Bacteria 2523
212 Ga0207683_10146585 3300026121 Bacteria 2129
213 Ga0209813_10006522 3300027866 Bacteria 2887
214 Ga0209813_10006776 3300027866 Bacteria 2838
215 Ga0209813_10007117 3300027866 Bacteria 2779
216 Ga0207428_10104347 3300027907 Bacteria 2188
217 Ga0207428_10317934 3300027907 Unclassified 1150
218 Ga0268265_10615533 3300028380 Bacteria 1040
219 Ga0268264_10005280 3300028381 Bacteria 10940
220 Ga0307408_100070690 3300031548 Bacteria 2578
221 Ga0316576_10046242 3300031727 Bacteria 3149
222 Ga0316578_10008860 3300031728 Bacteria 5144
223 Ga0307406_10705776 3300031901 Bacteria 843
224 Ga0307412_10405873 3300031911 Bacteria 1111
225 Ga0307409_100164295 3300031995 Bacteria 1946
226 Ga0316596_1092952 3300033541 Bacteria 814
227 Ga0373958_0062542 3300034819 Unclassified 809
228 Ga0373938_0003871 3300034957 Bacteria 2472
229 Ga0373928_0062783 3300035084 Bacteria 902
230 Ga0373940_0007906 3300035088 Bacteria 2419
231 Ga0373949_0016370 3300035090 Bacteria 1662
232 Ga0373941_0091510 3300035115 Unclassified 1044
233 Ga0373945_0005545 3300035116 Bacteria 4044
234 Ga0373943_0010111 3300035170 Bacteria 4232
235 Ga0373943_0224791 3300035170 Bacteria 1047
236 Ga0373962_0009168 3300035242 Bacteria 2446
237 Ga0373931_0027378 3300035691 Bacteria 2910
238 Ga0373931_0050625 3300035691 Bacteria 2210
239 Ga0373931_0144952 3300035691 Bacteria 1379
240 Ga0373935_0005798 3300035692 Bacteria 7309
241 Ga0373927_0001269 3300035695 Bacteria 19101
242 Ga0373947_0002736 3300035725 Bacteria 10564
243 Ga0373947_0161849 3300035725 Bacteria 1448
244 Ga0316584_0066355 3300036712 Bacteria 2704
245 Ga0373925_0002428 3300037068 Bacteria 14948
246 Ga0395900_0224205 3300037418 Bacteria 1893
247 Ga0395900_0281932 3300037418 Bacteria 1653
248 Ga0395898_1069240 3300037466 Bacteria 741
249 Ga0395901_0399705 3300038443 Bacteria 1412
250 Ga0400486_16255 3300038742 Bacteria 2775
251 Ga0400487_47190 3300039110 Unclassified 1018
252 Ga0439435_0095545 3300042436 Bacteria 908
253 Ga0439440_0012164 3300042993 Bacteria 1826
254 Ga0495603_0026078 3300046455 Bacteria 3532
255 Ga0495603_0164823 3300046455 Bacteria 1285
256 Ga0495629_0021460 3300046459 Bacteria 4608
257 Ga0495580_0020485 3300046472 Bacteria 4893
258 Ga0495582_0023162 3300046473 Bacteria 3396
259 Ga0495639_0008694 3300046475 Bacteria 4353
260 Ga0495584_0008550 3300046491 Bacteria 5301
261 Ga0495584_0016252 3300046491 Bacteria 3796
262 Ga0495584_0166086 3300046491 Unclassified 1122
263 Ga0495585_0115083 3300046492 Bacteria 1427
264 Ga0495594_0000080 3300046499 Bacteria 42875
265 Ga0495583_0108703 3300046506 Bacteria 1177
266 Ga0495630_0123070 3300046517 Bacteria 1968
267 Ga0495637_0045874 3300046520 Bacteria 1851
268 Ga0495666_0016410 3300046526 Bacteria 3687
269 Ga0495640_0195759 3300046533 Bacteria 1283
270 Ga0495622_0001178 3300046557 Bacteria 13529
271 Ga0495633_0062261 3300046558 Bacteria 1747
272 Ga0495656_0241592 3300046615 Unclassified 909
273 Ga0495668_0209272 3300046616 Bacteria 1068
274 Ga0495634_0026788 3300046642 Bacteria 4019
275 Ga0495635_0042753 3300046663 Bacteria 3128
276 Ga0495588_0002228 3300046674 Bacteria 8303
277 Ga0495647_0003145 3300046681 Bacteria 5285
278 Ga0495613_0025078 3300046689 Bacteria 4443
279 Ga0495581_0002237 3300047315 Bacteria 10889
280 Ga0495676_0015708 3300047321 Bacteria 6731
281 Ga0495680_0016659 3300047322 Bacteria 6306
282 Ga0495684_0147088 3300047471 Bacteria 1764
283 Ga0495593_0008532 3300047673 Bacteria 5956
284 Ga0495614_0007980 3300048089 Bacteria 4705
285 Ga0496101_0027263 3300048904 Bacteria 3978
286 Ga0496101_0120931 3300048904 Unclassified 1980
287 Ga0496101_0511043 3300048904 Bacteria 949
288 Ga0496102_0104658 3300048905 Bacteria 2632
289 Ga0496102_0476779 3300048905 Bacteria 1169
290 Ga0496102_0528430 3300048905 Bacteria 1102
291 Ga0496103_0027456 3300048906 Bacteria 3449
292 Ga0496103_0073853 3300048906 Bacteria 2137
293 Ga0496103_0100306 3300048906 Bacteria 1832
294 Ga0496104_0000143 3300048907 Bacteria 65828
295 Ga0496104_0165931 3300048907 Bacteria 2118
296 Ga0496105_0068750 3300048908 Bacteria 2926
297 Ga0496106_0001450 3300048909 Bacteria 17806
298 Ga0496106_0121963 3300048909 Bacteria 2038
299 Ga0496106_0144673 3300048909 Bacteria 1872
300 Ga0496106_0425223 3300048909 Bacteria 1067
301 Ga0496107_0138239 3300048910 Bacteria 1800
302 Ga0496107_0173723 3300048910 Bacteria 1599
303 Ga0496107_0284164 3300048910 Bacteria 1231
304 Ga0496108_0065232 3300048911 Bacteria 3069
305 Ga0496108_0126048 3300048911 Bacteria 2198
306 Ga0496108_0200424 3300048911 Bacteria 1732
307 Ga0496109_0024003 3300048912 Bacteria 5417
308 Ga0496109_0065180 3300048912 Bacteria 3335
309 Ga0496109_0205692 3300048912 Bacteria 1851
310 Ga0496109_0793083 3300048912 Unclassified 885
311 Ga0496110_0001854 3300048913 Bacteria 15604
312 Ga0496110_0063980 3300048913 Bacteria 3250
313 Ga0496110_0128193 3300048913 Bacteria 2290
314 Ga0496110_0172410 3300048913 Bacteria 1963
315 Ga0496110_0194677 3300048913 Bacteria 1841
316 Ga0496111_0014337 3300048914 Bacteria 5413
317 Ga0496112_0058534 3300048915 Bacteria 3795
318 Ga0496113_0004311 3300048916 Bacteria 8714
319 Ga0496113_0201432 3300048916 Bacteria 1582
320 Ga0496113_0544593 3300048916 Bacteria 931
321 Ga0496114_0085872 3300048917 Bacteria 2666
322 Ga0496115_0001918 3300048918 Bacteria 14843
323 Ga0496115_0260555 3300048918 Bacteria 1426
324 Ga0496124_0183079 3300048927 Bacteria 1610
325 Ga0501031_0045097 3300049568 Bacteria 2877
326 Ga0501032_0001579 3300049569 Bacteria 18158
327 Ga0501032_0217636 3300049569 Bacteria 1244
328 Ga0501032_0294931 3300049569 Bacteria 1049
329 Ga0501032_0443667 3300049569 Bacteria 832
330 Ga0501033_0032499 3300049570 Bacteria 3919
331 Ga0501033_0090711 3300049570 Bacteria 2236
332 Ga0501034_0000031 3300049571 Bacteria 244022
333 Ga0501034_0096353 3300049571 Bacteria 2955
334 Ga0501034_0162761 3300049571 Bacteria 2201
335 Ga0501036_0175680 3300049572 Bacteria 1803
336 Ga0501036_0250887 3300049572 Bacteria 1483
337 Ga0501036_0335867 3300049572 Bacteria 1262
338 Ga0501036_0391934 3300049572 Unclassified 1159
339 Ga0501037_0052709 3300049573 Bacteria 2974
340 Ga0501037_0204632 3300049573 Bacteria 1394
341 Ga0501038_0030342 3300049574 Bacteria 4785
342 Ga0501038_0146480 3300049574 Bacteria 1928
343 Ga0501038_0502669 3300049574 Unclassified 927
344 Ga0501038_0621398 3300049574 Bacteria 816
345 Ga0501039_0000745 3300049575 Bacteria 23419
346 Ga0501039_0073856 3300049575 Bacteria 2650
347 Ga0501039_0093426 3300049575 Bacteria 2344
348 Ga0501039_0119014 3300049575 Bacteria 2069
349 Ga0501039_0622134 3300049575 Bacteria 846
350 Ga0501039_0636379 3300049575 Bacteria 835
351 Ga0501040_0016063 3300049576 Bacteria 4951
352 Ga0501040_0025848 3300049576 Bacteria 3950
353 Ga0501040_0042859 3300049576 Bacteria 3083
354 Ga0501040_0148587 3300049576 Bacteria 1652
355 Ga0501040_0189963 3300049576 Bacteria 1457
356 Ga0501040_0191531 3300049576 Bacteria 1451
357 Ga0501040_0313524 3300049576 Bacteria 1122
358 Ga0501040_0328834 3300049576 Bacteria 1094
359 Ga0501040_0372155 3300049576 Unclassified 1025
360 Ga0501040_0646980 3300049576 Bacteria 764
361 Ga0501041_0045459 3300049577 Bacteria 2669
362 Ga0501041_0152804 3300049577 Bacteria 1442
363 Ga0501041_0168870 3300049577 Bacteria 1369
364 Ga0501041_0187554 3300049577 Bacteria 1295
365 Ga0501041_0419110 3300049577 Bacteria 849
366 Ga0501042_0033080 3300049578 Bacteria 3665
367 Ga0501042_0049428 3300049578 Bacteria 3000
368 Ga0501042_0059603 3300049578 Bacteria 2725
369 Ga0501042_0084221 3300049578 Bacteria 2279
370 Ga0501042_0153901 3300049578 Bacteria 1658
371 Ga0501042_0279393 3300049578 Bacteria 1206
372 Ga0501043_0083443 3300049579 Bacteria 2512
373 Ga0501043_0128890 3300049579 Bacteria 1983
374 Ga0501043_0145232 3300049579 Bacteria 1858
375 Ga0501046_0000011 3300049580 Bacteria 326457
376 Ga0501046_0000503 3300049580 Bacteria 39054
377 Ga0501046_0006688 3300049580 Bacteria 10180
378 Ga0501046_0141567 3300049580 Bacteria 1820
379 Ga0501046_0148652 3300049580 Bacteria 1768
380 Ga0501046_0151324 3300049580 Bacteria 1750
381 Ga0501046_0220247 3300049580 Bacteria 1405
382 Ga0501046_0275499 3300049580 Bacteria 1233
383 Ga0501046_0336429 3300049580 Bacteria 1098
384 Ga0501047_0000175 3300049581 Bacteria 78925
385 Ga0501047_0034491 3300049581 Bacteria 4886
386 Ga0501047_0560384 3300049581 Bacteria 966
387 Ga0501048_0000981 3300049582 Bacteria 21148
388 Ga0501048_0046148 3300049582 Bacteria 3111
389 Ga0501048_0064586 3300049582 Bacteria 2588
390 Ga0501067_0001123 3300049583 Bacteria 14488
391 Ga0501067_0005468 3300049583 Bacteria 7047
392 Ga0501067_0130053 3300049583 Bacteria 1401
393 Ga0501070_0008008 3300049586 Bacteria 8948
394 Ga0501070_0360830 3300049586 Bacteria 1179
395 Ga0501070_0909850 3300049586 Bacteria 686
396 Ga0501071_0104775 3300049587 Unclassified 2088
397 Ga0501071_0122665 3300049587 Bacteria 1927
398 Ga0501071_0163302 3300049587 Bacteria 1665
399 Ga0501072_0070006 3300049588 Bacteria 2770
400 Ga0501072_0175264 3300049588 Bacteria 1711
401 Ga0501072_0607204 3300049588 Bacteria 862
402 Ga0501073_0347542 3300049589 Bacteria 1024
403 Ga0501073_0424781 3300049589 Bacteria 919
404 Ga0501073_0498903 3300049589 Bacteria 842
405 Ga0501074_0122518 3300049590 Bacteria 1860
406 Ga0501075_0040135 3300049591 Bacteria 3504
407 Ga0501075_0056515 3300049591 Bacteria 2954
408 Ga0501075_0085075 3300049591 Bacteria 2396
409 Ga0501075_0182419 3300049591 Bacteria 1601
410 Ga0501075_0347913 3300049591 Bacteria 1129
411 Ga0501075_0697547 3300049591 Unclassified 773
412 Ga0501076_0014438 3300049592 Bacteria 5950
413 Ga0501076_0034639 3300049592 Bacteria 3948
414 Ga0501076_0115353 3300049592 Bacteria 2173
415 Ga0501076_0178837 3300049592 Bacteria 1729
416 Ga0501076_0224198 3300049592 Bacteria 1536
417 Ga0501077_0007748 3300049593 Bacteria 6627
418 Ga0501077_0021753 3300049593 Bacteria 4060
419 Ga0501077_0137623 3300049593 Bacteria 1548
420 Ga0501077_0224277 3300049593 Bacteria 1194
421 Ga0501077_0539870 3300049593 Bacteria 748
422 Ga0501079_0038257 3300049741 Bacteria 3699
423 Ga0501079_0083511 3300049741 Bacteria 2471
424 Ga0501079_0137693 3300049741 Bacteria 1901
425 Ga0501079_0193911 3300049741 Bacteria 1586
426 Ga0501079_0251460 3300049741 Bacteria 1381
427 Ga0501079_0503500 3300049741 Bacteria 952
428 Ga0501080_0000020 3300049742 Bacteria 91998
429 Ga0501080_0058733 3300049742 Bacteria 3580
430 Ga0501080_0182696 3300049742 Bacteria 1929
431 Ga0501080_0281188 3300049742 Bacteria 1513
432 Ga0501080_0418073 3300049742 Bacteria 1205
433 Ga0501081_0012015 3300049743 Bacteria 5676
434 Ga0501081_0080287 3300049743 Bacteria 2283
435 Ga0501081_0090628 3300049743 Bacteria 2150
436 Ga0501081_0109373 3300049743 Bacteria 1961
437 Ga0501081_0124297 3300049743 Bacteria 1840
438 Ga0501081_0205670 3300049743 Unclassified 1428
439 Ga0501081_0464923 3300049743 Bacteria 940
440 Ga0501083_0130497 3300049744 Bacteria 1647
441 Ga0501083_0222334 3300049744 Bacteria 1230
442 Ga0501083_0234894 3300049744 Bacteria 1194
443 Ga0501083_0333311 3300049744 Bacteria 987
444 Ga0501083_0692650 3300049744 Bacteria 663
445 Ga0501035_0000077 3300049822 Bacteria 121242
446 Ga0501035_0072591 3300049822 Bacteria 3046
447 Ga0501035_0189386 3300049822 Bacteria 1769
448 Ga0501044_0000013 3300049823 Bacteria 248795
449 Ga0501044_0286194 3300049823 Unclassified 1581
450 Ga0501044_0341194 3300049823 Bacteria 1419
451 Ga0501045_0056106 3300049824 Bacteria 2881
452 Ga0501045_0165205 3300049824 Bacteria 1648
453 Ga0501045_0257910 3300049824 Bacteria 1298
454 nmdc:mga03n38_29590_c1 3300050490 Bacteria 2294
455 nmdc:mga03n38_43818_c1 3300050490 Bacteria 1962
456 nmdc:mga03n38_57094_c1 3300050490 Bacteria 1764
457 nmdc:mga0yw44_1640_c1 3300050492 Bacteria 9010
458 nmdc:mga0k408_42545_c1 3300050493 Bacteria 2616
459 nmdc:mga06z11_31814_c1 3300050494 Bacteria 2063
460 nmdc:mga06z11_5396_c1 3300050494 Bacteria 5124
461 nmdc:mga06z11_7967_c1 3300050494 Bacteria 4390
462 nmdc:mga06z11_952_c1 3300050494 Bacteria 10537
463 nmdc:mga04h51_224_c1 3300050495 Bacteria 15118
464 nmdc:mga04h51_3889_c1 3300050495 Bacteria 3673
465 nmdc:mga05p37_494795_c1 3300050507 Bacteria 1405
466 nmdc:mga05p37_50480_c1 3300050507 Bacteria 5116
467 nmdc:mga05p37_88024_c2 3300050507 Bacteria 3329
468 nmdc:mga05p37_90594_c1 3300050507 Bacteria 3768
469 nmdc:mga09592_276396_c1 3300050508 Bacteria 1457
470 nmdc:mga09592_321388_c1 3300050508 Bacteria 1341
471 nmdc:mga09592_509485_c1 3300050508 Bacteria 1036
472 nmdc:mga0qj67_166411_c1 3300050509 Bacteria 1790
473 nmdc:mga0qj67_260488_c1 3300050509 Bacteria 1407
474 nmdc:mga0qj67_289994_c1 3300050509 Bacteria 1326
475 nmdc:mga0qj67_333473_c1 3300050509 Bacteria 1227
476 nmdc:mga0qj67_402460_c1 3300050509 Bacteria 1105
477 nmdc:mga06r32_151535_c1 3300050510 Bacteria 2297
478 nmdc:mga06r32_18425_c1 3300050510 Bacteria 6392
479 nmdc:mga06r32_266895_c1 3300050510 Bacteria 1699
480 nmdc:mga06r32_418288_c1 3300050510 Bacteria 1322
481 nmdc:mga06r32_64786_c1 3300050510 Bacteria 3524
482 nmdc:mga08y16_150410_c1 3300050511 Bacteria 2420
483 nmdc:mga08y16_235604_c1 3300050511 Bacteria 1893
484 nmdc:mga08y16_516305_c1 3300050511 Bacteria 1212
485 nmdc:mga08y16_60673_c1 3300050511 Bacteria 3950
486 nmdc:mga08y16_87767_c1 3300050511 Bacteria 3241
487 nmdc:mga0n895_1078108_c1 3300050512 Bacteria 781
488 nmdc:mga0n895_14493_c1 3300050512 Bacteria 7162
489 nmdc:mga0n895_394761_c1 3300050512 Bacteria 1399
490 nmdc:mga0n895_496494_c1 3300050512 Bacteria 1230
491 nmdc:mga0n895_62228_c1 3300050512 Bacteria 3688
492 nmdc:mga0rr50_16392_c1 3300050513 Bacteria 4921
493 nmdc:mga08x19_397103_c1 3300050514 Bacteria 967
494 nmdc:mga0a205_198464_c1 3300050515 Bacteria 1897
495 nmdc:mga0a205_5097_c1 3300050515 Bacteria 2009
496 nmdc:mga0a205_726694_c1 3300050515 Bacteria 842
497 Ga0495601_0011981 3300053077 Bacteria 5195
498 Ga0495601_0098377 3300053077 Bacteria 1888
499 Ga0495612_0083809 3300053078 Bacteria 1342
500 Ga0495595_0011536 3300053084 Bacteria 3696
501 Ga0495619_0035600 3300053085 Bacteria 3238
502 Ga0495619_0162409 3300053085 Bacteria 1543
503 Ga0500556_0000281 3300053104 Bacteria 40052
504 Ga0500595_065969 3300053119 Bacteria 1083
505 Ga0500616_0004495 3300053153 Bacteria 9909
506 Ga0500616_0008087 3300053153 Bacteria 6579
507 Ga0500616_0125472 3300053153 Bacteria 1220
508 Ga0500645_029253 3300053730 Bacteria 1664
509 Ga0501084_0037958 3300054114 Bacteria 4026
510 Ga0501084_0060165 3300054114 Bacteria 3180
511 Ga0501084_0073462 3300054114 Bacteria 2864
512 Ga0501084_0193985 3300054114 Unclassified 1714
513 Ga0501084_0249848 3300054114 Bacteria 1497
514 Ga0501084_0256047 3300054114 Bacteria 1477
515 Ga0501084_0369322 3300054114 Bacteria 1212
516 Ga0501084_0541015 3300054114 Bacteria 984
517 Ga0501084_0556035 3300054114 Bacteria 969
518 Ga0501082_0001338 3300060353 Bacteria 21612
519 Ga0501082_0002841 3300060353 Bacteria 15085
520 Ga0501082_0032367 3300060353 Bacteria 4510
521 Ga0501082_0037061 3300060353 Bacteria 4201
522 Ga0501082_0037554 3300060353 Bacteria 4176
523 Ga0501082_0043937 3300060353 Bacteria 3854
524 Ga0501082_0056019 3300060353 Bacteria 3396
525 Ga0501082_0729170 3300060353 Bacteria 867
526 Ga0530510_0026750 3300061734 Bacteria 4131
527 Ga0530510_0222296 3300061734 Unclassified 1404
528 2899807139 2899803654 Bacteria 5577784
529 Ga0207678_10236270
530 JGI25156J39149_1000007
531 JGI25154J39366_1000013
532 JGI25157J39369_1000012
533 JGI25157J39369_1000099
534 rootH2_10060175
535 Ga0070676_10082611
536 Ga0068869_100121173
537 Ga0068869_100446206
538 Ga0070680_100013897
539 Ga0070682_100011897
540 Ga0070682_100252392
541 Ga0070689_100163536
542 Ga0070689_100407790
543 Ga0070691_10011181
544 Ga0070691_10033541
545 Ga0070691_10112125
546 Ga0070661_100123627
547 Ga0070692_10060013
548 Ga0070668_100059948
549 Ga0070668_100234313
550 Ga0070668_100320575
551 Ga0070675_100370795
552 Ga0070674_100280775
553 Ga0070673_100413305
554 Ga0070673_100458687
555 Ga0070688_100452624
556 Ga0070659_100008905
557 Ga0070667_100527201
558 Ga0070703_10048394
559 Ga0070703_10120720
560 Ga0070701_10098422
561 Ga0070700_100016937
562 Ga0070700_100078951
563 Ga0070700_100473258
564 Ga0070694_100033837
565 Ga0070694_100039843
566 Ga0070694_100082888
567 Ga0070694_100308267
568 Ga0070708_100104572
569 Ga0070663_100024966
570 Ga0070663_100041570
571 Ga0070663_100194976
572 Ga0070663_100654048
573 Ga0070663_101047482
574 Ga0070678_100011483
575 Ga0070678_100904130
576 Ga0070662_100087959
577 Ga0070662_100270814
578 Ga0070662_100561509
579 Ga0070662_100578161
580 Ga0070681_10100680
581 Ga0068867_100290387
582 Ga0070706_100175998
583 Ga0070707_100304273
584 Ga0070699_100015213
585 Ga0070679_100066132
586 Ga0070697_100030901
587 Ga0068853_100044798
588 Ga0070695_100000774
589 Ga0070695_100001145
590 Ga0070696_100074252
591 Ga0070696_100640333
592 Ga0070693_100167520
593 Ga0070704_100008998
594 Ga0070704_100324635
595 Ga0068855_100148941
596 Ga0070664_100179504
597 Ga0070664_100343453
598 Ga0068857_100091768
599 Ga0068857_100106947
600 Ga0068852_100192939
601 Ga0068859_100009400
602 Ga0068864_100297152
603 Ga0068861_100158005
604 Ga0068861_100234132
605 Ga0068861_100256142
606 Ga0068863_100592194
607 Ga0068858_100619925
608 Ga0068860_100063001
609 Ga0068860_100867402
610 Ga0068862_100139953
611 Ga0081455_10000334
612 Ga0081455_10029756
613 Ga0081540_1000179
614 Ga0075365_10036488
615 Ga0075368_10000723
616 Ga0075368_10236539
617 Ga0075363_100032318
618 Ga0075363_100079119
619 Ga0075364_10042404
620 Ga0070715_10040215
621 Ga0075367_10000521
622 Ga0075367_10002168
623 Ga0075367_10004325
624 Ga0075366_10042560
625 Ga0075428_100152654
626 Ga0075428_100195467
627 Ga0075428_100533682
628 Ga0075428_100898182
629 Ga0075428_101001116
630 Ga0075430_100120893
631 Ga0075430_100385123
632 Ga0075430_100629991
633 Ga0075431_100032482
634 Ga0075431_100051005
635 Ga0075431_100366542
636 Ga0075431_100366978
637 Ga0075431_100460261
638 Ga0075431_100770443
639 Ga0075434_100005901
640 Ga0075434_100039291
641 Ga0075434_100146372
642 Ga0075434_100168546
643 Ga0075429_100189478
644 Ga0075429_100511990
645 Ga0068865_100246886
646 Ga0097620_100009401
647 Ga0075435_100156378
648 Ga0075435_100701381
649 Ga0111539_10124731
650 Ga0111539_10152147
651 Ga0111539_10292323
652 Ga0111539_10410910
653 Ga0105245_10049468
654 Ga0105247_10753094
655 Ga0114129_10029243
656 Ga0114129_10044273
657 Ga0114129_10186621
658 Ga0114129_10537949
659 Ga0114129_10558290
660 Ga0105243_10046920
661 Ga0105243_10144706
662 Ga0105243_10366324
663 Ga0105241_10032861
664 Ga0105241_10913723
665 Ga0105237_10382025
666 Ga0105249_10154057
667 Ga0105249_11414483
668 Ga0105239_10306004
669 Ga0105246_10012000
670 Ga0105246_10173485
671 Ga0105246_10698111
672 Ga0105246_10974829
673 Ga0157326_1014078
674 Ga0157369_10239594
675 Ga0157378_10153197
676 Ga0163162_10197792
677 Ga0157375_10526077
678 Ga0163163_10112034
679 Ga0157380_10076265
680 Ga0157380_10926626
681 Ga0157380_11034681
682 Ga0157379_10028672
683 Ga0157379_10031757
684 Ga0157379_10152900
685 Ga0157379_10293201
686 Ga0157379_10810640
687 Ga0157376_10162568
688 Ga0209435_100006
689 Ga0209646_1000015
690 Ga0209026_1000046
691 Ga0209759_1000005
692 Ga0207647_10021766
693 Ga0207645_10172008
694 Ga0207643_10114978
695 Ga0207643_10221051
696 Ga0207684_10224097
697 Ga0207654_10105590
698 Ga0207707_10037615
699 Ga0207660_10086200
700 Ga0207660_10135735
701 Ga0207652_10065317
702 Ga0207646_10289609
703 Ga0207681_10777479
704 Ga0207694_10139841
705 Ga0207659_10308366
706 Ga0207690_10013300
707 Ga0207706_10261858
708 Ga0207706_10283207
709 Ga0207706_10580254
710 Ga0207709_10037927
711 Ga0207709_10132047
712 Ga0207669_10306596
713 Ga0207669_10678556
714 Ga0207704_10306494
715 Ga0207704_10490574
716 Ga0207689_10031028
717 Ga0207679_10187720
718 Ga0207679_10678101
719 Ga0207667_10215552
720 Ga0207651_10297975
721 Ga0207712_10135532
722 Ga0207668_10149042
723 Ga0207658_10237579
724 Ga0207658_11057915
725 Ga0207639_10019140
726 Ga0207678_10000550
727 Ga0207678_10027306
728 Ga0207678_10114448
729 Ga0207708_10018634
730 Ga0207708_10126363
731 Ga0207708_10152550
732 Ga0207641_11006210
733 Ga0207648_10192931
734 Ga0207676_10375440
735 Ga0207674_10031659
736 Ga0207675_100122765
737 Ga0207675_100233939
738 Ga0207675_100321720
739 Ga0207683_10105196
740 Ga0207683_10146585
741 Ga0209813_10006522
742 Ga0209813_10006776
743 Ga0209813_10007117
744 Ga0207428_10104347
745 Ga0207428_10317934
746 Ga0268265_10615533
747 Ga0268264_10005280
748 Ga0307408_100070690
749 Ga0316576_10046242
750 Ga0316578_10008860
751 Ga0307406_10705776
752 Ga0307412_10405873
753 Ga0307409_100164295
754 Ga0316596_1092952
755 Ga0373958_0062542
756 Ga0373938_0003871
757 Ga0373928_0062783
758 Ga0373940_0007906
759 Ga0373949_0016370
760 Ga0373941_0091510
761 Ga0373945_0005545
762 Ga0373943_0010111
763 Ga0373943_0224791
764 Ga0373962_0009168
765 Ga0373931_0027378
766 Ga0373931_0050625
767 Ga0373931_0144952
768 Ga0373935_0005798
769 Ga0373927_0001269
770 Ga0373947_0002736
771 Ga0373947_0161849
772 Ga0316584_0066355
773 Ga0373925_0002428
774 Ga0395900_0224205
775 Ga0395900_0281932
776 Ga0395898_1069240
777 Ga0395901_0399705
778 Ga0400486_16255
779 Ga0400487_47190
780 Ga0439435_0095545
781 Ga0439440_0012164
782 Ga0495603_0026078
783 Ga0495603_0164823
784 Ga0495629_0021460
785 Ga0495580_0020485
786 Ga0495582_0023162
787 Ga0495639_0008694
788 Ga0495584_0008550
789 Ga0495584_0016252
790 Ga0495584_0166086
791 Ga0495585_0115083
792 Ga0495594_0000080
793 Ga0495583_0108703
794 Ga0495630_0123070
795 Ga0495637_0045874
796 Ga0495666_0016410
797 Ga0495640_0195759
798 Ga0495622_0001178
799 Ga0495633_0062261
800 Ga0495656_0241592
801 Ga0495668_0209272
802 Ga0495634_0026788
803 Ga0495635_0042753
804 Ga0495588_0002228
805 Ga0495647_0003145
806 Ga0495613_0025078
807 Ga0495581_0002237
808 Ga0495676_0015708
809 Ga0495680_0016659
810 Ga0495684_0147088
811 Ga0495593_0008532
812 Ga0495614_0007980
813 Ga0496101_0027263
814 Ga0496101_0120931
815 Ga0496101_0511043
816 Ga0496102_0104658
817 Ga0496102_0476779
818 Ga0496102_0528430
819 Ga0496103_0027456
820 Ga0496103_0073853
821 Ga0496103_0100306
822 Ga0496104_0000143
823 Ga0496104_0165931
824 Ga0496105_0068750
825 Ga0496106_0001450
826 Ga0496106_0121963
827 Ga0496106_0144673
828 Ga0496106_0425223
829 Ga0496107_0138239
830 Ga0496107_0173723
831 Ga0496107_0284164
832 Ga0496108_0065232
833 Ga0496108_0126048
834 Ga0496108_0200424
835 Ga0496109_0024003
836 Ga0496109_0065180
837 Ga0496109_0205692
838 Ga0496109_0793083
839 Ga0496110_0001854
840 Ga0496110_0063980
841 Ga0496110_0128193
842 Ga0496110_0172410
843 Ga0496110_0194677
844 Ga0496111_0014337
845 Ga0496112_0058534
846 Ga0496113_0004311
847 Ga0496113_0201432
848 Ga0496113_0544593
849 Ga0496114_0085872
850 Ga0496115_0001918
851 Ga0496115_0260555
852 Ga0496124_0183079
853 Ga0501031_0045097
854 Ga0501032_0001579
855 Ga0501032_0217636
856 Ga0501032_0294931
857 Ga0501032_0443667
858 Ga0501033_0032499
859 Ga0501033_0090711
860 Ga0501034_0000031
861 Ga0501034_0096353
862 Ga0501034_0162761
863 Ga0501036_0175680
864 Ga0501036_0250887
865 Ga0501036_0335867
866 Ga0501036_0391934
867 Ga0501037_0052709
868 Ga0501037_0204632
869 Ga0501038_0030342
870 Ga0501038_0146480
871 Ga0501038_0502669
872 Ga0501038_0621398
873 Ga0501039_0000745
874 Ga0501039_0073856
875 Ga0501039_0093426
876 Ga0501039_0119014
877 Ga0501039_0622134
878 Ga0501039_0636379
879 Ga0501040_0016063
880 Ga0501040_0025848
881 Ga0501040_0042859
882 Ga0501040_0148587
883 Ga0501040_0189963
884 Ga0501040_0191531
885 Ga0501040_0313524
886 Ga0501040_0328834
887 Ga0501040_0372155
888 Ga0501040_0646980
889 Ga0501041_0045459
890 Ga0501041_0152804
891 Ga0501041_0168870
892 Ga0501041_0187554
893 Ga0501041_0419110
894 Ga0501042_0033080
895 Ga0501042_0049428
896 Ga0501042_0059603
897 Ga0501042_0084221
898 Ga0501042_0153901
899 Ga0501042_0279393
900 Ga0501043_0083443
901 Ga0501043_0128890
902 Ga0501043_0145232
903 Ga0501046_0000011
904 Ga0501046_0000503
905 Ga0501046_0006688
906 Ga0501046_0141567
907 Ga0501046_0148652
908 Ga0501046_0151324
909 Ga0501046_0220247
910 Ga0501046_0275499
911 Ga0501046_0336429
912 Ga0501047_0000175
913 Ga0501047_0034491
914 Ga0501047_0560384
915 Ga0501048_0000981
916 Ga0501048_0046148
917 Ga0501048_0064586
918 Ga0501067_0001123
919 Ga0501067_0005468
920 Ga0501067_0130053
921 Ga0501070_0008008
922 Ga0501070_0360830
923 Ga0501070_0909850
924 Ga0501071_0104775
925 Ga0501071_0122665
926 Ga0501071_0163302
927 Ga0501072_0070006
928 Ga0501072_0175264
929 Ga0501072_0607204
930 Ga0501073_0347542
931 Ga0501073_0424781
932 Ga0501073_0498903
933 Ga0501074_0122518
934 Ga0501075_0040135
935 Ga0501075_0056515
936 Ga0501075_0085075
937 Ga0501075_0182419
938 Ga0501075_0347913
939 Ga0501075_0697547
940 Ga0501076_0014438
941 Ga0501076_0034639
942 Ga0501076_0115353
943 Ga0501076_0178837
944 Ga0501076_0224198
945 Ga0501077_0007748
946 Ga0501077_0021753
947 Ga0501077_0137623
948 Ga0501077_0224277
949 Ga0501077_0539870
950 Ga0501079_0038257
951 Ga0501079_0083511
952 Ga0501079_0137693
953 Ga0501079_0193911
954 Ga0501079_0251460
955 Ga0501079_0503500
956 Ga0501080_0000020
957 Ga0501080_0058733
958 Ga0501080_0182696
959 Ga0501080_0281188
960 Ga0501080_0418073
961 Ga0501081_0012015
962 Ga0501081_0080287
963 Ga0501081_0090628
964 Ga0501081_0109373
965 Ga0501081_0124297
966 Ga0501081_0205670
967 Ga0501081_0464923
968 Ga0501083_0130497
969 Ga0501083_0222334
970 Ga0501083_0234894
971 Ga0501083_0333311
972 Ga0501083_0692650
973 Ga0501035_0000077
974 Ga0501035_0072591
975 Ga0501035_0189386
976 Ga0501044_0000013
977 Ga0501044_0286194
978 Ga0501044_0341194
979 Ga0501045_0056106
980 Ga0501045_0165205
981 Ga0501045_0257910
982 nmdc:mga03n38_29590_c1
983 nmdc:mga03n38_43818_c1
984 nmdc:mga03n38_57094_c1
985 nmdc:mga0yw44_1640_c1
986 nmdc:mga0k408_42545_c1
987 nmdc:mga06z11_31814_c1
988 nmdc:mga06z11_5396_c1
989 nmdc:mga06z11_7967_c1
990 nmdc:mga06z11_952_c1
991 nmdc:mga04h51_224_c1
992 nmdc:mga04h51_3889_c1
993 nmdc:mga05p37_494795_c1
994 nmdc:mga05p37_50480_c1
995 nmdc:mga05p37_88024_c2
996 nmdc:mga05p37_90594_c1
997 nmdc:mga09592_276396_c1
998 nmdc:mga09592_321388_c1
999 nmdc:mga09592_509485_c1
1000 nmdc:mga0qj67_166411_c1
1001 nmdc:mga0qj67_260488_c1
1002 nmdc:mga0qj67_289994_c1
1003 nmdc:mga0qj67_333473_c1
1004 nmdc:mga0qj67_402460_c1
1005 nmdc:mga06r32_151535_c1
1006 nmdc:mga06r32_18425_c1
1007 nmdc:mga06r32_266895_c1
1008 nmdc:mga06r32_418288_c1
1009 nmdc:mga06r32_64786_c1
1010 nmdc:mga08y16_150410_c1
1011 nmdc:mga08y16_235604_c1
1012 nmdc:mga08y16_516305_c1
1013 nmdc:mga08y16_60673_c1
1014 nmdc:mga08y16_87767_c1
1015 nmdc:mga0n895_1078108_c1
1016 nmdc:mga0n895_14493_c1
1017 nmdc:mga0n895_394761_c1
1018 nmdc:mga0n895_496494_c1
1019 nmdc:mga0n895_62228_c1
1020 nmdc:mga0rr50_16392_c1
1021 nmdc:mga08x19_397103_c1
1022 nmdc:mga0a205_198464_c1
1023 nmdc:mga0a205_5097_c1
1024 nmdc:mga0a205_726694_c1
1025 Ga0495601_0011981
1026 Ga0495601_0098377
1027 Ga0495612_0083809
1028 Ga0495595_0011536
1029 Ga0495619_0035600
1030 Ga0495619_0162409
1031 Ga0500556_0000281
1032 Ga0500595_065969
1033 Ga0500616_0004495
1034 Ga0500616_0008087
1035 Ga0500616_0125472
1036 Ga0500645_029253
1037 Ga0501084_0037958
1038 Ga0501084_0060165
1039 Ga0501084_0073462
1040 Ga0501084_0193985
1041 Ga0501084_0249848
1042 Ga0501084_0256047
1043 Ga0501084_0369322
1044 Ga0501084_0541015
1045 Ga0501084_0556035
1046 Ga0501082_0001338
1047 Ga0501082_0002841
1048 Ga0501082_0032367
1049 Ga0501082_0037061
1050 Ga0501082_0037554
1051 Ga0501082_0043937
1052 Ga0501082_0056019
1053 Ga0501082_0729170
1054 Ga0530510_0026750
1055 Ga0530510_0222296
1056 2899807139

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02581

TMP-TENI

Thiamine monophosphate synthase

13

186

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1g4t-assembly1.cif.gz_A thiamin phosphate synthase 0.8779 4 198
1g67-assembly1.cif.gz_A thiamin phosphate synthase 0.8767 6 198
1xi3-assembly1.cif.gz_B thiamine phosphate pyrophosphorylase from pyrococcus furiosus pfu-1255191-001 0.8705 4 197
3nm1-assembly1.cif.gz_E the crystal structure of candida glabrata thi6, a bifunctional enzyme involved in thiamin biosyhthesis of eukaryotes 0.8676 4 197
3nm1-assembly1.cif.gz_F the crystal structure of candida glabrata thi6, a bifunctional enzyme involved in thiamin biosyhthesis of eukaryotes 0.8518 6 197
ID Description Score Start End Superfamily
af_P30137_10_206_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9678 4 196 3.20.20.70
af_P30137_10_206_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.944 4 196 3.20.20.70
af_A0A1D6MYJ2_339_548_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8892 6 197 3.20.20.70
af_Q2FWG3_1_212_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8883 6 197 3.20.20.70
1xi3B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8705 4 197 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A178XN77-F1-model_v4 Thiamine-phosphate synthase (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) 0.9999 1 197 GO:0004789
GO:0005737
GO:0009228
GO:0009229
GO:0046872
AF-A0A4S0XVW4-F1-model_v4 deleted 0.9999 1 197
AF-A0A1W2AFB1-F1-model_v4 Thiamine-phosphate synthase (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) 0.9994 3 198 GO:0004789
GO:0005737
GO:0009228
GO:0009229
GO:0046872
AF-A0A090EZZ4-F1-model_v4 Thiamine-phosphate synthase (EC 2.5.1.3) 0.9994 34 197 GO:0004789
GO:0005737
GO:0009228
GO:0046872
AF-K2MPQ9-F1-model_v4 Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) 0.9993 1 197 GO:0000287
GO:0004789
GO:0005737
GO:0009228
GO:0009229

Map