F459646

General Info

Members Datasets Scaffolds Average Seq Length
528 211 508 259

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100298318|Ga0068852_1002983181
Length 292
Sequence MDIPIRPLPALFLSHGSPMLALEPGATGHFLQQLGPAIDQAFGRPRAILAVSAHTTARVPVLLAGAQHREVHDFGGFPDALFQLRYRPPGAPALAGEVAACLASAGVAARSVNEGGLDHGIWSMLRFMYPDADVPVLPLAWMPGAPPAEQFALGEALAPLRAQGVLLMGTGSITHNLRRIFSAGAPERDAVEITESREFRAWFAERGAARDWDRLWDYRRQAPHAADMHPTDEHLLPWFVAAGSGGREATPLRLHDGVTYGCLGMDAYAFGESAARLAQHLPPSSTGAGQAR

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
8 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
9 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
10 2738541280 Massilia sp. GV090 Isolate Unclassified
11 2738541297 Duganella sp. GV083 Isolate Unclassified
12 2738541357 Duganella sp. GV053 Isolate Unclassified
13 2738543003 Duganella sp. GV066 Isolate Unclassified
14 2738543026 Duganella sp. GV089 Isolate Unclassified
15 2738543029 Duganella sp. GV039 Isolate Unclassified
16 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
17 2842682962 Bacillus sp. R-72492 Isolate Unclassified
18 2849139964 Bacillus sp. R-71875 Isolate Unclassified
19 2857581216 Bacillus sp. R-71922 Isolate Unclassified
20 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
21 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
58 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
59 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
60 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
84 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
86 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
87 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
88 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
89 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
90 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
91 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
98 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
105 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
106 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
107 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
108 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
109 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
110 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
111 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
112 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
113 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
123 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
127 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
128 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
129 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
130 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
131 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
132 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
133 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
134 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
135 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
136 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
137 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
138 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
141 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
145 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
146 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
147 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
154 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
159 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
160 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
161 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
162 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
163 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
164 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
172 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
175 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
176 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
177 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
178 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
181 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
182 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
189 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
190 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
193 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
194 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
195 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
196 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
199 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
200 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
201 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
202 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
203 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
204 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
205 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
206 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
207 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
208 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
209 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
210 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
211 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.21
Metatranscriptomes 0
Isolates 3.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.8
Nodule 0.38
Rhizoplane 1.14
Rhizosphere 82.2
Stem 0
Stem Tuber 0
Unclassified 5.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10018001 3300001979 Bacteria 2516
2 JGI24739J22299_10023619 3300001989 Bacteria 2171
3 JGI25151J46595_10013357 3300003187 Bacteria 3697
4 JGI25153J46596_10004031 3300003215 Bacteria 8011
5 JGI25153J46596_10031434 3300003215 Bacteria 1787
6 rootL2_10137477 3300003322 Bacteria 1500
7 Ga0055526_1010965 3300003771 Bacteria 4146
8 Ga0055524_1000233 3300003775 Bacteria 58967
9 Ga0055530_10000758 3300003791 Bacteria 26817
10 Ga0055540_1000080 3300003792 Bacteria 111063
11 Ga0065165_1005423 3300005262 Bacteria 7180
12 Ga0070661_100002124 3300005344 Bacteria 13661
13 Ga0070659_100001740 3300005366 Bacteria 15646
14 Ga0070663_100238995 3300005455 Bacteria 1433
15 Ga0070663_100398231 3300005455 Bacteria 1125
16 Ga0068853_100029161 3300005539 Bacteria 4649
17 Ga0068853_100077324 3300005539 Bacteria 2907
18 Ga0068855_100172283 3300005563 Bacteria 2450
19 Ga0070664_100004314 3300005564 Bacteria 11432
20 Ga0068857_100039597 3300005577 Bacteria 4175
21 Ga0068857_100053285 3300005577 Bacteria 3589
22 Ga0068854_100077337 3300005578 Bacteria 2448
23 Ga0068854_100227424 3300005578 Bacteria 1479
24 Ga0068856_100042379 3300005614 Bacteria 4477
25 Ga0068856_100144833 3300005614 Bacteria 2383
26 Ga0068852_100006956 3300005616 Bacteria 8233
27 Ga0068852_100298318 3300005616 Bacteria 1559
28 Ga0068851_10006649 3300005834 Bacteria 5289
29 Ga0075368_10020643 3300006042 Bacteria 2495
30 Ga0075368_10090557 3300006042 Bacteria 1251
31 Ga0075363_100018328 3300006048 Bacteria 3486
32 Ga0075363_100086239 3300006048 Bacteria 1723
33 Ga0075364_10103939 3300006051 Bacteria 1892
34 Ga0075362_10013240 3300006177 Bacteria 3298
35 Ga0075367_10007224 3300006178 Bacteria 5674
36 Ga0075367_10007323 3300006178 Bacteria 5643
37 Ga0075369_10009873 3300006186 Bacteria 3723
38 Ga0075369_10010697 3300006186 Bacteria 3595
39 Ga0075366_10132880 3300006195 Bacteria 1502
40 Ga0075370_10001889 3300006353 Bacteria 9407
41 Ga0079104_1000267 3300006946 Bacteria 68733
42 Ga0105240_10089772 3300009093 Bacteria 3758
43 Ga0105241_10088831 3300009174 Bacteria 2434
44 Ga0105237_10316434 3300009545 Bacteria 1564
45 Ga0105238_10004432 3300009551 Bacteria 13921
46 Ga0105238_10035858 3300009551 Bacteria 5042
47 Ga0105239_10069717 3300010375 Bacteria 3862
48 Ga0105239_10074831 3300010375 Bacteria 3724
49 Ga0157379_10593546 3300014968 Bacteria 1033
50 Ga0183360_10001 3300015689 Bacteria 3943671
51 Ga0207425_1002947 3300025245 Bacteria 5695
52 Ga0209129_1000043 3300025258 Bacteria 298978
53 Ga0209673_1004179 3300025273 Bacteria 7882
54 Ga0209675_1014907 3300025291 Bacteria 2339
55 Ga0209025_1007958 3300025294 Bacteria 7756
56 Ga0209564_1000014 3300025295 Bacteria 621501
57 Ga0209758_1000307 3300025297 Bacteria 95192
58 Ga0209758_1000492 3300025297 Bacteria 64511
59 Ga0209050_1000493 3300025298 Bacteria 67885
60 Ga0209050_1000739 3300025298 Bacteria 47380
61 Ga0209050_1028009 3300025298 Bacteria 1840
62 Ga0209256_1000203 3300025299 Bacteria 112500
63 Ga0209051_1000035 3300025303 Bacteria 346999
64 Ga0209257_1000346 3300025304 Bacteria 95662
65 Ga0207656_10160266 3300025321 Bacteria 1070
66 Ga0207654_10001596 3300025911 Bacteria 11905
67 Ga0207695_10000497 3300025913 Bacteria 83894
68 Ga0207695_10196716 3300025913 Bacteria 1932
69 Ga0207649_10001856 3300025920 Bacteria 12074
70 Ga0207694_10003968 3300025924 Bacteria 11669
71 Ga0207679_10007881 3300025945 Bacteria 6767
72 Ga0207667_10017824 3300025949 Bacteria 7983
73 Ga0207667_10238496 3300025949 Bacteria 1861
74 Ga0207667_10278918 3300025949 Bacteria 1708
75 Ga0207640_10021731 3300025981 Bacteria 3828
76 Ga0207640_10045704 3300025981 Bacteria 2813
77 Ga0207639_10060313 3300026041 Bacteria 2926
78 Ga0207678_10042049 3300026067 Bacteria 3961
79 Ga0207702_10001920 3300026078 Bacteria 20319
80 Ga0207676_10328406 3300026095 Bacteria 1407
81 Ga0207674_10003184 3300026116 Bacteria 20210
82 Ga0207674_10005049 3300026116 Bacteria 15751
83 Ga0207698_10241410 3300026142 Bacteria 1647
84 Ga0209281_1000076 3300027111 Bacteria 263350
85 Ga0209974_10004710 3300027876 Bacteria 4846
86 Ga0307515_10000232 3300028794 Bacteria 137778
87 Ga0307515_10004630 3300028794 Bacteria 28261
88 Ga0307515_10022661 3300028794 Bacteria 11055
89 Ga0265330_10011185 3300031235 Bacteria 4213
90 Ga0265332_10002259 3300031238 Bacteria 9879
91 Ga0265332_10019421 3300031238 Bacteria 2999
92 Ga0265328_10035630 3300031239 Bacteria 1840
93 Ga0265325_10055729 3300031241 Bacteria 2020
94 Ga0265329_10008772 3300031242 Bacteria 3813
95 Ga0265340_10004855 3300031247 Bacteria 7477
96 Ga0265339_10004680 3300031249 Bacteria 9291
97 Ga0265339_10022358 3300031249 Bacteria 3665
98 Ga0265331_10004561 3300031250 Bacteria 8621
99 Ga0265331_10022461 3300031250 Bacteria 3218
100 Ga0265327_10003970 3300031251 Bacteria 13507
101 Ga0265316_10057111 3300031344 Bacteria 3045
102 Ga0265313_10045132 3300031595 Bacteria 2147
103 Ga0307508_10001933 3300031616 Bacteria 22733
104 Ga0307514_10001048 3300031649 Bacteria 39659
105 Ga0265314_10031018 3300031711 Bacteria 3951
106 Ga0265342_10000210 3300031712 Bacteria 65961
107 Ga0307516_10010299 3300031730 Bacteria 10292
108 Ga0307507_10043893 3300033179 Bacteria 4429
109 Ga0436361_0883434 3300039447 Bacteria 1268
110 Ga0451807_1833390 3300041486 Bacteria 1627
111 Ga0451841_0922783 3300041498 Bacteria 2160
112 Ga0451845_0532962 3300041501 Bacteria 1847
113 Ga0451849_0172393 3300041505 Bacteria 1683
114 Ga0451843_0229425 3300041509 Bacteria 1155
115 Ga0450919_002169 3300042121 Bacteria 2557
116 Ga0450923_008095 3300042125 Bacteria 1798
117 Ga0450918_000766 3300042531 Bacteria 6794
118 Ga0495617_000012 3300046452 Bacteria 295916
119 Ga0495617_000129 3300046452 Bacteria 50053
120 Ga0495617_011437 3300046452 Bacteria 3027
121 Ga0495627_000007 3300046453 Bacteria 575915
122 Ga0495627_000118 3300046453 Bacteria 99480
123 Ga0495603_0081361 3300046455 Bacteria 1897
124 Ga0495603_0236403 3300046455 Bacteria 1053
125 Ga0495590_0006583 3300046457 Bacteria 4527
126 Ga0495590_0006631 3300046457 Bacteria 4512
127 Ga0495629_0077914 3300046459 Bacteria 2314
128 Ga0495629_0115771 3300046459 Bacteria 1868
129 Ga0495629_0140341 3300046459 Bacteria 1681
130 Ga0495638_0000621 3300046460 Bacteria 39333
131 Ga0495638_0001663 3300046460 Bacteria 19656
132 Ga0495638_0009045 3300046460 Bacteria 7021
133 Ga0495638_0093606 3300046460 Bacteria 1807
134 Ga0495638_0099563 3300046460 Bacteria 1739
135 Ga0495638_0190240 3300046460 Bacteria 1165
136 Ga0495653_0063220 3300046463 Bacteria 2794
137 Ga0495653_0075948 3300046463 Bacteria 2499
138 Ga0495653_0092966 3300046463 Bacteria 2201
139 Ga0495653_0165927 3300046463 Bacteria 1528
140 Ga0495650_0000213 3300046471 Bacteria 123910
141 Ga0495650_0000215 3300046471 Bacteria 122533
142 Ga0495650_0000289 3300046471 Bacteria 93255
143 Ga0495650_0033897 3300046471 Bacteria 2266
144 Ga0495580_0097491 3300046472 Bacteria 2045
145 Ga0495582_0004405 3300046473 Bacteria 7924
146 Ga0495605_0000072 3300046474 Bacteria 133731
147 Ga0495605_0004164 3300046474 Bacteria 8520
148 Ga0495605_0012668 3300046474 Bacteria 4670
149 Ga0495605_0023744 3300046474 Bacteria 3220
150 Ga0495605_0027241 3300046474 Bacteria 2962
151 Ga0495605_0058663 3300046474 Bacteria 1849
152 Ga0495605_0082097 3300046474 Bacteria 1506
153 Ga0495605_0113909 3300046474 Bacteria 1231
154 Ga0495584_0000173 3300046491 Bacteria 45316
155 Ga0495584_0000254 3300046491 Bacteria 38075
156 Ga0495584_0016136 3300046491 Bacteria 3810
157 Ga0495584_0021198 3300046491 Bacteria 3300
158 Ga0495584_0043103 3300046491 Bacteria 2278
159 Ga0495584_0060143 3300046491 Bacteria 1910
160 Ga0495584_0077698 3300046491 Bacteria 1669
161 Ga0495584_0079077 3300046491 Bacteria 1654
162 Ga0495584_0266830 3300046491 Bacteria 870
163 Ga0495585_0000032 3300046492 Bacteria 143439
164 Ga0495585_0000531 3300046492 Bacteria 36056
165 Ga0495585_0001223 3300046492 Bacteria 20807
166 Ga0495585_0001673 3300046492 Bacteria 16947
167 Ga0495585_0003418 3300046492 Bacteria 10738
168 Ga0495585_0007283 3300046492 Bacteria 6791
169 Ga0495585_0009059 3300046492 Bacteria 5996
170 Ga0495585_0038768 3300046492 Bacteria 2681
171 Ga0495585_0105838 3300046492 Bacteria 1500
172 Ga0495594_0075432 3300046499 Bacteria 1880
173 Ga0495594_0152638 3300046499 Bacteria 1311
174 Ga0495594_0195670 3300046499 Bacteria 1152
175 Ga0495596_0000029 3300046500 Bacteria 103615
176 Ga0495596_0000243 3300046500 Bacteria 36829
177 Ga0495596_0000309 3300046500 Bacteria 32084
178 Ga0495596_0000812 3300046500 Bacteria 18902
179 Ga0495596_0001063 3300046500 Bacteria 16319
180 Ga0495596_0001487 3300046500 Bacteria 13398
181 Ga0495596_0001613 3300046500 Bacteria 12829
182 Ga0495596_0002435 3300046500 Bacteria 10022
183 Ga0495596_0004066 3300046500 Bacteria 7200
184 Ga0495596_0016064 3300046500 Bacteria 3116
185 Ga0495596_0017551 3300046500 Bacteria 2960
186 Ga0495596_0017721 3300046500 Bacteria 2944
187 Ga0495607_0001726 3300046501 Bacteria 18722
188 Ga0495607_0001937 3300046501 Bacteria 17486
189 Ga0495607_0002294 3300046501 Bacteria 15726
190 Ga0495607_0005992 3300046501 Bacteria 8618
191 Ga0495607_0013962 3300046501 Bacteria 5245
192 Ga0495607_0032502 3300046501 Bacteria 3184
193 Ga0495607_0041812 3300046501 Bacteria 2720
194 Ga0495607_0063321 3300046501 Bacteria 2092
195 Ga0495607_0089220 3300046501 Bacteria 1674
196 Ga0495583_0000011 3300046506 Bacteria 350215
197 Ga0495583_0000014 3300046506 Bacteria 320136
198 Ga0495583_0000058 3300046506 Bacteria 200120
199 Ga0495583_0000519 3300046506 Bacteria 54774
200 Ga0495583_0002335 3300046506 Bacteria 16482
201 Ga0495583_0008962 3300046506 Bacteria 6035
202 Ga0495583_0028892 3300046506 Bacteria 2720
203 Ga0495583_0097019 3300046506 Bacteria 1262
204 Ga0495583_0124790 3300046506 Bacteria 1081
205 Ga0495606_0024447 3300046507 Bacteria 4353
206 Ga0495610_0000008 3300046512 Bacteria 622732
207 Ga0495616_0000034 3300046513 Bacteria 129394
208 Ga0495616_0000131 3300046513 Bacteria 65268
209 Ga0495616_0000195 3300046513 Bacteria 50559
210 Ga0495616_0000388 3300046513 Bacteria 34173
211 Ga0495616_0003312 3300046513 Bacteria 10345
212 Ga0495616_0012532 3300046513 Bacteria 4810
213 Ga0495616_0012807 3300046513 Bacteria 4746
214 Ga0495616_0019800 3300046513 Bacteria 3669
215 Ga0495616_0022267 3300046513 Bacteria 3423
216 Ga0495616_0142917 3300046513 Bacteria 1088
217 Ga0495616_0207127 3300046513 Bacteria 859
218 Ga0495631_0004538 3300046518 Bacteria 7376
219 Ga0495631_0004913 3300046518 Bacteria 7044
220 Ga0495631_0011769 3300046518 Bacteria 4291
221 Ga0495631_0017067 3300046518 Bacteria 3441
222 Ga0495631_0033906 3300046518 Bacteria 2290
223 Ga0495631_0046689 3300046518 Bacteria 1903
224 Ga0495631_0091506 3300046518 Bacteria 1309
225 Ga0495631_0132408 3300046518 Bacteria 1071
226 Ga0495631_0155985 3300046518 Bacteria 979
227 Ga0495631_0156627 3300046518 Bacteria 977
228 Ga0495631_0159401 3300046518 Bacteria 968
229 Ga0495632_0000033 3300046519 Bacteria 164240
230 Ga0495632_0000056 3300046519 Bacteria 124483
231 Ga0495632_0000086 3300046519 Bacteria 95327
232 Ga0495632_0000156 3300046519 Bacteria 70702
233 Ga0495632_0000853 3300046519 Bacteria 26790
234 Ga0495632_0030366 3300046519 Bacteria 2805
235 Ga0495632_0050249 3300046519 Bacteria 2057
236 Ga0495632_0118471 3300046519 Bacteria 1238
237 Ga0495637_0001006 3300046520 Bacteria 17776
238 Ga0495637_0001806 3300046520 Bacteria 12251
239 Ga0495637_0010650 3300046520 Bacteria 4439
240 Ga0495637_0016498 3300046520 Bacteria 3451
241 Ga0495637_0057590 3300046520 Bacteria 1605
242 Ga0495643_0000330 3300046522 Bacteria 65068
243 Ga0495643_0000742 3300046522 Bacteria 37024
244 Ga0495643_0006905 3300046522 Bacteria 7391
245 Ga0495643_0010736 3300046522 Bacteria 5625
246 Ga0495643_0014186 3300046522 Bacteria 4746
247 Ga0495643_0039385 3300046522 Bacteria 2585
248 Ga0495643_0044213 3300046522 Bacteria 2421
249 Ga0495643_0054120 3300046522 Bacteria 2150
250 Ga0495643_0068565 3300046522 Bacteria 1866
251 Ga0495644_0000156 3300046523 Bacteria 32480
252 Ga0495644_0002270 3300046523 Bacteria 7688
253 Ga0495644_0012721 3300046523 Bacteria 3235
254 Ga0495644_0016028 3300046523 Bacteria 2871
255 Ga0495644_0055511 3300046523 Bacteria 1488
256 Ga0495648_0000116 3300046524 Bacteria 98123
257 Ga0495648_0000505 3300046524 Bacteria 41982
258 Ga0495648_0001000 3300046524 Bacteria 29021
259 Ga0495648_0003863 3300046524 Bacteria 12994
260 Ga0495648_0004157 3300046524 Bacteria 12444
261 Ga0495648_0005481 3300046524 Bacteria 10528
262 Ga0495648_0007837 3300046524 Bacteria 8495
263 Ga0495648_0051221 3300046524 Bacteria 2517
264 Ga0495648_0058659 3300046524 Bacteria 2300
265 Ga0495666_0029471 3300046526 Bacteria 2700
266 Ga0495666_0046545 3300046526 Bacteria 2091
267 Ga0495642_0000010 3300046528 Bacteria 136557
268 Ga0495642_0000218 3300046528 Bacteria 33005
269 Ga0495642_0000293 3300046528 Bacteria 28229
270 Ga0495642_0000459 3300046528 Bacteria 21479
271 Ga0495642_0011323 3300046528 Bacteria 3426
272 Ga0495642_0014391 3300046528 Bacteria 3065
273 Ga0495642_0023055 3300046528 Bacteria 2456
274 Ga0495642_0042907 3300046528 Bacteria 1844
275 Ga0495642_0080970 3300046528 Bacteria 1367
276 Ga0495654_0000058 3300046530 Bacteria 139884
277 Ga0495654_0004332 3300046530 Bacteria 8458
278 Ga0495654_0005595 3300046530 Bacteria 7271
279 Ga0495654_0067647 3300046530 Bacteria 1700
280 Ga0495665_0001347 3300046531 Bacteria 13125
281 Ga0495665_0015551 3300046531 Bacteria 4096
282 Ga0495586_0006821 3300046535 Bacteria 6089
283 Ga0495586_0014783 3300046535 Bacteria 4149
284 Ga0495587_0001570 3300046536 Bacteria 15194
285 Ga0495587_0105069 3300046536 Bacteria 1625
286 Ga0495609_0000044 3300046538 Bacteria 161642
287 Ga0495609_0000690 3300046538 Bacteria 26016
288 Ga0495609_0003410 3300046538 Bacteria 9117
289 Ga0495609_0007564 3300046538 Bacteria 5401
290 Ga0495609_0008735 3300046538 Bacteria 4937
291 Ga0495609_0045470 3300046538 Bacteria 1967
292 Ga0495609_0064124 3300046538 Bacteria 1621
293 Ga0495609_0119254 3300046538 Bacteria 1135
294 Ga0495597_0000196 3300046542 Bacteria 55404
295 Ga0495597_0002234 3300046542 Bacteria 12647
296 Ga0495597_0007050 3300046542 Bacteria 5754
297 Ga0495597_0008667 3300046542 Bacteria 5083
298 Ga0495597_0016905 3300046542 Bacteria 3441
299 Ga0495597_0120129 3300046542 Bacteria 1096
300 Ga0495597_0248308 3300046542 Bacteria 700
301 Ga0495622_0000167 3300046557 Bacteria 54264
302 Ga0495622_0001500 3300046557 Bacteria 11667
303 Ga0495622_0012995 3300046557 Bacteria 3863
304 Ga0495622_0047983 3300046557 Bacteria 1984
305 Ga0495633_0000703 3300046558 Bacteria 30527
306 Ga0495633_0001090 3300046558 Bacteria 21918
307 Ga0495633_0015052 3300046558 Bacteria 4021
308 Ga0495633_0023232 3300046558 Bacteria 3073
309 Ga0495633_0023994 3300046558 Bacteria 3018
310 Ga0495633_0042261 3300046558 Bacteria 2166
311 Ga0495633_0070457 3300046558 Bacteria 1632
312 Ga0495656_0000077 3300046615 Bacteria 43853
313 Ga0495656_0031426 3300046615 Bacteria 2153
314 Ga0495656_0040277 3300046615 Bacteria 1946
315 Ga0495656_0097851 3300046615 Bacteria 1352
316 Ga0495656_0309966 3300046615 Bacteria 811
317 Ga0495668_0000193 3300046616 Bacteria 89740
318 Ga0495668_0000532 3300046616 Bacteria 47353
319 Ga0495668_0002189 3300046616 Bacteria 16712
320 Ga0495668_0007214 3300046616 Bacteria 7138
321 Ga0495668_0013762 3300046616 Bacteria 4761
322 Ga0495668_0093539 3300046616 Bacteria 1646
323 Ga0495668_0134649 3300046616 Bacteria 1352
324 Ga0495668_0296964 3300046616 Bacteria 885
325 Ga0495611_0000850 3300046648 Bacteria 16737
326 Ga0495611_0002207 3300046648 Bacteria 9048
327 Ga0495611_0002540 3300046648 Bacteria 8294
328 Ga0495611_0023938 3300046648 Bacteria 2653
329 Ga0495611_0195302 3300046648 Bacteria 944
330 Ga0495625_0010704 3300046660 Bacteria 7554
331 Ga0495625_0014629 3300046660 Bacteria 6252
332 Ga0495625_0017544 3300046660 Bacteria 5604
333 Ga0495625_0048384 3300046660 Bacteria 3062
334 Ga0495625_0087641 3300046660 Bacteria 2158
335 Ga0495625_0099607 3300046660 Bacteria 1998
336 Ga0495625_0113126 3300046660 Bacteria 1854
337 Ga0495625_0169509 3300046660 Bacteria 1458
338 Ga0495625_0178259 3300046660 Bacteria 1415
339 Ga0495635_0010634 3300046663 Bacteria 6441
340 Ga0495659_0000003 3300046664 Bacteria 169166
341 Ga0495659_0000041 3300046664 Bacteria 59124
342 Ga0495659_0000538 3300046664 Bacteria 14018
343 Ga0495659_0007813 3300046664 Bacteria 3391
344 Ga0495661_0000426 3300046665 Bacteria 44529
345 Ga0495661_0002490 3300046665 Bacteria 14173
346 Ga0495661_0006243 3300046665 Bacteria 8379
347 Ga0495661_0017956 3300046665 Bacteria 4662
348 Ga0495661_0018907 3300046665 Bacteria 4522
349 Ga0495661_0020199 3300046665 Bacteria 4352
350 Ga0495661_0021810 3300046665 Bacteria 4170
351 Ga0495661_0031061 3300046665 Bacteria 3395
352 Ga0495661_0032380 3300046665 Bacteria 3305
353 Ga0495661_0045891 3300046665 Bacteria 2670
354 Ga0495661_0051794 3300046665 Bacteria 2477
355 Ga0495661_0200583 3300046665 Bacteria 1045
356 Ga0495588_0002966 3300046674 Bacteria 7332
357 Ga0495588_0041029 3300046674 Bacteria 2362
358 Ga0495588_0044110 3300046674 Bacteria 2283
359 Ga0495588_0172954 3300046674 Bacteria 1142
360 Ga0495588_0254507 3300046674 Bacteria 925
361 Ga0495669_0000017 3300046684 Bacteria 131447
362 Ga0495669_0000203 3300046684 Bacteria 36277
363 Ga0495669_0005584 3300046684 Bacteria 5246
364 Ga0495669_0031229 3300046684 Bacteria 2339
365 Ga0495669_0045923 3300046684 Bacteria 1948
366 Ga0495669_0050410 3300046684 Bacteria 1866
367 Ga0495613_0053263 3300046689 Bacteria 2978
368 Ga0495613_0220703 3300046689 Bacteria 1331
369 Ga0495624_0015547 3300046690 Bacteria 5136
370 Ga0495670_0000076 3300046691 Bacteria 43635
371 Ga0495670_0000460 3300046691 Bacteria 19471
372 Ga0495670_0000753 3300046691 Bacteria 15524
373 Ga0495670_0054852 3300046691 Bacteria 1998
374 Ga0495670_0061214 3300046691 Bacteria 1892
375 Ga0495671_0000087 3300046692 Bacteria 87327
376 Ga0495671_0000092 3300046692 Bacteria 85232
377 Ga0495671_0000116 3300046692 Bacteria 71676
378 Ga0495671_0000484 3300046692 Bacteria 30964
379 Ga0495671_0008571 3300046692 Bacteria 5742
380 Ga0495671_0029436 3300046692 Bacteria 2820
381 Ga0495671_0154790 3300046692 Bacteria 1115
382 Ga0495671_0185734 3300046692 Bacteria 1009
383 Ga0495649_0000166 3300046694 Bacteria 57538
384 Ga0495649_0004095 3300046694 Bacteria 9587
385 Ga0495649_0202577 3300046694 Bacteria 1030
386 Ga0495589_0000035 3300046794 Bacteria 161642
387 Ga0495589_0001393 3300046794 Bacteria 14055
388 Ga0495589_0021653 3300046794 Bacteria 3284
389 Ga0495589_0029314 3300046794 Bacteria 2774
390 Ga0495589_0039790 3300046794 Bacteria 2349
391 Ga0495589_0043858 3300046794 Bacteria 2225
392 Ga0495589_0091012 3300046794 Bacteria 1481
393 Ga0495589_0098576 3300046794 Bacteria 1415
394 Ga0495589_0192919 3300046794 Bacteria 963
395 Ga0495660_0005717 3300046810 Bacteria 7425
396 Ga0495660_0035876 3300046810 Bacteria 2768
397 Ga0495581_0009228 3300047315 Bacteria 5706
398 Ga0495581_0118009 3300047315 Bacteria 1543
399 Ga0495604_0010809 3300047317 Bacteria 7249
400 Ga0495604_0056933 3300047317 Bacteria 3006
401 Ga0495636_0000194 3300047318 Bacteria 23924
402 Ga0495636_0001027 3300047318 Bacteria 10464
403 Ga0495636_0034108 3300047318 Bacteria 2094
404 Ga0495636_0062529 3300047318 Bacteria 1576
405 Ga0495674_0289543 3300047319 Bacteria 1340
406 Ga0495672_0000023 3300047320 Bacteria 419080
407 Ga0495672_0001123 3300047320 Bacteria 27127
408 Ga0495672_0001427 3300047320 Bacteria 23485
409 Ga0495672_0002487 3300047320 Bacteria 16867
410 Ga0495672_0004870 3300047320 Bacteria 10799
411 Ga0495672_0092512 3300047320 Bacteria 1657
412 Ga0495672_0184765 3300047320 Bacteria 1053
413 Ga0495676_0000359 3300047321 Bacteria 37334
414 Ga0495680_0008177 3300047322 Bacteria 9538
415 Ga0495683_0005791 3300047323 Bacteria 6807
416 Ga0495683_0007124 3300047323 Bacteria 6068
417 Ga0495683_0019615 3300047323 Bacteria 3490
418 Ga0495683_0083323 3300047323 Bacteria 1557
419 Ga0495687_000002 3300047443 Bacteria 1085770
420 Ga0495687_000066 3300047443 Bacteria 161642
421 Ga0495687_000725 3300047443 Bacteria 36446
422 Ga0495687_001489 3300047443 Bacteria 21387
423 Ga0495675_0003976 3300047444 Bacteria 8960
424 Ga0495675_0040582 3300047444 Bacteria 2965
425 Ga0495677_0000013 3300047445 Bacteria 138372
426 Ga0495677_0000817 3300047445 Bacteria 12594
427 Ga0495677_0001313 3300047445 Bacteria 9944
428 Ga0495677_0002419 3300047445 Bacteria 7332
429 Ga0495677_0028233 3300047445 Bacteria 2037
430 Ga0495677_0105218 3300047445 Bacteria 1070
431 Ga0495679_014363 3300047446 Bacteria 2937
432 Ga0495679_053454 3300047446 Bacteria 1206
433 Ga0495679_054292 3300047446 Bacteria 1194
434 Ga0495685_000237 3300047447 Bacteria 18986
435 Ga0495685_000626 3300047447 Bacteria 10825
436 Ga0495685_004815 3300047447 Bacteria 4380
437 Ga0495685_007016 3300047447 Bacteria 3708
438 Ga0495685_058530 3300047447 Bacteria 1300
439 Ga0495673_0000003 3300047469 Bacteria 1491337
440 Ga0495673_0038898 3300047469 Bacteria 2161
441 Ga0495673_0094607 3300047469 Bacteria 1216
442 Ga0495681_0000016 3300047470 Bacteria 181322
443 Ga0495681_0010130 3300047470 Bacteria 5732
444 Ga0495681_0024956 3300047470 Bacteria 3135
445 Ga0495681_0039155 3300047470 Bacteria 2317
446 Ga0495681_0112283 3300047470 Bacteria 1179
447 Ga0495686_0000464 3300047472 Bacteria 60897
448 Ga0495593_0002588 3300047673 Bacteria 10877
449 Ga0495593_0039017 3300047673 Bacteria 2563
450 Ga0495593_0100836 3300047673 Bacteria 1480
451 Ga0495614_0004940 3300048089 Bacteria 6014
452 Ga0495614_0009931 3300048089 Bacteria 4201
453 Ga0495626_0000071 3300048091 Bacteria 136767
454 Ga0495626_0002561 3300048091 Bacteria 12453
455 Ga0495626_0002787 3300048091 Bacteria 11725
456 Ga0495626_0003182 3300048091 Bacteria 10692
457 Ga0495626_0003184 3300048091 Bacteria 10689
458 Ga0495626_0004939 3300048091 Bacteria 8002
459 Ga0495626_0007720 3300048091 Bacteria 5962
460 Ga0495626_0014101 3300048091 Bacteria 4134
461 Ga0495626_0023323 3300048091 Bacteria 3048
462 Ga0495626_0044972 3300048091 Bacteria 2063
463 Ga0495626_0052943 3300048091 Bacteria 1870
464 Ga0495626_0069925 3300048091 Bacteria 1580
465 Ga0495626_0120487 3300048091 Bacteria 1128
466 Ga0496102_0016451 3300048905 Bacteria 6462
467 Ga0496103_0101171 3300048906 Bacteria 1824
468 Ga0496110_0014362 3300048913 Bacteria 6573
469 Ga0496111_0030296 3300048914 Bacteria 3848
470 Ga0496114_0051058 3300048917 Bacteria 3443
471 Ga0496122_0006558 3300048925 Bacteria 13306
472 Ga0495678_000035 3300049459 Bacteria 200957
473 Ga0495678_000215 3300049459 Bacteria 66940
474 Ga0495678_000689 3300049459 Bacteria 30888
475 Ga0495678_014909 3300049459 Bacteria 3598
476 Ga0495682_0000224 3300049460 Bacteria 44478
477 Ga0495682_0000365 3300049460 Bacteria 32900
478 Ga0495682_0000677 3300049460 Bacteria 22419
479 Ga0495682_0000706 3300049460 Bacteria 21870
480 Ga0495682_0007037 3300049460 Bacteria 4505
481 Ga0495682_0009210 3300049460 Bacteria 3863
482 Ga0501067_0132937 3300049583 Bacteria 1385
483 Ga0501198_000014 3300049649 Bacteria 106940
484 Ga0501206_012860 3300049653 Bacteria 1140
485 Ga0501222_000008 3300049662 Bacteria 120904
486 nmdc:mga03683_10363_c1 3300050489 Bacteria 3341
487 nmdc:mga0yw44_18945_c1 3300050492 Bacteria 3784
488 nmdc:mga0k408_138307_c1 3300050493 Bacteria 1448
489 nmdc:mga0k408_31114_c1 3300050493 Bacteria 3046
490 nmdc:mga0k408_58391_c1 3300050493 Bacteria 2241
491 nmdc:mga04h51_14687_c1 3300050495 Bacteria 2243
492 nmdc:mga07m45_13482_c1 3300050496 Bacteria 4339
493 nmdc:mga07m45_330743_c1 3300050496 Bacteria 886
494 nmdc:mga07m45_74647_c1 3300050496 Bacteria 1932
495 Ga0500578_0000006 3300053086 Bacteria 234598
496 Ga0500651_0037482 3300053093 Bacteria 3055
497 Ga0500641_0005118 3300053096 Bacteria 4646
498 Ga0500562_020087 3300053108 Bacteria 1734
499 Ga0500593_079552 3300053117 Bacteria 1408
500 Ga0500595_007057 3300053119 Bacteria 4702
501 Ga0500628_009680 3300053129 Bacteria 1705
502 Ga0500652_000003 3300053131 Bacteria 221528
503 Ga0500652_000642 3300053131 Bacteria 11936
504 Ga0500655_018886 3300053133 Bacteria 1281
505 Ga0500586_000585 3300053145 Bacteria 7416
506 Ga0500586_047665 3300053145 Unclassified 1471
507 Ga0500619_000201 3300053154 Bacteria 13773
508 Ga0500622_0000221 3300053156 Bacteria 59833

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046542 Ga0495597_0248308 Ga0495597_0248308_12_674 219
2 3300046453 Ga0495627_000007 Ga0495627_000007_391620_392363 234
3 3300046506 Ga0495583_0000011 Ga0495583_0000011_195804_196589 241
4 3300046452 Ga0495617_011437 Ga0495617_011437_2247_2990 246
5 3300046455 Ga0495603_0081361 Ga0495603_0081361_441_1184 246
6 3300046457 Ga0495590_0006583 Ga0495590_0006583_1005_1748 246
7 3300046457 Ga0495590_0006631 Ga0495590_0006631_2031_2774 246
8 3300046459 Ga0495629_0077914 Ga0495629_0077914_217_960 246
9 3300046459 Ga0495629_0115771 Ga0495629_0115771_123_866 246
10 3300046459 Ga0495629_0140341 Ga0495629_0140341_447_1190 246
11 3300046460 Ga0495638_0001663 Ga0495638_0001663_2755_3498 246
12 3300046460 Ga0495638_0009045 Ga0495638_0009045_1837_2580 246
13 3300046460 Ga0495638_0190240 Ga0495638_0190240_310_1053 246
14 3300046463 Ga0495653_0063220 Ga0495653_0063220_1928_2671 246
15 3300046463 Ga0495653_0092966 Ga0495653_0092966_155_898 246
16 3300046463 Ga0495653_0165927 Ga0495653_0165927_172_915 246
17 3300046471 Ga0495650_0000215 Ga0495650_0000215_22631_23374 246
18 3300046471 Ga0495650_0000289 Ga0495650_0000289_14927_15670 246
19 3300046473 Ga0495582_0004405 Ga0495582_0004405_4816_5559 246
20 3300046474 Ga0495605_0004164 Ga0495605_0004164_1339_2082 246
21 3300046474 Ga0495605_0012668 Ga0495605_0012668_3462_4205 246
22 3300046474 Ga0495605_0058663 Ga0495605_0058663_848_1591 246
23 3300046474 Ga0495605_0113909 Ga0495605_0113909_25_768 246
24 3300046491 Ga0495584_0000173 Ga0495584_0000173_41717_42460 246
25 3300046491 Ga0495584_0000254 Ga0495584_0000254_13824_14567 246
26 3300046491 Ga0495584_0016136 Ga0495584_0016136_2185_2928 246
27 3300046491 Ga0495584_0021198 Ga0495584_0021198_2521_3264 246
28 3300046491 Ga0495584_0043103 Ga0495584_0043103_1278_2021 246
29 3300046491 Ga0495584_0077698 Ga0495584_0077698_291_1034 246
30 3300046491 Ga0495584_0266830 Ga0495584_0266830_71_814 246
31 3300046492 Ga0495585_0003418 Ga0495585_0003418_5436_6179 246
32 3300046492 Ga0495585_0007283 Ga0495585_0007283_1885_2628 246
33 3300046492 Ga0495585_0038768 Ga0495585_0038768_1249_1992 246
34 3300046492 Ga0495585_0105838 Ga0495585_0105838_411_1154 246
35 3300046499 Ga0495594_0075432 Ga0495594_0075432_687_1430 246
36 3300046499 Ga0495594_0152638 Ga0495594_0152638_158_901 246
37 3300046500 Ga0495596_0000309 Ga0495596_0000309_30622_31365 246
38 3300046500 Ga0495596_0001063 Ga0495596_0001063_298_1041 246
39 3300046500 Ga0495596_0001487 Ga0495596_0001487_3872_4615 246
40 3300046500 Ga0495596_0004066 Ga0495596_0004066_2275_3018 246
41 3300046500 Ga0495596_0017551 Ga0495596_0017551_1197_1940 246
42 3300046501 Ga0495607_0001937 Ga0495607_0001937_225_968 246
43 3300046501 Ga0495607_0005992 Ga0495607_0005992_4536_5279 246
44 3300046501 Ga0495607_0013962 Ga0495607_0013962_80_823 246
45 3300046501 Ga0495607_0041812 Ga0495607_0041812_21_764 246
46 3300046501 Ga0495607_0063321 Ga0495607_0063321_311_1054 246
47 3300046501 Ga0495607_0089220 Ga0495607_0089220_43_786 246
48 3300046506 Ga0495583_0000014 Ga0495583_0000014_136349_137092 246
49 3300046506 Ga0495583_0000519 Ga0495583_0000519_13068_13811 246
50 3300046506 Ga0495583_0002335 Ga0495583_0002335_6415_7158 246
51 3300046506 Ga0495583_0008962 Ga0495583_0008962_1123_1866 246
52 3300046506 Ga0495583_0028892 Ga0495583_0028892_1932_2675 246
53 3300046506 Ga0495583_0124790 Ga0495583_0124790_266_1009 246
54 3300046507 Ga0495606_0024447 Ga0495606_0024447_2400_3143 246
55 3300046512 Ga0495610_0000008 Ga0495610_0000008_618245_618988 246
56 3300046513 Ga0495616_0000034 Ga0495616_0000034_116562_117305 246
57 3300046513 Ga0495616_0000388 Ga0495616_0000388_24358_25101 246
58 3300046513 Ga0495616_0003312 Ga0495616_0003312_8878_9621 246
59 3300046513 Ga0495616_0012532 Ga0495616_0012532_2857_3600 246
60 3300046513 Ga0495616_0012807 Ga0495616_0012807_1501_2244 246
61 3300046513 Ga0495616_0019800 Ga0495616_0019800_1941_2684 246
62 3300046513 Ga0495616_0022267 Ga0495616_0022267_2665_3408 246
63 3300046513 Ga0495616_0142917 Ga0495616_0142917_146_889 246
64 3300046513 Ga0495616_0207127 Ga0495616_0207127_105_848 246
65 3300046518 Ga0495631_0004913 Ga0495631_0004913_1920_2663 246
66 3300046518 Ga0495631_0017067 Ga0495631_0017067_1429_2172 246
67 3300046518 Ga0495631_0132408 Ga0495631_0132408_306_1049 246
68 3300046518 Ga0495631_0156627 Ga0495631_0156627_69_812 246
69 3300046518 Ga0495631_0159401 Ga0495631_0159401_66_809 246
70 3300046519 Ga0495632_0000033 Ga0495632_0000033_112678_113421 246
71 3300046519 Ga0495632_0000086 Ga0495632_0000086_90516_91259 246
72 3300046519 Ga0495632_0000156 Ga0495632_0000156_59439_60182 246
73 3300046519 Ga0495632_0000853 Ga0495632_0000853_16401_17144 246
74 3300046519 Ga0495632_0030366 Ga0495632_0030366_818_1561 246
75 3300046520 Ga0495637_0001806 Ga0495637_0001806_1458_2201 246
76 3300046520 Ga0495637_0016498 Ga0495637_0016498_1021_1764 246
77 3300046520 Ga0495637_0057590 Ga0495637_0057590_537_1280 246
78 3300046522 Ga0495643_0000742 Ga0495643_0000742_13267_14010 246
79 3300046522 Ga0495643_0010736 Ga0495643_0010736_4684_5427 246
80 3300046522 Ga0495643_0014186 Ga0495643_0014186_313_1056 246
81 3300046522 Ga0495643_0039385 Ga0495643_0039385_280_1023 246
82 3300046522 Ga0495643_0044213 Ga0495643_0044213_372_1115 246
83 3300046523 Ga0495644_0000156 Ga0495644_0000156_14165_14908 246
84 3300046523 Ga0495644_0012721 Ga0495644_0012721_19_762 246
85 3300046523 Ga0495644_0016028 Ga0495644_0016028_1415_2158 246
86 3300046524 Ga0495648_0001000 Ga0495648_0001000_19751_20494 246
87 3300046524 Ga0495648_0003863 Ga0495648_0003863_9071_9814 246
88 3300046524 Ga0495648_0004157 Ga0495648_0004157_4034_4777 246
89 3300046524 Ga0495648_0005481 Ga0495648_0005481_2595_3338 246
90 3300046524 Ga0495648_0007837 Ga0495648_0007837_5508_6251 246
91 3300046526 Ga0495666_0029471 Ga0495666_0029471_1636_2379 246
92 3300046526 Ga0495666_0046545 Ga0495666_0046545_473_1216 246
93 3300046528 Ga0495642_0000218 Ga0495642_0000218_4038_4781 246
94 3300046528 Ga0495642_0000459 Ga0495642_0000459_11981_12724 246
95 3300046528 Ga0495642_0023055 Ga0495642_0023055_672_1415 246
96 3300046528 Ga0495642_0042907 Ga0495642_0042907_276_1019 246
97 3300046530 Ga0495654_0000058 Ga0495654_0000058_76901_77644 246
98 3300046530 Ga0495654_0005595 Ga0495654_0005595_3601_4344 246
99 3300046530 Ga0495654_0067647 Ga0495654_0067647_685_1428 246
100 3300046531 Ga0495665_0015551 Ga0495665_0015551_2910_3653 246
101 3300046535 Ga0495586_0014783 Ga0495586_0014783_2159_2902 246
102 3300046536 Ga0495587_0001570 Ga0495587_0001570_133_876 246
103 3300046538 Ga0495609_0000690 Ga0495609_0000690_2238_2981 246
104 3300046538 Ga0495609_0007564 Ga0495609_0007564_1435_2178 246
105 3300046538 Ga0495609_0008735 Ga0495609_0008735_1578_2321 246
106 3300046538 Ga0495609_0045470 Ga0495609_0045470_164_907 246
107 3300046542 Ga0495597_0000196 Ga0495597_0000196_18114_18857 246
108 3300046542 Ga0495597_0002234 Ga0495597_0002234_7376_8119 246
109 3300046542 Ga0495597_0007050 Ga0495597_0007050_2744_3487 246
110 3300046542 Ga0495597_0016905 Ga0495597_0016905_2000_2743 246
111 3300046558 Ga0495633_0000703 Ga0495633_0000703_20584_21327 246
112 3300046558 Ga0495633_0015052 Ga0495633_0015052_1318_2061 246
113 3300046558 Ga0495633_0023232 Ga0495633_0023232_72_815 246
114 3300046558 Ga0495633_0023994 Ga0495633_0023994_2127_2870 246
115 3300046558 Ga0495633_0070457 Ga0495633_0070457_30_773 246
116 3300046615 Ga0495656_0000077 Ga0495656_0000077_28596_29339 246
117 3300046615 Ga0495656_0031426 Ga0495656_0031426_1140_1883 246
118 3300046615 Ga0495656_0309966 Ga0495656_0309966_20_763 246
119 3300046616 Ga0495668_0002189 Ga0495668_0002189_2928_3671 246
120 3300046616 Ga0495668_0007214 Ga0495668_0007214_5587_6330 246
121 3300046616 Ga0495668_0013762 Ga0495668_0013762_550_1293 246
122 3300046616 Ga0495668_0134649 Ga0495668_0134649_140_883 246
123 3300046616 Ga0495668_0296964 Ga0495668_0296964_41_784 246
124 3300046648 Ga0495611_0000850 Ga0495611_0000850_4016_4759 246
125 3300046648 Ga0495611_0002540 Ga0495611_0002540_6551_7294 246
126 3300046660 Ga0495625_0010704 Ga0495625_0010704_5253_5996 246
127 3300046660 Ga0495625_0017544 Ga0495625_0017544_3657_4400 246
128 3300046660 Ga0495625_0099607 Ga0495625_0099607_1013_1756 246
129 3300046660 Ga0495625_0113126 Ga0495625_0113126_374_1117 246
130 3300046660 Ga0495625_0169509 Ga0495625_0169509_97_840 246
131 3300046660 Ga0495625_0178259 Ga0495625_0178259_525_1268 246
132 3300046663 Ga0495635_0010634 Ga0495635_0010634_4662_5405 246
133 3300046664 Ga0495659_0000041 Ga0495659_0000041_13250_13993 246
134 3300046664 Ga0495659_0000538 Ga0495659_0000538_6339_7082 246
135 3300046664 Ga0495659_0007813 Ga0495659_0007813_142_885 246
136 3300046665 Ga0495661_0002490 Ga0495661_0002490_11000_11743 246
137 3300046665 Ga0495661_0006243 Ga0495661_0006243_6500_7243 246
138 3300046665 Ga0495661_0018907 Ga0495661_0018907_2595_3338 246
139 3300046665 Ga0495661_0031061 Ga0495661_0031061_68_811 246
140 3300046665 Ga0495661_0032380 Ga0495661_0032380_1249_1992 246
141 3300046665 Ga0495661_0200583 Ga0495661_0200583_275_1018 246
142 3300046674 Ga0495588_0044110 Ga0495588_0044110_266_1009 246
143 3300046674 Ga0495588_0172954 Ga0495588_0172954_344_1087 246
144 3300046674 Ga0495588_0254507 Ga0495588_0254507_61_804 246
145 3300046684 Ga0495669_0000203 Ga0495669_0000203_4069_4812 246
146 3300046684 Ga0495669_0031229 Ga0495669_0031229_615_1358 246
147 3300046689 Ga0495613_0053263 Ga0495613_0053263_845_1588 246
148 3300046689 Ga0495613_0220703 Ga0495613_0220703_303_1046 246
149 3300046691 Ga0495670_0000076 Ga0495670_0000076_30505_31248 246
150 3300046691 Ga0495670_0000753 Ga0495670_0000753_13382_14125 246
151 3300046691 Ga0495670_0054852 Ga0495670_0054852_1085_1828 246
152 3300046692 Ga0495671_0000116 Ga0495671_0000116_68902_69645 246
153 3300046692 Ga0495671_0000484 Ga0495671_0000484_13650_14393 246
154 3300046692 Ga0495671_0008571 Ga0495671_0008571_4738_5481 246
155 3300046692 Ga0495671_0029436 Ga0495671_0029436_1333_2076 246
156 3300046692 Ga0495671_0185734 Ga0495671_0185734_217_960 246
157 3300046694 Ga0495649_0000166 Ga0495649_0000166_14158_14901 246
158 3300046694 Ga0495649_0004095 Ga0495649_0004095_2713_3456 246
159 3300046694 Ga0495649_0202577 Ga0495649_0202577_228_971 246
160 3300046794 Ga0495589_0001393 Ga0495589_0001393_2385_3128 246
161 3300046794 Ga0495589_0021653 Ga0495589_0021653_1606_2349 246
162 3300046794 Ga0495589_0029314 Ga0495589_0029314_348_1091 246
163 3300046794 Ga0495589_0039790 Ga0495589_0039790_526_1269 246
164 3300046794 Ga0495589_0098576 Ga0495589_0098576_284_1027 246
165 3300046810 Ga0495660_0005717 Ga0495660_0005717_4970_5713 246
166 3300046810 Ga0495660_0035876 Ga0495660_0035876_197_940 246
167 3300047315 Ga0495581_0118009 Ga0495581_0118009_713_1456 246
168 3300047317 Ga0495604_0056933 Ga0495604_0056933_1077_1820 246
169 3300047318 Ga0495636_0000194 Ga0495636_0000194_13151_13894 246
170 3300047318 Ga0495636_0001027 Ga0495636_0001027_8275_9018 246
171 3300047318 Ga0495636_0034108 Ga0495636_0034108_507_1250 246
172 3300047318 Ga0495636_0062529 Ga0495636_0062529_188_931 246
173 3300047320 Ga0495672_0000023 Ga0495672_0000023_18887_19630 246
174 3300047320 Ga0495672_0001123 Ga0495672_0001123_12428_13171 246
175 3300047320 Ga0495672_0001427 Ga0495672_0001427_9330_10073 246
176 3300047320 Ga0495672_0004870 Ga0495672_0004870_7804_8547 246
177 3300047320 Ga0495672_0092512 Ga0495672_0092512_191_934 246
178 3300047320 Ga0495672_0184765 Ga0495672_0184765_162_905 246
179 3300047322 Ga0495680_0008177 Ga0495680_0008177_208_951 246
180 3300047323 Ga0495683_0007124 Ga0495683_0007124_2210_2953 246
181 3300047323 Ga0495683_0083323 Ga0495683_0083323_656_1399 246
182 3300047443 Ga0495687_000725 Ga0495687_000725_23509_24252 246
183 3300047443 Ga0495687_001489 Ga0495687_001489_19920_20663 246
184 3300047444 Ga0495675_0003976 Ga0495675_0003976_5377_6120 246
185 3300047444 Ga0495675_0040582 Ga0495675_0040582_2177_2920 246
186 3300047445 Ga0495677_0000817 Ga0495677_0000817_9368_10111 246
187 3300047445 Ga0495677_0001313 Ga0495677_0001313_725_1468 246
188 3300047445 Ga0495677_0002419 Ga0495677_0002419_1767_2510 246
189 3300047445 Ga0495677_0028233 Ga0495677_0028233_39_782 246
190 3300047446 Ga0495679_014363 Ga0495679_014363_2011_2754 246
191 3300047446 Ga0495679_053454 Ga0495679_053454_173_916 246
192 3300047446 Ga0495679_054292 Ga0495679_054292_255_998 246
193 3300047447 Ga0495685_000237 Ga0495685_000237_8528_9271 246
194 3300047447 Ga0495685_000626 Ga0495685_000626_10031_10774 246
195 3300047447 Ga0495685_004815 Ga0495685_004815_303_1046 246
196 3300047447 Ga0495685_007016 Ga0495685_007016_1432_2175 246
197 3300047469 Ga0495673_0000003 Ga0495673_0000003_8424_9167 246
198 3300047469 Ga0495673_0094607 Ga0495673_0094607_449_1192 246
199 3300047470 Ga0495681_0010130 Ga0495681_0010130_3625_4368 246
200 3300047470 Ga0495681_0024956 Ga0495681_0024956_500_1243 246
201 3300047470 Ga0495681_0112283 Ga0495681_0112283_347_1090 246
202 3300047673 Ga0495593_0002588 Ga0495593_0002588_5944_6687 246
203 3300047673 Ga0495593_0039017 Ga0495593_0039017_1486_2229 246
204 3300047673 Ga0495593_0100836 Ga0495593_0100836_339_1082 246
205 3300048089 Ga0495614_0004940 Ga0495614_0004940_4891_5634 246
206 3300048089 Ga0495614_0009931 Ga0495614_0009931_3019_3762 246
207 3300048091 Ga0495626_0003184 Ga0495626_0003184_2593_3336 246
208 3300048091 Ga0495626_0004939 Ga0495626_0004939_2185_2928 246
209 3300048091 Ga0495626_0007720 Ga0495626_0007720_2654_3397 246
210 3300048091 Ga0495626_0069925 Ga0495626_0069925_233_976 246
211 3300048091 Ga0495626_0120487 Ga0495626_0120487_311_1054 246
212 3300048906 Ga0496103_0101171 Ga0496103_0101171_475_1218 246
213 3300049459 Ga0495678_000035 Ga0495678_000035_11130_11873 246
214 3300049459 Ga0495678_000689 Ga0495678_000689_8943_9686 246
215 3300049459 Ga0495678_014909 Ga0495678_014909_2828_3571 246
216 3300049460 Ga0495682_0000224 Ga0495682_0000224_42659_43402 246
217 3300049460 Ga0495682_0000365 Ga0495682_0000365_14716_15459 246
218 3300049460 Ga0495682_0000706 Ga0495682_0000706_20052_20795 246
219 3300049460 Ga0495682_0007037 Ga0495682_0007037_2876_3619 246
220 3300049460 Ga0495682_0009210 Ga0495682_0009210_714_1457 246
221 3300053145 Ga0500586_000585 Ga0500586_000585_5628_6371 246
222 3300053145 Ga0500586_047665 Ga0500586_047665_568_1311 246
223 iso_pu_bacteria 2671180330 2672336449 249
224 iso_pu_bacteria 2816332186 2816863086 249
225 iso_pu_bacteria 2842682962 2842683137 249
226 iso_pu_bacteria 2849139964 2849143879 249
227 iso_pu_bacteria 2857581216 2857582831 249
228 3300031235 Ga0265330_10011185 Ga0265330_100111855 251
229 3300031238 Ga0265332_10019421 Ga0265332_100194213 251
230 3300031239 Ga0265328_10035630 Ga0265328_100356302 251
231 3300031242 Ga0265329_10008772 Ga0265329_100087723 251
232 3300031249 Ga0265339_10022358 Ga0265339_100223583 251
233 3300031250 Ga0265331_10004561 Ga0265331_100045612 251
234 3300031251 Ga0265327_10003970 Ga0265327_1000397011 251
235 3300031344 Ga0265316_10057111 Ga0265316_100571112 251
236 3300031595 Ga0265313_10045132 Ga0265313_100451322 251
237 3300031711 Ga0265314_10031018 Ga0265314_100310182 251
238 3300046691 Ga0495670_0000460 Ga0495670_0000460_15351_16151 251
239 3300006946 Ga0079104_1000267 Ga0079104_100026755 252
240 3300027111 Ga0209281_1000076 Ga0209281_1000076110 252
241 3300047470 Ga0495681_0000016 Ga0495681_0000016_37888_38649 252
242 3300025294 Ga0209025_1007958 Ga0209025_10079583 253
243 3300046455 Ga0495603_0236403 Ga0495603_0236403_54_824 253
244 3300048913 Ga0496110_0014362 Ga0496110_0014362_4428_5198 253
245 3300048914 Ga0496111_0030296 Ga0496111_0030296_979_1749 253
246 3300048925 Ga0496122_0006558 Ga0496122_0006558_697_1467 253
247 3300046460 Ga0495638_0000621 Ga0495638_0000621_34388_35164 255
248 3300046520 Ga0495637_0001006 Ga0495637_0001006_12842_13618 255
249 3300046524 Ga0495648_0051221 Ga0495648_0051221_299_1075 255
250 3300046692 Ga0495671_0154790 Ga0495671_0154790_158_934 255
251 3300014968 Ga0157379_10593546 Ga0157379_105935461 256
252 3300046492 Ga0495585_0001673 Ga0495585_0001673_81_854 256
253 iso_pu_bacteria 2738541280 2738739698 256
254 iso_pu_bacteria 2738541297 2738830425 256
255 iso_pu_bacteria 2738541357 2739154221 256
256 iso_pu_bacteria 2738543003 2739196246 256
257 iso_pu_bacteria 2738543026 2739322617 256
258 iso_pu_bacteria 2738543029 2739340858 256
259 3300009093 Ga0105240_10089772 Ga0105240_100897722 257
260 3300050496 nmdc:mga07m45_330743_c1 nmdc:mga07m45_330743_c1_33_842 257
261 3300053108 Ga0500562_020087 Ga0500562_020087_11_808 257
262 3300049583 Ga0501067_0132937 Ga0501067_0132937_377_1219 258
263 3300006042 Ga0075368_10020643 Ga0075368_100206432 259
264 3300006051 Ga0075364_10103939 Ga0075364_101039392 259
265 3300006177 Ga0075362_10013240 Ga0075362_100132402 259
266 3300006178 Ga0075367_10007323 Ga0075367_100073232 259
267 3300006186 Ga0075369_10009873 Ga0075369_100098733 259
268 3300039447 Ga0436361_0883434 Ga0436361_0883434_137_922 259
269 3300046500 Ga0495596_0000029 Ga0495596_0000029_50699_51481 259
270 3300046794 Ga0495589_0091012 Ga0495589_0091012_104_886 259
271 3300047323 Ga0495683_0005791 Ga0495683_0005791_5160_5942 259
272 3300050489 nmdc:mga03683_10363_c1 nmdc:mga03683_10363_c1_1029_1814 259
273 3300050492 nmdc:mga0yw44_18945_c1 nmdc:mga0yw44_18945_c1_2769_3554 259
274 3300050495 nmdc:mga04h51_14687_c1 nmdc:mga04h51_14687_c1_601_1386 259
275 3300053096 Ga0500641_0005118 Ga0500641_0005118_2970_3755 259
276 3300053119 Ga0500595_007057 Ga0500595_007057_3518_4303 259
277 3300053131 Ga0500652_000003 Ga0500652_000003_27838_28623 259
278 iso_pu_bacteria 2995948881 2995952834 259
279 3300046452 Ga0495617_000012 Ga0495617_000012_172889_173674 260
280 3300046453 Ga0495627_000118 Ga0495627_000118_17305_18090 260
281 3300046460 Ga0495638_0093606 Ga0495638_0093606_19_804 260
282 3300046471 Ga0495650_0000213 Ga0495650_0000213_48860_49645 260
283 3300046471 Ga0495650_0033897 Ga0495650_0033897_333_1118 260
284 3300046472 Ga0495580_0097491 Ga0495580_0097491_21_806 260
285 3300046474 Ga0495605_0000072 Ga0495605_0000072_37647_38432 260
286 3300046474 Ga0495605_0023744 Ga0495605_0023744_1130_1915 260
287 3300046474 Ga0495605_0027241 Ga0495605_0027241_45_830 260
288 3300046474 Ga0495605_0082097 Ga0495605_0082097_667_1452 260
289 3300046491 Ga0495584_0060143 Ga0495584_0060143_778_1563 260
290 3300046491 Ga0495584_0079077 Ga0495584_0079077_157_942 260
291 3300046492 Ga0495585_0000032 Ga0495585_0000032_73731_74516 260
292 3300046492 Ga0495585_0000531 Ga0495585_0000531_21073_21858 260
293 3300046492 Ga0495585_0001223 Ga0495585_0001223_15307_16092 260
294 3300046492 Ga0495585_0009059 Ga0495585_0009059_2676_3461 260
295 3300046499 Ga0495594_0195670 Ga0495594_0195670_71_856 260
296 3300046500 Ga0495596_0000243 Ga0495596_0000243_11464_12249 260
297 3300046500 Ga0495596_0000812 Ga0495596_0000812_2703_3488 260
298 3300046500 Ga0495596_0001613 Ga0495596_0001613_11758_12543 260
299 3300046500 Ga0495596_0002435 Ga0495596_0002435_8951_9736 260
300 3300046500 Ga0495596_0016064 Ga0495596_0016064_1356_2141 260
301 3300046500 Ga0495596_0017721 Ga0495596_0017721_301_1086 260
302 3300046501 Ga0495607_0001726 Ga0495607_0001726_7437_8222 260
303 3300046501 Ga0495607_0002294 Ga0495607_0002294_13656_14441 260
304 3300046501 Ga0495607_0032502 Ga0495607_0032502_373_1158 260
305 3300046506 Ga0495583_0000058 Ga0495583_0000058_38822_39607 260
306 3300046506 Ga0495583_0097019 Ga0495583_0097019_162_947 260
307 3300046513 Ga0495616_0000131 Ga0495616_0000131_45007_45792 260
308 3300046513 Ga0495616_0000195 Ga0495616_0000195_8521_9306 260
309 3300046518 Ga0495631_0004538 Ga0495631_0004538_3282_4067 260
310 3300046518 Ga0495631_0011769 Ga0495631_0011769_363_1148 260
311 3300046518 Ga0495631_0033906 Ga0495631_0033906_1051_1836 260
312 3300046518 Ga0495631_0046689 Ga0495631_0046689_247_1032 260
313 3300046518 Ga0495631_0091506 Ga0495631_0091506_68_853 260
314 3300046518 Ga0495631_0155985 Ga0495631_0155985_56_841 260
315 3300046519 Ga0495632_0000056 Ga0495632_0000056_77600_78385 260
316 3300046520 Ga0495637_0010650 Ga0495637_0010650_3455_4240 260
317 3300046522 Ga0495643_0000330 Ga0495643_0000330_40358_41143 260
318 3300046522 Ga0495643_0006905 Ga0495643_0006905_4409_5194 260
319 3300046522 Ga0495643_0054120 Ga0495643_0054120_659_1444 260
320 3300046522 Ga0495643_0068565 Ga0495643_0068565_873_1658 260
321 3300046523 Ga0495644_0002270 Ga0495644_0002270_284_1069 260
322 3300046523 Ga0495644_0055511 Ga0495644_0055511_243_1028 260
323 3300046524 Ga0495648_0000116 Ga0495648_0000116_18677_19462 260
324 3300046524 Ga0495648_0000505 Ga0495648_0000505_36643_37428 260
325 3300046524 Ga0495648_0058659 Ga0495648_0058659_817_1602 260
326 3300046528 Ga0495642_0000010 Ga0495642_0000010_19455_20240 260
327 3300046528 Ga0495642_0000293 Ga0495642_0000293_25009_25794 260
328 3300046528 Ga0495642_0011323 Ga0495642_0011323_911_1696 260
329 3300046528 Ga0495642_0014391 Ga0495642_0014391_530_1315 260
330 3300046528 Ga0495642_0080970 Ga0495642_0080970_44_829 260
331 3300046531 Ga0495665_0001347 Ga0495665_0001347_3784_4569 260
332 3300046535 Ga0495586_0006821 Ga0495586_0006821_3863_4648 260
333 3300046538 Ga0495609_0000044 Ga0495609_0000044_63424_64209 260
334 3300046538 Ga0495609_0003410 Ga0495609_0003410_3124_3909 260
335 3300046538 Ga0495609_0064124 Ga0495609_0064124_424_1209 260
336 3300046538 Ga0495609_0119254 Ga0495609_0119254_121_906 260
337 3300046542 Ga0495597_0008667 Ga0495597_0008667_3605_4390 260
338 3300046542 Ga0495597_0120129 Ga0495597_0120129_283_1068 260
339 3300046557 Ga0495622_0000167 Ga0495622_0000167_32917_33702 260
340 3300046557 Ga0495622_0001500 Ga0495622_0001500_10588_11373 260
341 3300046557 Ga0495622_0012995 Ga0495622_0012995_359_1144 260
342 3300046557 Ga0495622_0047983 Ga0495622_0047983_288_1073 260
343 3300046558 Ga0495633_0001090 Ga0495633_0001090_7080_7865 260
344 3300046558 Ga0495633_0042261 Ga0495633_0042261_749_1534 260
345 3300046615 Ga0495656_0040277 Ga0495656_0040277_900_1685 260
346 3300046615 Ga0495656_0097851 Ga0495656_0097851_152_937 260
347 3300046616 Ga0495668_0000193 Ga0495668_0000193_70636_71421 260
348 3300046616 Ga0495668_0000532 Ga0495668_0000532_18474_19259 260
349 3300046616 Ga0495668_0093539 Ga0495668_0093539_231_1016 260
350 3300046648 Ga0495611_0002207 Ga0495611_0002207_5108_5893 260
351 3300046648 Ga0495611_0023938 Ga0495611_0023938_1811_2596 260
352 3300046648 Ga0495611_0195302 Ga0495611_0195302_55_840 260
353 3300046660 Ga0495625_0048384 Ga0495625_0048384_1393_2178 260
354 3300046660 Ga0495625_0087641 Ga0495625_0087641_508_1293 260
355 3300046664 Ga0495659_0000003 Ga0495659_0000003_4399_5184 260
356 3300046665 Ga0495661_0000426 Ga0495661_0000426_7132_7917 260
357 3300046665 Ga0495661_0017956 Ga0495661_0017956_2175_2960 260
358 3300046665 Ga0495661_0020199 Ga0495661_0020199_3544_4329 260
359 3300046665 Ga0495661_0021810 Ga0495661_0021810_2484_3269 260
360 3300046665 Ga0495661_0045891 Ga0495661_0045891_743_1528 260
361 3300046665 Ga0495661_0051794 Ga0495661_0051794_828_1613 260
362 3300046674 Ga0495588_0002966 Ga0495588_0002966_6097_6882 260
363 3300046674 Ga0495588_0041029 Ga0495588_0041029_238_1023 260
364 3300046684 Ga0495669_0000017 Ga0495669_0000017_108380_109165 260
365 3300046684 Ga0495669_0005584 Ga0495669_0005584_1433_2218 260
366 3300046684 Ga0495669_0045923 Ga0495669_0045923_814_1599 260
367 3300046684 Ga0495669_0050410 Ga0495669_0050410_803_1588 260
368 3300046690 Ga0495624_0015547 Ga0495624_0015547_3000_3785 260
369 3300046691 Ga0495670_0061214 Ga0495670_0061214_1041_1826 260
370 3300046692 Ga0495671_0000087 Ga0495671_0000087_25334_26119 260
371 3300046692 Ga0495671_0000092 Ga0495671_0000092_69719_70504 260
372 3300046794 Ga0495589_0000035 Ga0495589_0000035_63424_64209 260
373 3300046794 Ga0495589_0043858 Ga0495589_0043858_284_1069 260
374 3300046794 Ga0495589_0192919 Ga0495589_0192919_70_855 260
375 3300047315 Ga0495581_0009228 Ga0495581_0009228_1813_2598 260
376 3300047317 Ga0495604_0010809 Ga0495604_0010809_1103_1888 260
377 3300047319 Ga0495674_0289543 Ga0495674_0289543_262_1047 260
378 3300047320 Ga0495672_0002487 Ga0495672_0002487_10027_10812 260
379 3300047321 Ga0495676_0000359 Ga0495676_0000359_7797_8582 260
380 3300047323 Ga0495683_0019615 Ga0495683_0019615_2601_3386 260
381 3300047443 Ga0495687_000002 Ga0495687_000002_489536_490321 260
382 3300047443 Ga0495687_000066 Ga0495687_000066_63424_64209 260
383 3300047445 Ga0495677_0000013 Ga0495677_0000013_97434_98219 260
384 3300047445 Ga0495677_0105218 Ga0495677_0105218_168_953 260
385 3300047447 Ga0495685_058530 Ga0495685_058530_340_1125 260
386 3300047469 Ga0495673_0038898 Ga0495673_0038898_1245_2030 260
387 3300047470 Ga0495681_0039155 Ga0495681_0039155_1023_1808 260
388 3300047472 Ga0495686_0000464 Ga0495686_0000464_8047_8832 260
389 3300048091 Ga0495626_0000071 Ga0495626_0000071_34931_35716 260
390 3300048091 Ga0495626_0002561 Ga0495626_0002561_11539_12324 260
391 3300048091 Ga0495626_0002787 Ga0495626_0002787_2115_2900 260
392 3300048091 Ga0495626_0003182 Ga0495626_0003182_2853_3638 260
393 3300048091 Ga0495626_0014101 Ga0495626_0014101_2372_3157 260
394 3300048091 Ga0495626_0023323 Ga0495626_0023323_1568_2353 260
395 3300048091 Ga0495626_0044972 Ga0495626_0044972_215_1000 260
396 3300048091 Ga0495626_0052943 Ga0495626_0052943_167_952 260
397 3300049459 Ga0495678_000215 Ga0495678_000215_42229_43014 260
398 3300049460 Ga0495682_0000677 Ga0495682_0000677_2321_3106 260
399 3300031238 Ga0265332_10002259 Ga0265332_100022593 261
400 3300031241 Ga0265325_10055729 Ga0265325_100557292 261
401 3300031247 Ga0265340_10004855 Ga0265340_100048556 261
402 3300031249 Ga0265339_10004680 Ga0265339_100046808 261
403 3300031250 Ga0265331_10022461 Ga0265331_100224613 261
404 3300031712 Ga0265342_10000210 Ga0265342_1000021069 261
405 3300003187 JGI25151J46595_10013357 JGI25151J46595_100133571 262
406 3300003322 rootL2_10137477 rootL2_101374771 262
407 3300015689 Ga0183360_10001 Ga0183360_10001380 262
408 3300048905 Ga0496102_0016451 Ga0496102_0016451_3535_4377 265
409 iso_pu_bacteria 2643221644 2644248723 266
410 iso_pu_bacteria 2585428057 2587730797 267
411 iso_pu_bacteria 2585428058 2587737168 267
412 iso_pu_bacteria 2585428062 2587756134 267
413 iso_pu_bacteria 2588253510 2588294633 267
414 iso_pu_bacteria 2643221592 2643971647 267
415 iso_pu_bacteria 2643221625 2644142725 267
416 iso_pu_bacteria 2643221648 2644272714 267
417 3300046452 Ga0495617_000129 Ga0495617_000129_38460_39281 269
418 3300046463 Ga0495653_0075948 Ga0495653_0075948_71_889 269
419 3300046530 Ga0495654_0004332 Ga0495654_0004332_2071_2892 269
420 3300046536 Ga0495587_0105069 Ga0495587_0105069_685_1503 269
421 3300049649 Ga0501198_000014 Ga0501198_000014_88895_89743 269
422 3300049653 Ga0501206_012860 Ga0501206_012860_21_869 269
423 3300049662 Ga0501222_000008 Ga0501222_000008_14741_15589 269
424 3300003775 Ga0055524_1000233 Ga0055524_100023332 270
425 3300003791 Ga0055530_10000758 Ga0055530_1000075817 270
426 3300003792 Ga0055540_1000080 Ga0055540_100008080 270
427 3300005344 Ga0070661_100002124 Ga0070661_1000021249 270
428 3300005366 Ga0070659_100001740 Ga0070659_1000017402 270
429 3300005564 Ga0070664_100004314 Ga0070664_1000043149 270
430 3300025291 Ga0209675_1014907 Ga0209675_10149072 270
431 3300025298 Ga0209050_1000739 Ga0209050_10007397 270
432 3300025298 Ga0209050_1028009 Ga0209050_10280092 270
433 3300025299 Ga0209256_1000203 Ga0209256_100020379 270
434 3300025303 Ga0209051_1000035 Ga0209051_100003579 270
435 3300025304 Ga0209257_1000346 Ga0209257_100034638 270
436 3300025920 Ga0207649_10001856 Ga0207649_100018565 270
437 3300025945 Ga0207679_10007881 Ga0207679_100078812 270
438 3300042121 Ga0450919_002169 Ga0450919_002169_883_1716 270
439 3300042125 Ga0450923_008095 Ga0450923_008095_68_901 270
440 3300042531 Ga0450918_000766 Ga0450918_000766_4950_5783 270
441 3300048917 Ga0496114_0051058 Ga0496114_0051058_1514_2347 270
442 3300003215 JGI25153J46596_10004031 JGI25153J46596_100040317 271
443 3300003215 JGI25153J46596_10031434 JGI25153J46596_100314342 271
444 3300003771 Ga0055526_1010965 Ga0055526_10109652 271
445 3300005262 Ga0065165_1005423 Ga0065165_10054233 271
446 3300005455 Ga0070663_100238995 Ga0070663_1002389951 271
447 3300005616 Ga0068852_100298318 Ga0068852_1002983181 271
448 3300006042 Ga0075368_10090557 Ga0075368_100905571 271
449 3300006048 Ga0075363_100018328 Ga0075363_1000183282 271
450 3300006048 Ga0075363_100086239 Ga0075363_1000862392 271
451 3300006178 Ga0075367_10007224 Ga0075367_100072243 271
452 3300006186 Ga0075369_10010697 Ga0075369_100106974 271
453 3300006195 Ga0075366_10132880 Ga0075366_101328801 271
454 3300006353 Ga0075370_10001889 Ga0075370_100018892 271
455 3300025245 Ga0207425_1002947 Ga0207425_10029474 271
456 3300025258 Ga0209129_1000043 Ga0209129_1000043272 271
457 3300025273 Ga0209673_1004179 Ga0209673_10041794 271
458 3300025295 Ga0209564_1000014 Ga0209564_1000014379 271
459 3300025297 Ga0209758_1000307 Ga0209758_100030765 271
460 3300025297 Ga0209758_1000492 Ga0209758_100049256 271
461 3300025298 Ga0209050_1000493 Ga0209050_10004937 271
462 3300025949 Ga0207667_10278918 Ga0207667_102789182 271
463 3300026142 Ga0207698_10241410 Ga0207698_102414101 271
464 3300027876 Ga0209974_10004710 Ga0209974_100047102 271
465 3300028794 Ga0307515_10000232 Ga0307515_10000232113 271
466 3300028794 Ga0307515_10004630 Ga0307515_1000463013 271
467 3300028794 Ga0307515_10022661 Ga0307515_100226617 271
468 3300031616 Ga0307508_10001933 Ga0307508_100019333 271
469 3300031649 Ga0307514_10001048 Ga0307514_100010484 271
470 3300031730 Ga0307516_10010299 Ga0307516_100102993 271
471 3300033179 Ga0307507_10043893 Ga0307507_100438933 271
472 3300041486 Ga0451807_1833390 Ga0451807_1833390_421_1272 271
473 3300041498 Ga0451841_0922783 Ga0451841_0922783_767_1618 271
474 3300041501 Ga0451845_0532962 Ga0451845_0532962_284_1135 271
475 3300041505 Ga0451849_0172393 Ga0451849_0172393_340_1191 271
476 3300041509 Ga0451843_0229425 Ga0451843_0229425_209_1060 271
477 3300046460 Ga0495638_0099563 Ga0495638_0099563_282_1121 271
478 3300046519 Ga0495632_0050249 Ga0495632_0050249_482_1333 271
479 3300046519 Ga0495632_0118471 Ga0495632_0118471_369_1220 271
480 3300046660 Ga0495625_0014629 Ga0495625_0014629_3443_4294 271
481 3300050493 nmdc:mga0k408_138307_c1 nmdc:mga0k408_138307_c1_421_1272 271
482 3300050493 nmdc:mga0k408_31114_c1 nmdc:mga0k408_31114_c1_1596_2447 271
483 3300050493 nmdc:mga0k408_58391_c1 nmdc:mga0k408_58391_c1_560_1399 271
484 3300050496 nmdc:mga07m45_13482_c1 nmdc:mga07m45_13482_c1_2294_3133 271
485 3300050496 nmdc:mga07m45_74647_c1 nmdc:mga07m45_74647_c1_197_1048 271
486 3300053086 Ga0500578_0000006 Ga0500578_0000006_16075_16914 271
487 3300053093 Ga0500651_0037482 Ga0500651_0037482_803_1642 271
488 3300053117 Ga0500593_079552 Ga0500593_079552_483_1322 271
489 3300053129 Ga0500628_009680 Ga0500628_009680_283_1122 271
490 3300053131 Ga0500652_000642 Ga0500652_000642_6731_7570 271
491 3300053133 Ga0500655_018886 Ga0500655_018886_150_989 271
492 3300053154 Ga0500619_000201 Ga0500619_000201_3214_4089 271
493 3300053156 Ga0500622_0000221 Ga0500622_0000221_15533_16372 271
494 3300026095 Ga0207676_10328406 Ga0207676_103284062 273
495 3300001979 JGI24740J21852_10018001 JGI24740J21852_100180012 280
496 3300001989 JGI24739J22299_10023619 JGI24739J22299_100236192 280
497 3300005455 Ga0070663_100398231 Ga0070663_1003982312 280
498 3300005539 Ga0068853_100029161 Ga0068853_1000291612 280
499 3300005539 Ga0068853_100077324 Ga0068853_1000773243 280
500 3300005563 Ga0068855_100172283 Ga0068855_1001722832 280
501 3300005577 Ga0068857_100039597 Ga0068857_1000395974 280
502 3300005577 Ga0068857_100053285 Ga0068857_1000532852 280
503 3300005578 Ga0068854_100077337 Ga0068854_1000773372 280
504 3300005578 Ga0068854_100227424 Ga0068854_1002274241 280
505 3300005614 Ga0068856_100042379 Ga0068856_1000423793 280
506 3300005614 Ga0068856_100144833 Ga0068856_1001448332 280
507 3300005616 Ga0068852_100006956 Ga0068852_1000069565 280
508 3300005834 Ga0068851_10006649 Ga0068851_100066492 280
509 3300009174 Ga0105241_10088831 Ga0105241_100888314 280
510 3300009545 Ga0105237_10316434 Ga0105237_103164342 280
511 3300009551 Ga0105238_10004432 Ga0105238_100044323 280
512 3300009551 Ga0105238_10035858 Ga0105238_100358583 280
513 3300010375 Ga0105239_10069717 Ga0105239_100697173 280
514 3300010375 Ga0105239_10074831 Ga0105239_100748313 280
515 3300025321 Ga0207656_10160266 Ga0207656_101602661 280
516 3300025911 Ga0207654_10001596 Ga0207654_1000159611 280
517 3300025913 Ga0207695_10000497 Ga0207695_1000049753 280
518 3300025913 Ga0207695_10196716 Ga0207695_101967162 280
519 3300025924 Ga0207694_10003968 Ga0207694_100039682 280
520 3300025949 Ga0207667_10017824 Ga0207667_100178242 280
521 3300025949 Ga0207667_10238496 Ga0207667_102384962 280
522 3300025981 Ga0207640_10021731 Ga0207640_100217311 280
523 3300025981 Ga0207640_10045704 Ga0207640_100457044 280
524 3300026041 Ga0207639_10060313 Ga0207639_100603132 280
525 3300026067 Ga0207678_10042049 Ga0207678_100420495 280
526 3300026078 Ga0207702_10001920 Ga0207702_100019204 280
527 3300026116 Ga0207674_10003184 Ga0207674_100031844 280
528 3300026116 Ga0207674_10005049 Ga0207674_100050494 280

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02900

LigB

Catalytic LigB subunit of aromatic ring-opening dioxygenase

9

271

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pw6-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein jw3007 from escherichia coli k12 0.8746 12 267
2pw6-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein jw3007 from escherichia coli k12 0.8646 12 267
7txy-assembly2.cif.gz_E crystal structure of the 2-aminophenol 1,6-dioxygenase from the aro bacterial microcompartment of micromonospora rosaria 0.8055 11 267
8iq8-assembly1.cif.gz_D crystal structure of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (dhpao) from acinetobacter baumannii 0.7787 10 270
3vsj-assembly1.cif.gz_D crystal structure of 1,6-apd (2-animophenol-1,6-dioxygenase) complexed with intermediate products 0.7612 10 267
ID Description Score Start End Superfamily
af_I1MQB9_2_262_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9567 14 268 3.40.830.10
af_I1MQB9_2_262_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9317 14 268 3.40.830.10
af_Q54W77_1_267_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.921 10 269 3.40.830.10
af_P24197_1_271_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9081 1 267 3.40.830.10
af_Q54W77_1_267_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8943 10 269 3.40.830.10
ID Description Score Start End GO Terms
AF-A0A239I298-F1-model_v4 4,5-DOPA dioxygenase extradiol 0.9894 10 269 GO:0008198
GO:0008270
GO:0016701
GO:0051213
AF-A0A847VKX5-F1-model_v4 Dioxygenase 0.9869 65 268 GO:0008198
GO:0008270
GO:0016701
GO:0051213
AF-A0A401IHF5-F1-model_v4 Extradiol ring-cleavage dioxygenase class III enzyme subunit B domain-containing protein 0.9865 10 270 GO:0008198
GO:0008270
GO:0016701
AF-A0A1E4JJS9-F1-model_v4 Dioxygenase 0.9853 12 268 GO:0008198
GO:0008270
GO:0016701
GO:0051213
AF-A0A7X1FZ99-F1-model_v4 Dioxygenase 0.9842 13 269 GO:0008198
GO:0008270
GO:0016701
GO:0051213

Feature Viewer

pLDDT pTM Quality
91.29 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map