F459651

General Info

Members Datasets Scaffolds Average Seq Length
528 250 1056 301

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10014687|Ga0081539_100146873
Length 329
Sequence VLDDSLASLTHDRHCGSLARVSFPLSARPVVLGAVAAGAGLTAYALAEARAYTLRRVTVRVLPPGSPDMRVLHLSDLHLTPGQRRKQAWLRELAGLRPDLVVDTGDNIGHRDSVPLLLDCLAGLTGIPGVFVLGSNDYYSPTLRNPIRYLLPDDGKRHTDTPQLPWREMRDELTGRLGWSDLTNRRTVLEVRGMRIAFAGVDDPHLGYDRLEEVAGPAEPDADLRLAVAHAPYLRVLDRFAADGYDAVLAGHTHGGQVCLPGIGALTTNCDLEPARAKGLHRHPAGSRPGDAGSSWLHVSAGLGTSPYARIRVACRPEATLLTLVPIEP

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
115 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
116 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
117 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
118 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
119 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
120 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
121 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
122 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
123 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
124 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
125 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
126 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
127 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
206 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
207 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
208 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
209 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
210 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
222 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
223 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
224 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
225 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
230 2643221561 Nocardioides sp. Root151 Isolate Unclassified
231 2643221576 Nocardioides sp. Root614 Isolate Unclassified
232 2643221590 Nocardioides sp. Root682 Isolate Unclassified
233 2643221604 Nocardioides sp. Root190 Isolate Unclassified
234 2643221615 Nocardioides sp. Root224 Isolate Unclassified
235 2643221617 Nocardioides sp. Root79 Isolate Unclassified
236 2643221641 Nocardioides sp. Root122 Isolate Unclassified
237 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
238 2643221696 Nocardioides sp. Root140 Isolate Unclassified
239 2738541305 Nocardioides sp. CF167 Isolate Unclassified
240 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
241 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
242 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
243 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
244 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
245 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
246 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
247 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
248 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
249 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
250 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.02
Metatranscriptomes 0
Isolates 3.98

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 9.66
Nodule 0.19
Rhizoplane 7.58
Rhizosphere 79.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10014687 3300005985 Bacteria 5762
2 JGI25407J50210_10017096 3300003373 Bacteria 1881
3 Ga0070658_10021285 3300005327 Bacteria 5196
4 Ga0070658_10062942 3300005327 Bacteria 3024
5 Ga0070683_100001487 3300005329 Bacteria 18080
6 Ga0070683_100005084 3300005329 Bacteria 10930
7 Ga0070683_100162729 3300005329 Bacteria 2117
8 Ga0070683_100182901 3300005329 Bacteria 1990
9 Ga0068869_100010586 3300005334 Bacteria 6020
10 Ga0070660_100027312 3300005339 Bacteria 4258
11 Ga0070689_100246254 3300005340 Bacteria 1474
12 Ga0070692_10015822 3300005345 Bacteria 3576
13 Ga0070675_100152197 3300005354 Bacteria 1984
14 Ga0070688_100111944 3300005365 Bacteria 1817
15 Ga0070659_100048294 3300005366 Bacteria 3343
16 Ga0070667_100029053 3300005367 Bacteria 4605
17 Ga0070709_10083781 3300005434 Bacteria 2086
18 Ga0070714_100012888 3300005435 Bacteria 6685
19 Ga0070713_100252746 3300005436 Bacteria 1608
20 Ga0070710_10120892 3300005437 Bacteria 1585
21 Ga0070663_100114267 3300005455 Bacteria 2033
22 Ga0070663_100153081 3300005455 Bacteria 1770
23 Ga0070662_100250110 3300005457 Bacteria 1425
24 Ga0068867_100348129 3300005459 Bacteria 1236
25 Ga0070685_10020895 3300005466 Bacteria 3550
26 Ga0070685_10226416 3300005466 Bacteria 1228
27 Ga0070707_100125553 3300005468 Bacteria 2493
28 Ga0070707_100505288 3300005468 Bacteria 1171
29 Ga0070679_100003923 3300005530 Bacteria 13682
30 Ga0070684_100000262 3300005535 Bacteria 36422
31 Ga0070684_100156944 3300005535 Bacteria 2063
32 Ga0068853_100182097 3300005539 Bacteria 1906
33 Ga0070665_100053151 3300005548 Bacteria 4062
34 Ga0070665_100456389 3300005548 Bacteria 1288
35 Ga0068855_100017677 3300005563 Bacteria 8576
36 Ga0070664_100018551 3300005564 Bacteria 5718
37 Ga0070664_100348468 3300005564 Bacteria 1346
38 Ga0070664_100374441 3300005564 Bacteria 1299
39 Ga0068856_100054529 3300005614 Bacteria 3943
40 Ga0068856_100225640 3300005614 Bacteria 1889
41 Ga0070702_100081893 3300005615 Bacteria 1935
42 Ga0068861_100122410 3300005719 Bacteria 2101
43 Ga0068860_100049352 3300005843 Bacteria 4008
44 Ga0081455_10029803 3300005937 Bacteria 4970
45 Ga0081538_10001513 3300005981 Bacteria 23849
46 Ga0081538_10002385 3300005981 Bacteria 18449
47 Ga0081538_10006455 3300005981 Bacteria 10320
48 Ga0081538_10009975 3300005981 Bacteria 7841
49 Ga0081538_10012231 3300005981 Bacteria 6894
50 Ga0081538_10017230 3300005981 Bacteria 5495
51 Ga0081538_10062231 3300005981 Bacteria 2130
52 Ga0081538_10166892 3300005981 Bacteria 968
53 Ga0081539_10006567 3300005985 Bacteria 11075
54 Ga0081539_10050700 3300005985 Bacteria 2346
55 Ga0081539_10052438 3300005985 Bacteria 2291
56 Ga0081539_10091417 3300005985 Bacteria 1572
57 Ga0081539_10097433 3300005985 Bacteria 1506
58 Ga0070717_10115187 3300006028 Bacteria 2297
59 Ga0070717_10351207 3300006028 Bacteria 1318
60 Ga0075365_10001139 3300006038 Bacteria 11639
61 Ga0075365_10049187 3300006038 Bacteria 2777
62 Ga0075365_10080147 3300006038 Bacteria 2210
63 Ga0075363_100004620 3300006048 Bacteria 6049
64 Ga0075363_100007988 3300006048 Bacteria 4904
65 Ga0075363_100015632 3300006048 Bacteria 3734
66 Ga0075363_100098493 3300006048 Bacteria 1616
67 Ga0075364_10015872 3300006051 Bacteria 4675
68 Ga0075364_10018979 3300006051 Bacteria 4313
69 Ga0075364_10050967 3300006051 Bacteria 2702
70 Ga0075364_10079532 3300006051 Bacteria 2166
71 Ga0075364_10205088 3300006051 Bacteria 1337
72 Ga0075432_10020800 3300006058 Bacteria 2244
73 Ga0075362_10016202 3300006177 Bacteria 3048
74 Ga0075367_10001582 3300006178 Bacteria 9864
75 Ga0075367_10005746 3300006178 Bacteria 6198
76 Ga0075367_10109769 3300006178 Bacteria 1692
77 Ga0075369_10091750 3300006186 Bacteria 1356
78 Ga0075427_10010162 3300006194 Bacteria 1406
79 Ga0097621_100175382 3300006237 Bacteria 1850
80 Ga0075370_10020427 3300006353 Bacteria 3620
81 Ga0075370_10047600 3300006353 Bacteria 2428
82 Ga0075370_10068253 3300006353 Bacteria 2030
83 Ga0068871_100161000 3300006358 Bacteria 1920
84 Ga0075428_100026557 3300006844 Bacteria 6410
85 Ga0075430_100261446 3300006846 Bacteria 1433
86 Ga0075431_100014879 3300006847 Bacteria 7877
87 Ga0075433_10128370 3300006852 Bacteria 2252
88 Ga0075434_100340516 3300006871 Bacteria 1521
89 Ga0068865_100016252 3300006881 Bacteria 4758
90 Ga0111539_10016622 3300009094 Bacteria 9118
91 Ga0105245_10280347 3300009098 Bacteria 1629
92 Ga0105245_10530553 3300009098 Bacteria 1197
93 Ga0114129_10057285 3300009147 Bacteria 5455
94 Ga0114129_10394225 3300009147 Bacteria 1826
95 Ga0105242_10480663 3300009176 Bacteria 1177
96 Ga0105249_10043155 3300009553 Bacteria 4102
97 Ga0105249_10168432 3300009553 Bacteria 2122
98 Ga0105239_10021731 3300010375 Bacteria 7073
99 Ga0157370_10336696 3300013104 Bacteria 1391
100 Ga0157369_10069058 3300013105 Bacteria 3796
101 Ga0163162_10151696 3300013306 Bacteria 2436
102 Ga0157375_10166142 3300013308 Bacteria 2352
103 Ga0157375_10484490 3300013308 Bacteria 1402
104 Ga0163163_10085004 3300014325 Bacteria 3172
105 Ga0163163_10276922 3300014325 Bacteria 1729
106 Ga0157377_10012380 3300014745 Bacteria 4290
107 Ga0163161_10109351 3300017792 Bacteria 2065
108 Ga0163161_10116063 3300017792 Bacteria 2007
109 Ga0207688_10120376 3300025901 Bacteria 1531
110 Ga0207647_10002943 3300025904 Bacteria 12814
111 Ga0207684_10210950 3300025910 Bacteria 1675
112 Ga0207693_10269986 3300025915 Bacteria 1333
113 Ga0207657_10039956 3300025919 Bacteria 4161
114 Ga0207657_10119250 3300025919 Bacteria 2171
115 Ga0207652_10040667 3300025921 Bacteria 3949
116 Ga0207659_10456891 3300025926 Bacteria 1076
117 Ga0207687_10009664 3300025927 Bacteria 6307
118 Ga0207664_10082878 3300025929 Bacteria 2613
119 Ga0207690_10059572 3300025932 Bacteria 2587
120 Ga0207706_10083076 3300025933 Bacteria 2815
121 Ga0207709_10235798 3300025935 Bacteria 1328
122 Ga0207704_10173644 3300025938 Bacteria 1549
123 Ga0207665_10066821 3300025939 Bacteria 2447
124 Ga0207661_10016497 3300025944 Bacteria 5450
125 Ga0207661_10018004 3300025944 Bacteria 5244
126 Ga0207661_10295561 3300025944 Bacteria 1451
127 Ga0207712_10140480 3300025961 Bacteria 1853
128 Ga0207712_10164961 3300025961 Bacteria 1726
129 Ga0207658_10036321 3300025986 Bacteria 3532
130 Ga0207703_10258375 3300026035 Bacteria 1573
131 Ga0207639_10029162 3300026041 Bacteria 4037
132 Ga0207678_10026272 3300026067 Bacteria 5080
133 Ga0207678_10123439 3300026067 Bacteria 2210
134 Ga0207708_10035443 3300026075 Bacteria 3797
135 Ga0207648_10294918 3300026089 Bacteria 1453
136 Ga0207674_10009716 3300026116 Bacteria 10965
137 Ga0207675_100035773 3300026118 Bacteria 4632
138 Ga0207675_100205820 3300026118 Bacteria 1891
139 Ga0207683_10017903 3300026121 Bacteria 6041
140 Ga0207428_10002650 3300027907 Bacteria 17835
141 Ga0268266_10008193 3300028379 Bacteria 9321
142 Ga0268266_10087581 3300028379 Bacteria 2725
143 Ga0268264_10000343 3300028381 Bacteria 71702
144 Ga0268264_10094576 3300028381 Bacteria 2584
145 Ga0307515_10072752 3300028794 Bacteria 4632
146 Ga0307408_100004716 3300031548 Bacteria 9203
147 Ga0307408_100009365 3300031548 Bacteria 6456
148 Ga0316576_10000951 3300031727 Bacteria 14821
149 Ga0307405_10002996 3300031731 Bacteria 7640
150 Ga0307405_10018416 3300031731 Bacteria 3852
151 Ga0307405_10034073 3300031731 Bacteria 3026
152 Ga0307405_10106155 3300031731 Bacteria 1893
153 Ga0307405_10308216 3300031731 Bacteria 1204
154 Ga0307413_10002233 3300031824 Bacteria 7807
155 Ga0307413_10029029 3300031824 Bacteria 3089
156 Ga0307413_10037227 3300031824 Bacteria 2809
157 Ga0307413_10194976 3300031824 Bacteria 1457
158 Ga0307413_10268518 3300031824 Bacteria 1276
159 Ga0307410_10003477 3300031852 Bacteria 7906
160 Ga0307410_10076228 3300031852 Bacteria 2340
161 Ga0307410_10121977 3300031852 Bacteria 1902
162 Ga0307410_10124972 3300031852 Bacteria 1882
163 Ga0307406_10007310 3300031901 Bacteria 6118
164 Ga0307406_10057403 3300031901 Bacteria 2496
165 Ga0307407_10002115 3300031903 Bacteria 7628
166 Ga0307407_10039055 3300031903 Bacteria 2636
167 Ga0307407_10046057 3300031903 Bacteria 2468
168 Ga0307407_10091149 3300031903 Bacteria 1868
169 Ga0307407_10243396 3300031903 Bacteria 1228
170 Ga0307412_10017299 3300031911 Bacteria 4314
171 Ga0307412_10075605 3300031911 Bacteria 2311
172 Ga0307412_10220534 3300031911 Bacteria 1453
173 Ga0307412_10222767 3300031911 Bacteria 1447
174 Ga0307412_10313869 3300031911 Bacteria 1244
175 Ga0307409_100000784 3300031995 Bacteria 14423
176 Ga0307409_100004996 3300031995 Bacteria 7552
177 Ga0307409_100081956 3300031995 Bacteria 2610
178 Ga0307409_100147548 3300031995 Bacteria 2036
179 Ga0307409_100153136 3300031995 Bacteria 2005
180 Ga0307409_100209040 3300031995 Bacteria 1752
181 Ga0307409_100254316 3300031995 Bacteria 1608
182 Ga0307409_100388898 3300031995 Bacteria 1328
183 Ga0307416_100001624 3300032002 Bacteria 12376
184 Ga0307416_100004150 3300032002 Bacteria 8679
185 Ga0307416_100007478 3300032002 Bacteria 6951
186 Ga0307416_100009427 3300032002 Bacteria 6389
187 Ga0307416_100016008 3300032002 Bacteria 5198
188 Ga0307416_100096621 3300032002 Bacteria 2555
189 Ga0307416_100307188 3300032002 Bacteria 1580
190 Ga0307416_100675935 3300032002 Bacteria 1119
191 Ga0307414_10014870 3300032004 Bacteria 4683
192 Ga0307414_10045866 3300032004 Bacteria 2996
193 Ga0307414_10215962 3300032004 Bacteria 1571
194 Ga0307414_10338992 3300032004 Bacteria 1286
195 Ga0307411_10020968 3300032005 Bacteria 3813
196 Ga0307411_10108038 3300032005 Bacteria 1984
197 Ga0307411_10200371 3300032005 Bacteria 1532
198 Ga0307415_100003850 3300032126 Bacteria 7697
199 Ga0307415_100005817 3300032126 Bacteria 6589
200 Ga0307415_100010759 3300032126 Bacteria 5198
201 Ga0307415_100015073 3300032126 Bacteria 4565
202 Ga0307415_100015486 3300032126 Bacteria 4517
203 Ga0307415_100049310 3300032126 Bacteria 2846
204 Ga0307415_100054639 3300032126 Bacteria 2727
205 Ga0307415_100074831 3300032126 Bacteria 2395
206 Ga0307415_100204717 3300032126 Bacteria 1569
207 Ga0307415_100207485 3300032126 Bacteria 1560
208 Ga0307415_100228992 3300032126 Bacteria 1495
209 Ga0373923_0095436 3300035111 Bacteria 1306
210 Ga0373955_0144616 3300035172 Bacteria 1396
211 Ga0395899_0007916 3300037312 Bacteria 8187
212 Ga0395900_0034547 3300037418 Bacteria 5208
213 Ga0395898_0298561 3300037466 Bacteria 1537
214 Ga0395905_0040537 3300037471 Bacteria 4369
215 Ga0395905_0107122 3300037471 Bacteria 2624
216 Ga0395905_0291761 3300037471 Bacteria 1518
217 Ga0395905_0607024 3300037471 Bacteria 996
218 Ga0395901_0042933 3300038443 Bacteria 4690
219 Ga0395901_0079434 3300038443 Bacteria 3426
220 Ga0395901_0515024 3300038443 Bacteria 1216
221 Ga0439438_081086 3300041405 Bacteria 796
222 Ga0439447_031504 3300041407 Bacteria 1331
223 Ga0439448_0000094 3300042005 Bacteria 15876
224 Ga0439448_0009868 3300042005 Bacteria 2820
225 Ga0439450_000153 3300042008 Bacteria 7608
226 Ga0439451_010395 3300042009 Bacteria 1876
227 Ga0439463_000140 3300042016 Bacteria 18289
228 Ga0450888_005685 3300042126 Bacteria 1337
229 Ga0450905_002105 3300042142 Bacteria 2542
230 Ga0439446_0015230 3300042156 Bacteria 2132
231 Ga0439458_0029640 3300042157 Bacteria 1299
232 Ga0439460_0000416 3300042461 Bacteria 9096
233 Ga0439460_0065886 3300042461 Bacteria 1113
234 Ga0439440_0000567 3300042993 Bacteria 6265
235 Ga0439440_0002481 3300042993 Bacteria 3492
236 Ga0466972_0146376 3300044658 Bacteria 1111
237 Ga0466965_0032696 3300044683 Bacteria 2541
238 Ga0466965_0044257 3300044683 Bacteria 2200
239 Ga0466965_0103317 3300044683 Bacteria 1459
240 Ga0466965_0144751 3300044683 Bacteria 1239
241 Ga0466966_0068194 3300044684 Bacteria 2233
242 Ga0466961_0019358 3300044693 Bacteria 4379
243 Ga0466961_0089886 3300044693 Bacteria 1939
244 Ga0466963_0079401 3300044694 Bacteria 2220
245 Ga0466963_0161769 3300044694 Bacteria 1558
246 Ga0466963_0165004 3300044694 Bacteria 1543
247 Ga0466964_0047953 3300044706 Bacteria 1745
248 Ga0466964_0055310 3300044706 Bacteria 1638
249 Ga0466964_0139395 3300044706 Bacteria 1113
250 Ga0466964_0238751 3300044706 Bacteria 890
251 Ga0466971_0080024 3300044719 Bacteria 1489
252 Ga0466968_0101595 3300044735 Bacteria 1284
253 Ga0466970_0019754 3300044765 Bacteria 3496
254 Ga0466970_0031586 3300044765 Bacteria 2797
255 Ga0466957_0000903 3300044842 Bacteria 15189
256 Ga0466957_0021835 3300044842 Bacteria 3773
257 Ga0466957_0052245 3300044842 Bacteria 2488
258 Ga0466957_0092215 3300044842 Bacteria 1899
259 Ga0466960_0004312 3300044901 Bacteria 5545
260 Ga0466960_0068283 3300044901 Bacteria 1763
261 Ga0466960_0235073 3300044901 Bacteria 1013
262 Ga0466959_0066772 3300045049 Bacteria 2609
263 Ga0466958_0033747 3300045836 Bacteria 3050
264 Ga0466958_0217856 3300045836 Bacteria 1217
265 Ga0466967_0007144 3300045976 Bacteria 8015
266 Ga0466967_0057285 3300045976 Bacteria 3439
267 Ga0466967_0085047 3300045976 Bacteria 2863
268 Ga0466967_0102448 3300045976 Bacteria 2619
269 Ga0466967_0106376 3300045976 Bacteria 2571
270 Ga0466967_0193797 3300045976 Bacteria 1922
271 Ga0466967_0391407 3300045976 Bacteria 1351
272 Ga0466967_0644295 3300045976 Bacteria 1047
273 Ga0495592_0273924 3300046454 Bacteria 1106
274 Ga0495629_0181220 3300046459 Bacteria 1460
275 Ga0495651_0019876 3300046462 Bacteria 5208
276 Ga0495651_0211964 3300046462 Bacteria 1347
277 Ga0495653_0009380 3300046463 Bacteria 8007
278 Ga0495664_0008588 3300046477 Bacteria 5698
279 Ga0495584_0018532 3300046491 Bacteria 3538
280 Ga0495618_0035513 3300046514 Bacteria 3128
281 Ga0495628_0040761 3300046516 Bacteria 3709
282 Ga0495644_0017946 3300046523 Bacteria 2703
283 Ga0495667_0021037 3300046559 Bacteria 4400
284 Ga0495667_0156300 3300046559 Bacteria 1467
285 Ga0495657_0088172 3300046675 Bacteria 1995
286 Ga0495657_0142154 3300046675 Bacteria 1495
287 Ga0495600_0142552 3300046809 Bacteria 1554
288 Ga0495674_0249044 3300047319 Bacteria 1462
289 Ga0495680_0002347 3300047322 Bacteria 19418
290 Ga0495675_0077351 3300047444 Bacteria 2096
291 Ga0495684_0309964 3300047471 Bacteria 1131
292 Ga0495602_0078758 3300048088 Bacteria 2782
293 Ga0496100_0069968 3300048903 Bacteria 2338
294 Ga0496101_0004070 3300048904 Bacteria 9143
295 Ga0496101_0423709 3300048904 Bacteria 1049
296 Ga0496102_0016647 3300048905 Bacteria 6429
297 Ga0496102_0018290 3300048905 Bacteria 6157
298 Ga0496102_0068487 3300048905 Bacteria 3257
299 Ga0496102_0262690 3300048905 Bacteria 1628
300 Ga0496102_0586836 3300048905 Bacteria 1037
301 Ga0496103_0013896 3300048906 Bacteria 4780
302 Ga0496103_0207687 3300048906 Bacteria 1259
303 Ga0496103_0289418 3300048906 Bacteria 1054
304 Ga0496104_0008596 3300048907 Bacteria 9081
305 Ga0496105_0039141 3300048908 Bacteria 3907
306 Ga0496105_0127583 3300048908 Bacteria 2097
307 Ga0496106_0009785 3300048909 Bacteria 7083
308 Ga0496106_0191798 3300048909 Bacteria 1625
309 Ga0496106_0242160 3300048909 Bacteria 1441
310 Ga0496106_0477802 3300048909 Bacteria 1001
311 Ga0496107_0010563 3300048910 Bacteria 6418
312 Ga0496107_0178317 3300048910 Bacteria 1577
313 Ga0496107_0273906 3300048910 Bacteria 1256
314 Ga0496108_0035280 3300048911 Bacteria 4157
315 Ga0496109_0016179 3300048912 Bacteria 6519
316 Ga0496109_0076989 3300048912 Bacteria 3069
317 Ga0496109_0079280 3300048912 Bacteria 3025
318 Ga0496109_0079557 3300048912 Bacteria 3020
319 Ga0496109_0366696 3300048912 Bacteria 1360
320 Ga0496110_0010400 3300048913 Bacteria 7565
321 Ga0496110_0070170 3300048913 Bacteria 3104
322 Ga0496110_0389434 3300048913 Bacteria 1270
323 Ga0496111_0004341 3300048914 Bacteria 8946
324 Ga0496112_0291568 3300048915 Bacteria 1578
325 Ga0496113_0076498 3300048916 Bacteria 2557
326 Ga0496114_0002242 3300048917 Bacteria 14731
327 Ga0496114_0004492 3300048917 Bacteria 10829
328 Ga0496114_0056718 3300048917 Bacteria 3269
329 Ga0496114_0106110 3300048917 Bacteria 2403
330 Ga0496114_0111083 3300048917 Bacteria 2349
331 Ga0496114_0116248 3300048917 Bacteria 2296
332 Ga0496115_0006725 3300048918 Bacteria 8434
333 Ga0501031_0000111 3300049568 Bacteria 43355
334 Ga0501031_0007405 3300049568 Bacteria 7151
335 Ga0501032_0044021 3300049569 Bacteria 3022
336 Ga0501032_0058000 3300049569 Bacteria 2600
337 Ga0501033_0004182 3300049570 Bacteria 11619
338 Ga0501033_0194642 3300049570 Bacteria 1450
339 Ga0501034_0005076 3300049571 Bacteria 14458
340 Ga0501034_0127797 3300049571 Bacteria 2526
341 Ga0501034_0142779 3300049571 Bacteria 2373
342 Ga0501034_0216643 3300049571 Bacteria 1868
343 Ga0501036_0003346 3300049572 Bacteria 12802
344 Ga0501036_0003907 3300049572 Bacteria 11963
345 Ga0501036_0053738 3300049572 Bacteria 3410
346 Ga0501036_0227507 3300049572 Bacteria 1565
347 Ga0501036_0251158 3300049572 Bacteria 1482
348 Ga0501037_0003601 3300049573 Bacteria 11236
349 Ga0501037_0008306 3300049573 Bacteria 7611
350 Ga0501037_0160749 3300049573 Bacteria 1601
351 Ga0501037_0237020 3300049573 Bacteria 1280
352 Ga0501038_0001473 3300049574 Bacteria 21653
353 Ga0501038_0006058 3300049574 Bacteria 11187
354 Ga0501038_0353337 3300049574 Bacteria 1144
355 Ga0501039_0000147 3300049575 Bacteria 47822
356 Ga0501039_0097798 3300049575 Bacteria 2289
357 Ga0501039_0140774 3300049575 Bacteria 1895
358 Ga0501039_0161275 3300049575 Bacteria 1762
359 Ga0501039_0232078 3300049575 Bacteria 1451
360 Ga0501040_0000114 3300049576 Bacteria 42226
361 Ga0501040_0001540 3300049576 Bacteria 14665
362 Ga0501040_0174757 3300049576 Bacteria 1522
363 Ga0501041_0000191 3300049577 Bacteria 27930
364 Ga0501041_0003449 3300049577 Bacteria 9101
365 Ga0501041_0009547 3300049577 Bacteria 5721
366 Ga0501041_0149675 3300049577 Bacteria 1457
367 Ga0501042_0000297 3300049578 Bacteria 24700
368 Ga0501042_0000978 3300049578 Bacteria 16169
369 Ga0501042_0141690 3300049578 Bacteria 1733
370 Ga0501042_0204642 3300049578 Bacteria 1423
371 Ga0501042_0265448 3300049578 Bacteria 1239
372 Ga0501046_0000612 3300049580 Bacteria 35049
373 Ga0501046_0002575 3300049580 Bacteria 16967
374 Ga0501046_0108047 3300049580 Bacteria 2128
375 Ga0501046_0208105 3300049580 Bacteria 1453
376 Ga0501046_0362943 3300049580 Bacteria 1050
377 Ga0501047_0194027 3300049581 Bacteria 1893
378 Ga0501047_0239378 3300049581 Bacteria 1666
379 Ga0501047_0333793 3300049581 Bacteria 1354
380 Ga0501048_0000717 3300049582 Bacteria 24247
381 Ga0501048_0000820 3300049582 Bacteria 22911
382 Ga0501048_0030839 3300049582 Bacteria 3880
383 Ga0501048_0049371 3300049582 Bacteria 2999
384 Ga0501048_0102855 3300049582 Bacteria 2016
385 Ga0501067_0005723 3300049583 Bacteria 6899
386 Ga0501067_0016786 3300049583 Bacteria 4045
387 Ga0501067_0104771 3300049583 Bacteria 1571
388 Ga0501067_0106524 3300049583 Bacteria 1558
389 Ga0501067_0128531 3300049583 Bacteria 1410
390 Ga0501068_0005088 3300049584 Bacteria 7171
391 Ga0501068_0016493 3300049584 Bacteria 4258
392 Ga0501068_0018708 3300049584 Bacteria 4013
393 Ga0501068_0123284 3300049584 Bacteria 1617
394 Ga0501069_0013600 3300049585 Bacteria 4340
395 Ga0501069_0119016 3300049585 Bacteria 1508
396 Ga0501070_0003822 3300049586 Bacteria 13000
397 Ga0501070_0003973 3300049586 Bacteria 12728
398 Ga0501070_0224458 3300049586 Bacteria 1540
399 Ga0501070_0271545 3300049586 Bacteria 1385
400 Ga0501070_0286018 3300049586 Bacteria 1344
401 Ga0501071_0001266 3300049587 Bacteria 14333
402 Ga0501071_0030896 3300049587 Bacteria 3791
403 Ga0501071_0123278 3300049587 Bacteria 1922
404 Ga0501071_0148149 3300049587 Bacteria 1749
405 Ga0501071_0407947 3300049587 Bacteria 1038
406 Ga0501072_0000216 3300049588 Bacteria 42014
407 Ga0501072_0051377 3300049588 Bacteria 3246
408 Ga0501072_0143845 3300049588 Bacteria 1901
409 Ga0501072_0183678 3300049588 Bacteria 1668
410 Ga0501072_0387882 3300049588 Bacteria 1108
411 Ga0501073_0004466 3300049589 Bacteria 10506
412 Ga0501074_0001125 3300049590 Bacteria 17494
413 Ga0501074_0003249 3300049590 Bacteria 11483
414 Ga0501074_0003942 3300049590 Bacteria 10575
415 Ga0501074_0016488 3300049590 Bacteria 5363
416 Ga0501074_0028064 3300049590 Bacteria 4079
417 Ga0501074_0086196 3300049590 Bacteria 2250
418 Ga0501074_0162038 3300049590 Bacteria 1597
419 Ga0501074_0257511 3300049590 Bacteria 1241
420 Ga0501075_0000188 3300049591 Bacteria 32133
421 Ga0501075_0008337 3300049591 Bacteria 7226
422 Ga0501075_0146601 3300049591 Bacteria 1799
423 Ga0501076_0000108 3300049592 Bacteria 45397
424 Ga0501076_0000253 3300049592 Bacteria 32905
425 Ga0501076_0212620 3300049592 Bacteria 1580
426 Ga0501076_0524120 3300049592 Bacteria 977
427 Ga0501077_0000818 3300049593 Bacteria 18893
428 Ga0501077_0015076 3300049593 Bacteria 4859
429 Ga0501077_0046565 3300049593 Bacteria 2755
430 Ga0501079_0000095 3300049741 Bacteria 43726
431 Ga0501079_0000386 3300049741 Bacteria 28381
432 Ga0501079_0161871 3300049741 Bacteria 1745
433 Ga0501079_0297811 3300049741 Bacteria 1262
434 Ga0501080_0004664 3300049742 Bacteria 12229
435 Ga0501080_0028133 3300049742 Bacteria 5227
436 Ga0501080_0067731 3300049742 Bacteria 3320
437 Ga0501080_0175904 3300049742 Bacteria 1971
438 Ga0501080_0469628 3300049742 Bacteria 1126
439 Ga0501081_0000341 3300049743 Bacteria 25026
440 Ga0501081_0001382 3300049743 Bacteria 14851
441 Ga0501081_0034487 3300049743 Bacteria 3444
442 Ga0501083_0023387 3300049744 Bacteria 4286
443 Ga0501083_0045347 3300049744 Bacteria 2975
444 Ga0501083_0065799 3300049744 Bacteria 2414
445 Ga0501035_0002924 3300049822 Bacteria 16439
446 Ga0501035_0011956 3300049822 Bacteria 8031
447 Ga0501044_0012512 3300049823 Bacteria 9189
448 Ga0501044_0584499 3300049823 Bacteria 1011
449 Ga0501045_0000072 3300049824 Bacteria 47645
450 Ga0501045_0000088 3300049824 Bacteria 43733
451 Ga0501045_0175909 3300049824 Bacteria 1594
452 Ga0501045_0275401 3300049824 Bacteria 1253
453 Ga0501045_0402198 3300049824 Bacteria 1019
454 nmdc:mga03683_13066_c1 3300050489 Bacteria 3048
455 nmdc:mga03n38_20660_c1 3300050490 Bacteria 2639
456 nmdc:mga03n38_30494_c1 3300050490 Bacteria 2268
457 nmdc:mga03n38_38381_c1 3300050490 Bacteria 2071
458 nmdc:mga03n38_70496_c1 3300050490 Bacteria 1616
459 nmdc:mga03n38_871_c1 3300050490 Bacteria 8104
460 nmdc:mga00v17_13751_c1 3300050491 Bacteria 4499
461 nmdc:mga00v17_14101_c1 3300050491 Bacteria 4455
462 nmdc:mga00v17_196901_c1 3300050491 Bacteria 1302
463 nmdc:mga00v17_94367_c1 3300050491 Bacteria 1882
464 nmdc:mga00v17_99360_c1 3300050491 Bacteria 1836
465 nmdc:mga0yw44_10566_c1 3300050492 Bacteria 4723
466 nmdc:mga0yw44_112191_c1 3300050492 Bacteria 1748
467 nmdc:mga0yw44_124878_c1 3300050492 Bacteria 1661
468 nmdc:mga0yw44_256459_c1 3300050492 Bacteria 1165
469 nmdc:mga0yw44_273365_c1 3300050492 Bacteria 1128
470 nmdc:mga0yw44_28112_c1 3300050492 Bacteria 3232
471 nmdc:mga0yw44_54803_c1 3300050492 Bacteria 2425
472 nmdc:mga0yw44_69715_c1 3300050492 Bacteria 2178
473 nmdc:mga06z11_202119_c1 3300050494 Bacteria 1155
474 nmdc:mga06z11_225791_c1 3300050494 Bacteria 1096
475 nmdc:mga06z11_63755_c1 3300050494 Bacteria 1929
476 nmdc:mga07m45_16506_c1 3300050496 Bacteria 3953
477 nmdc:mga07m45_62260_c1 3300050496 Bacteria 2114
478 nmdc:mga07m45_8086_c1 3300050496 Bacteria 5394
479 nmdc:mga05p37_28171_c1 3300050507 Bacteria 6848
480 nmdc:mga05p37_5041_c1 3300050507 Bacteria 15476
481 nmdc:mga0qj67_19320_c1 3300050509 Bacteria 5204
482 nmdc:mga06r32_7150_c1 3300050510 Bacteria 10058
483 nmdc:mga08y16_15326_c1 3300050511 Bacteria 8064
484 nmdc:mga0n895_125991_c1 3300050512 Bacteria 2585
485 nmdc:mga0a205_9213_c1 3300050515 Bacteria 9012
486 nmdc:mga0sz30_11721_c1 3300050516 Bacteria 3393
487 Ga0495601_0105974 3300053077 Bacteria 1818
488 Ga0495595_0041081 3300053084 Bacteria 2115
489 Ga0495619_0107966 3300053085 Bacteria 1899
490 Ga0500644_0000352 3300053088 Bacteria 22817
491 Ga0500641_0023651 3300053096 Bacteria 2365
492 Ga0500556_0001590 3300053104 Bacteria 9084
493 Ga0500593_002019 3300053117 Bacteria 7366
494 Ga0500573_0049588 3300053140 Bacteria 2416
495 Ga0501084_0000268 3300054114 Bacteria 39282
496 Ga0501084_0000695 3300054114 Bacteria 25783
497 Ga0501084_0044225 3300054114 Bacteria 3728
498 Ga0501084_0203354 3300054114 Bacteria 1671
499 Ga0590071_015406 3300059421 Bacteria 1792
500 Ga0501082_0001106 3300060353 Bacteria 23826
501 Ga0501082_0001192 3300060353 Bacteria 22868
502 Ga0501082_0024200 3300060353 Bacteria 5237
503 Ga0501082_0063297 3300060353 Bacteria 3185
504 Ga0530510_0000453 3300061734 Bacteria 26561
505 Ga0530510_0008358 3300061734 Bacteria 7212
506 Ga0530510_0177885 3300061734 Bacteria 1577
507 Ga0530510_0494810 3300061734 Bacteria 927
508 2643824882 2643221561 Bacteria 4984412
509 2643892717 2643221576 Bacteria 5214352
510 2643962166 2643221590 Bacteria 5214697
511 2644032182 2643221604 Bacteria 5014917
512 2644093328 2643221615 Bacteria 5487866
513 2644100092 2643221617 Bacteria 5139111
514 2644232061 2643221641 Bacteria 4490190
515 2644322938 2643221657 Bacteria 5490246
516 2644532567 2643221696 Bacteria 5431823
517 2738870914 2738541305 Bacteria 4910150
518 2774395076 2773857762 Bacteria 5971770
519 2809194093 2808606439 Bacteria 5952208
520 2812334985 2811994874 Bacteria 5367947
521 2837184766 2837183177 Bacteria 4637169
522 2855390151 2855386786 Bacteria 4752232
523 2984578770 2984576629 Bacteria 4248407
524 2990257978 2990256926 Bacteria 4252839
525 2995729010 2995726249 Bacteria 3470435
526 8054611476 8054609563 Bacteria 5170090
527 8055037144 8055034563 Bacteria 3562128
528 8055039357 8055037949 Bacteria 3337834
529 Ga0081539_10014687
530 JGI25407J50210_10017096
531 Ga0070658_10021285
532 Ga0070658_10062942
533 Ga0070683_100001487
534 Ga0070683_100005084
535 Ga0070683_100162729
536 Ga0070683_100182901
537 Ga0068869_100010586
538 Ga0070660_100027312
539 Ga0070689_100246254
540 Ga0070692_10015822
541 Ga0070675_100152197
542 Ga0070688_100111944
543 Ga0070659_100048294
544 Ga0070667_100029053
545 Ga0070709_10083781
546 Ga0070714_100012888
547 Ga0070713_100252746
548 Ga0070710_10120892
549 Ga0070663_100114267
550 Ga0070663_100153081
551 Ga0070662_100250110
552 Ga0068867_100348129
553 Ga0070685_10020895
554 Ga0070685_10226416
555 Ga0070707_100125553
556 Ga0070707_100505288
557 Ga0070679_100003923
558 Ga0070684_100000262
559 Ga0070684_100156944
560 Ga0068853_100182097
561 Ga0070665_100053151
562 Ga0070665_100456389
563 Ga0068855_100017677
564 Ga0070664_100018551
565 Ga0070664_100348468
566 Ga0070664_100374441
567 Ga0068856_100054529
568 Ga0068856_100225640
569 Ga0070702_100081893
570 Ga0068861_100122410
571 Ga0068860_100049352
572 Ga0081455_10029803
573 Ga0081538_10001513
574 Ga0081538_10002385
575 Ga0081538_10006455
576 Ga0081538_10009975
577 Ga0081538_10012231
578 Ga0081538_10017230
579 Ga0081538_10062231
580 Ga0081538_10166892
581 Ga0081539_10006567
582 Ga0081539_10050700
583 Ga0081539_10052438
584 Ga0081539_10091417
585 Ga0081539_10097433
586 Ga0070717_10115187
587 Ga0070717_10351207
588 Ga0075365_10001139
589 Ga0075365_10049187
590 Ga0075365_10080147
591 Ga0075363_100004620
592 Ga0075363_100007988
593 Ga0075363_100015632
594 Ga0075363_100098493
595 Ga0075364_10015872
596 Ga0075364_10018979
597 Ga0075364_10050967
598 Ga0075364_10079532
599 Ga0075364_10205088
600 Ga0075432_10020800
601 Ga0075362_10016202
602 Ga0075367_10001582
603 Ga0075367_10005746
604 Ga0075367_10109769
605 Ga0075369_10091750
606 Ga0075427_10010162
607 Ga0097621_100175382
608 Ga0075370_10020427
609 Ga0075370_10047600
610 Ga0075370_10068253
611 Ga0068871_100161000
612 Ga0075428_100026557
613 Ga0075430_100261446
614 Ga0075431_100014879
615 Ga0075433_10128370
616 Ga0075434_100340516
617 Ga0068865_100016252
618 Ga0111539_10016622
619 Ga0105245_10280347
620 Ga0105245_10530553
621 Ga0114129_10057285
622 Ga0114129_10394225
623 Ga0105242_10480663
624 Ga0105249_10043155
625 Ga0105249_10168432
626 Ga0105239_10021731
627 Ga0157370_10336696
628 Ga0157369_10069058
629 Ga0163162_10151696
630 Ga0157375_10166142
631 Ga0157375_10484490
632 Ga0163163_10085004
633 Ga0163163_10276922
634 Ga0157377_10012380
635 Ga0163161_10109351
636 Ga0163161_10116063
637 Ga0207688_10120376
638 Ga0207647_10002943
639 Ga0207684_10210950
640 Ga0207693_10269986
641 Ga0207657_10039956
642 Ga0207657_10119250
643 Ga0207652_10040667
644 Ga0207659_10456891
645 Ga0207687_10009664
646 Ga0207664_10082878
647 Ga0207690_10059572
648 Ga0207706_10083076
649 Ga0207709_10235798
650 Ga0207704_10173644
651 Ga0207665_10066821
652 Ga0207661_10016497
653 Ga0207661_10018004
654 Ga0207661_10295561
655 Ga0207712_10140480
656 Ga0207712_10164961
657 Ga0207658_10036321
658 Ga0207703_10258375
659 Ga0207639_10029162
660 Ga0207678_10026272
661 Ga0207678_10123439
662 Ga0207708_10035443
663 Ga0207648_10294918
664 Ga0207674_10009716
665 Ga0207675_100035773
666 Ga0207675_100205820
667 Ga0207683_10017903
668 Ga0207428_10002650
669 Ga0268266_10008193
670 Ga0268266_10087581
671 Ga0268264_10000343
672 Ga0268264_10094576
673 Ga0307515_10072752
674 Ga0307408_100004716
675 Ga0307408_100009365
676 Ga0316576_10000951
677 Ga0307405_10002996
678 Ga0307405_10018416
679 Ga0307405_10034073
680 Ga0307405_10106155
681 Ga0307405_10308216
682 Ga0307413_10002233
683 Ga0307413_10029029
684 Ga0307413_10037227
685 Ga0307413_10194976
686 Ga0307413_10268518
687 Ga0307410_10003477
688 Ga0307410_10076228
689 Ga0307410_10121977
690 Ga0307410_10124972
691 Ga0307406_10007310
692 Ga0307406_10057403
693 Ga0307407_10002115
694 Ga0307407_10039055
695 Ga0307407_10046057
696 Ga0307407_10091149
697 Ga0307407_10243396
698 Ga0307412_10017299
699 Ga0307412_10075605
700 Ga0307412_10220534
701 Ga0307412_10222767
702 Ga0307412_10313869
703 Ga0307409_100000784
704 Ga0307409_100004996
705 Ga0307409_100081956
706 Ga0307409_100147548
707 Ga0307409_100153136
708 Ga0307409_100209040
709 Ga0307409_100254316
710 Ga0307409_100388898
711 Ga0307416_100001624
712 Ga0307416_100004150
713 Ga0307416_100007478
714 Ga0307416_100009427
715 Ga0307416_100016008
716 Ga0307416_100096621
717 Ga0307416_100307188
718 Ga0307416_100675935
719 Ga0307414_10014870
720 Ga0307414_10045866
721 Ga0307414_10215962
722 Ga0307414_10338992
723 Ga0307411_10020968
724 Ga0307411_10108038
725 Ga0307411_10200371
726 Ga0307415_100003850
727 Ga0307415_100005817
728 Ga0307415_100010759
729 Ga0307415_100015073
730 Ga0307415_100015486
731 Ga0307415_100049310
732 Ga0307415_100054639
733 Ga0307415_100074831
734 Ga0307415_100204717
735 Ga0307415_100207485
736 Ga0307415_100228992
737 Ga0373923_0095436
738 Ga0373955_0144616
739 Ga0395899_0007916
740 Ga0395900_0034547
741 Ga0395898_0298561
742 Ga0395905_0040537
743 Ga0395905_0107122
744 Ga0395905_0291761
745 Ga0395905_0607024
746 Ga0395901_0042933
747 Ga0395901_0079434
748 Ga0395901_0515024
749 Ga0439438_081086
750 Ga0439447_031504
751 Ga0439448_0000094
752 Ga0439448_0009868
753 Ga0439450_000153
754 Ga0439451_010395
755 Ga0439463_000140
756 Ga0450888_005685
757 Ga0450905_002105
758 Ga0439446_0015230
759 Ga0439458_0029640
760 Ga0439460_0000416
761 Ga0439460_0065886
762 Ga0439440_0000567
763 Ga0439440_0002481
764 Ga0466972_0146376
765 Ga0466965_0032696
766 Ga0466965_0044257
767 Ga0466965_0103317
768 Ga0466965_0144751
769 Ga0466966_0068194
770 Ga0466961_0019358
771 Ga0466961_0089886
772 Ga0466963_0079401
773 Ga0466963_0161769
774 Ga0466963_0165004
775 Ga0466964_0047953
776 Ga0466964_0055310
777 Ga0466964_0139395
778 Ga0466964_0238751
779 Ga0466971_0080024
780 Ga0466968_0101595
781 Ga0466970_0019754
782 Ga0466970_0031586
783 Ga0466957_0000903
784 Ga0466957_0021835
785 Ga0466957_0052245
786 Ga0466957_0092215
787 Ga0466960_0004312
788 Ga0466960_0068283
789 Ga0466960_0235073
790 Ga0466959_0066772
791 Ga0466958_0033747
792 Ga0466958_0217856
793 Ga0466967_0007144
794 Ga0466967_0057285
795 Ga0466967_0085047
796 Ga0466967_0102448
797 Ga0466967_0106376
798 Ga0466967_0193797
799 Ga0466967_0391407
800 Ga0466967_0644295
801 Ga0495592_0273924
802 Ga0495629_0181220
803 Ga0495651_0019876
804 Ga0495651_0211964
805 Ga0495653_0009380
806 Ga0495664_0008588
807 Ga0495584_0018532
808 Ga0495618_0035513
809 Ga0495628_0040761
810 Ga0495644_0017946
811 Ga0495667_0021037
812 Ga0495667_0156300
813 Ga0495657_0088172
814 Ga0495657_0142154
815 Ga0495600_0142552
816 Ga0495674_0249044
817 Ga0495680_0002347
818 Ga0495675_0077351
819 Ga0495684_0309964
820 Ga0495602_0078758
821 Ga0496100_0069968
822 Ga0496101_0004070
823 Ga0496101_0423709
824 Ga0496102_0016647
825 Ga0496102_0018290
826 Ga0496102_0068487
827 Ga0496102_0262690
828 Ga0496102_0586836
829 Ga0496103_0013896
830 Ga0496103_0207687
831 Ga0496103_0289418
832 Ga0496104_0008596
833 Ga0496105_0039141
834 Ga0496105_0127583
835 Ga0496106_0009785
836 Ga0496106_0191798
837 Ga0496106_0242160
838 Ga0496106_0477802
839 Ga0496107_0010563
840 Ga0496107_0178317
841 Ga0496107_0273906
842 Ga0496108_0035280
843 Ga0496109_0016179
844 Ga0496109_0076989
845 Ga0496109_0079280
846 Ga0496109_0079557
847 Ga0496109_0366696
848 Ga0496110_0010400
849 Ga0496110_0070170
850 Ga0496110_0389434
851 Ga0496111_0004341
852 Ga0496112_0291568
853 Ga0496113_0076498
854 Ga0496114_0002242
855 Ga0496114_0004492
856 Ga0496114_0056718
857 Ga0496114_0106110
858 Ga0496114_0111083
859 Ga0496114_0116248
860 Ga0496115_0006725
861 Ga0501031_0000111
862 Ga0501031_0007405
863 Ga0501032_0044021
864 Ga0501032_0058000
865 Ga0501033_0004182
866 Ga0501033_0194642
867 Ga0501034_0005076
868 Ga0501034_0127797
869 Ga0501034_0142779
870 Ga0501034_0216643
871 Ga0501036_0003346
872 Ga0501036_0003907
873 Ga0501036_0053738
874 Ga0501036_0227507
875 Ga0501036_0251158
876 Ga0501037_0003601
877 Ga0501037_0008306
878 Ga0501037_0160749
879 Ga0501037_0237020
880 Ga0501038_0001473
881 Ga0501038_0006058
882 Ga0501038_0353337
883 Ga0501039_0000147
884 Ga0501039_0097798
885 Ga0501039_0140774
886 Ga0501039_0161275
887 Ga0501039_0232078
888 Ga0501040_0000114
889 Ga0501040_0001540
890 Ga0501040_0174757
891 Ga0501041_0000191
892 Ga0501041_0003449
893 Ga0501041_0009547
894 Ga0501041_0149675
895 Ga0501042_0000297
896 Ga0501042_0000978
897 Ga0501042_0141690
898 Ga0501042_0204642
899 Ga0501042_0265448
900 Ga0501046_0000612
901 Ga0501046_0002575
902 Ga0501046_0108047
903 Ga0501046_0208105
904 Ga0501046_0362943
905 Ga0501047_0194027
906 Ga0501047_0239378
907 Ga0501047_0333793
908 Ga0501048_0000717
909 Ga0501048_0000820
910 Ga0501048_0030839
911 Ga0501048_0049371
912 Ga0501048_0102855
913 Ga0501067_0005723
914 Ga0501067_0016786
915 Ga0501067_0104771
916 Ga0501067_0106524
917 Ga0501067_0128531
918 Ga0501068_0005088
919 Ga0501068_0016493
920 Ga0501068_0018708
921 Ga0501068_0123284
922 Ga0501069_0013600
923 Ga0501069_0119016
924 Ga0501070_0003822
925 Ga0501070_0003973
926 Ga0501070_0224458
927 Ga0501070_0271545
928 Ga0501070_0286018
929 Ga0501071_0001266
930 Ga0501071_0030896
931 Ga0501071_0123278
932 Ga0501071_0148149
933 Ga0501071_0407947
934 Ga0501072_0000216
935 Ga0501072_0051377
936 Ga0501072_0143845
937 Ga0501072_0183678
938 Ga0501072_0387882
939 Ga0501073_0004466
940 Ga0501074_0001125
941 Ga0501074_0003249
942 Ga0501074_0003942
943 Ga0501074_0016488
944 Ga0501074_0028064
945 Ga0501074_0086196
946 Ga0501074_0162038
947 Ga0501074_0257511
948 Ga0501075_0000188
949 Ga0501075_0008337
950 Ga0501075_0146601
951 Ga0501076_0000108
952 Ga0501076_0000253
953 Ga0501076_0212620
954 Ga0501076_0524120
955 Ga0501077_0000818
956 Ga0501077_0015076
957 Ga0501077_0046565
958 Ga0501079_0000095
959 Ga0501079_0000386
960 Ga0501079_0161871
961 Ga0501079_0297811
962 Ga0501080_0004664
963 Ga0501080_0028133
964 Ga0501080_0067731
965 Ga0501080_0175904
966 Ga0501080_0469628
967 Ga0501081_0000341
968 Ga0501081_0001382
969 Ga0501081_0034487
970 Ga0501083_0023387
971 Ga0501083_0045347
972 Ga0501083_0065799
973 Ga0501035_0002924
974 Ga0501035_0011956
975 Ga0501044_0012512
976 Ga0501044_0584499
977 Ga0501045_0000072
978 Ga0501045_0000088
979 Ga0501045_0175909
980 Ga0501045_0275401
981 Ga0501045_0402198
982 nmdc:mga03683_13066_c1
983 nmdc:mga03n38_20660_c1
984 nmdc:mga03n38_30494_c1
985 nmdc:mga03n38_38381_c1
986 nmdc:mga03n38_70496_c1
987 nmdc:mga03n38_871_c1
988 nmdc:mga00v17_13751_c1
989 nmdc:mga00v17_14101_c1
990 nmdc:mga00v17_196901_c1
991 nmdc:mga00v17_94367_c1
992 nmdc:mga00v17_99360_c1
993 nmdc:mga0yw44_10566_c1
994 nmdc:mga0yw44_112191_c1
995 nmdc:mga0yw44_124878_c1
996 nmdc:mga0yw44_256459_c1
997 nmdc:mga0yw44_273365_c1
998 nmdc:mga0yw44_28112_c1
999 nmdc:mga0yw44_54803_c1
1000 nmdc:mga0yw44_69715_c1
1001 nmdc:mga06z11_202119_c1
1002 nmdc:mga06z11_225791_c1
1003 nmdc:mga06z11_63755_c1
1004 nmdc:mga07m45_16506_c1
1005 nmdc:mga07m45_62260_c1
1006 nmdc:mga07m45_8086_c1
1007 nmdc:mga05p37_28171_c1
1008 nmdc:mga05p37_5041_c1
1009 nmdc:mga0qj67_19320_c1
1010 nmdc:mga06r32_7150_c1
1011 nmdc:mga08y16_15326_c1
1012 nmdc:mga0n895_125991_c1
1013 nmdc:mga0a205_9213_c1
1014 nmdc:mga0sz30_11721_c1
1015 Ga0495601_0105974
1016 Ga0495595_0041081
1017 Ga0495619_0107966
1018 Ga0500644_0000352
1019 Ga0500641_0023651
1020 Ga0500556_0001590
1021 Ga0500593_002019
1022 Ga0500573_0049588
1023 Ga0501084_0000268
1024 Ga0501084_0000695
1025 Ga0501084_0044225
1026 Ga0501084_0203354
1027 Ga0590071_015406
1028 Ga0501082_0001106
1029 Ga0501082_0001192
1030 Ga0501082_0024200
1031 Ga0501082_0063297
1032 Ga0530510_0000453
1033 Ga0530510_0008358
1034 Ga0530510_0177885
1035 Ga0530510_0494810
1036 2643824882
1037 2643892717
1038 2643962166
1039 2644032182
1040 2644093328
1041 2644100092
1042 2644232061
1043 2644322938
1044 2644532567
1045 2738870914
1046 2774395076
1047 2809194093
1048 2812334985
1049 2837184766
1050 2855390151
1051 2984578770
1052 2990257978
1053 2995729010
1054 8054611476
1055 8055037144
1056 8055039357

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

69

256

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hy1-assembly1.cif.gz_A-2 crystal structure of rv0805 0.5737 48 268
3av0-assembly1.cif.gz_A crystal structure of mre11-rad50 bound to atp s 0.5726 45 268
7mst-assembly1.cif.gz_B phosphorylated human e105qa gtp-specific succinyl-coa synthetase complexed with coenzyme a 0.5708 60 160
2hyo-assembly1.cif.gz_A-2 crystal structure of rv0805 n97a mutant 0.5635 48 268
2hyp-assembly1.cif.gz_A-2 crystal structure of rv0805 d66a mutant 0.5635 48 268
ID Description Score Start End Superfamily
af_I6X827_50_260_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8621 48 256 3.60.21.10
af_I6X827_50_260_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8508 48 256 3.60.21.10
af_Q09320_248_456_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7473 48 265 3.60.21.10
af_Q09320_248_456_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7408 48 265 3.60.21.10
af_Q22704_214_405_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6908 48 231 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A7C7XEF7-F1-model_v4 Metallophosphoesterase 0.9404 26 294 GO:0008758
GO:0009245
GO:0016020
AF-A0A1Q2CSE8-F1-model_v4 Phosphoesterase 0.9386 5 294 GO:0008758
GO:0009245
GO:0016020
AF-A0A6I5VMF8-F1-model_v4 Metallophosphoesterase 0.9312 6 293 GO:0008758
GO:0009245
GO:0016020
AF-A0A3N2IL59-F1-model_v4 Putative MPP superfamily phosphohydrolase 0.9248 13 291 GO:0008758
GO:0009245
GO:0016020
AF-A0A1Q2CSE8-F1-model_v4 Phosphoesterase 0.9232 5 294 GO:0008758
GO:0009245
GO:0016020

Map