F459545

General Info

Members Datasets Scaffolds Average Seq Length
527 299 1054 410

Family's Representative Sequence

Representative Sequence 3300025926|Ga0207659_10126699|Ga0207659_101266991
Length 484
Sequence MRACPIPEIDWNVSARTGKTFIKRFTEERELTVILAVDLSGSGSFGSGRPPWVPSTLVTSGPTSDVSKETAGAPLVVRTVALELPAEASLLDLLPEDHPVTWLRNGDGLVGCGVAAVLRPSGPDRFAEADAWWRDVTARAIVRSDVHEPGSGLVSFGTFAFADDSVESALIVPEVILGRRGDTSWLTTVSSVGGLDQLDRRLELATTPPAPVGVTFTDGALDGQQWMAAVGEAVRRINAGDLEKVVLARDLVATAAEPIDVRWPLRRLADGYPTCWTFHVDGIFGATPELLVRRERGLVTSRVLAGTIRRTGDDARDLTLAARLARSSKDLEEHEYAVRSVAEALEPHCSSMNVPEAPFVLHLPNVMHLATDVAGVVHDAATVTSLELAAALHPSAAVGGTPTRDAIALIAELEGMDRGRYAGPVGWMDAQGDGEWGIALRSAVIDGATVRLYAGCGIVADSDPEAELAETQGKFVPVRDALST

Samples

Sample ID Description Type Environment
1 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
140 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
141 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
142 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
156 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
180 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
181 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
182 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
183 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
184 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
203 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
214 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
217 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
241 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
263 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
266 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
267 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
279 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
280 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
281 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
282 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
283 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
284 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
285 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
286 2643221561 Nocardioides sp. Root151 Isolate Unclassified
287 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
288 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
289 2643221696 Nocardioides sp. Root140 Isolate Unclassified
290 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
291 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
292 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
293 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
294 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
295 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
296 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
297 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
298 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
299 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.96
Metatranscriptomes 0.19
Isolates 2.85

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 8.16
Nodule 0
Rhizoplane 6.64
Rhizosphere 81.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207659_10126699 3300025926 Bacteria 1965
2 JGI24740J21852_10014343 3300001979 Bacteria 2926
3 JGI24739J22299_10013514 3300001989 Bacteria 2980
4 JGI24737J22298_10000883 3300001990 Bacteria 10709
5 JGI24738J21930_10007663 3300002075 Bacteria 2480
6 JGI24744J21845_10006150 3300002077 Bacteria 2490
7 Ga0070658_10093621 3300005327 Bacteria 2478
8 Ga0070683_100014369 3300005329 Bacteria 6925
9 Ga0070683_100035140 3300005329 Bacteria 4581
10 Ga0070670_100008648 3300005331 Bacteria 8691
11 Ga0068869_100152091 3300005334 Bacteria 1795
12 Ga0070680_100050778 3300005336 Bacteria 3383
13 Ga0070682_100011681 3300005337 Bacteria 5020
14 Ga0070682_100053194 3300005337 Bacteria 2537
15 Ga0068868_100017979 3300005338 Bacteria 5276
16 Ga0068868_100049680 3300005338 Bacteria 3292
17 Ga0070660_100062623 3300005339 Bacteria 2890
18 Ga0070660_100129374 3300005339 Bacteria 2019
19 Ga0070689_100075178 3300005340 Bacteria 2644
20 Ga0070691_10009498 3300005341 Bacteria 4438
21 Ga0070661_100187709 3300005344 Bacteria 1575
22 Ga0070669_100058715 3300005353 Bacteria 2823
23 Ga0070675_100088812 3300005354 Bacteria 2587
24 Ga0070675_100195878 3300005354 Bacteria 1752
25 Ga0070671_100018779 3300005355 Bacteria 5619
26 Ga0070673_100018065 3300005364 Bacteria 5031
27 Ga0070659_100078345 3300005366 Bacteria 2636
28 Ga0070667_100042907 3300005367 Bacteria 3795
29 Ga0070667_100064728 3300005367 Bacteria 3103
30 Ga0070709_10067834 3300005434 Bacteria 2292
31 Ga0070714_100122941 3300005435 Bacteria 2311
32 Ga0070713_100011013 3300005436 Bacteria 6564
33 Ga0070710_10000505 3300005437 Bacteria 18330
34 Ga0070701_10015954 3300005438 Bacteria 3481
35 Ga0070701_10019669 3300005438 Bacteria 3192
36 Ga0070711_100125867 3300005439 Bacteria 1902
37 Ga0070700_100018285 3300005441 Bacteria 4027
38 Ga0070678_100026245 3300005456 Bacteria 3935
39 Ga0070662_100051334 3300005457 Bacteria 2977
40 Ga0070662_100189495 3300005457 Bacteria 1626
41 Ga0070681_10058330 3300005458 Bacteria 3840
42 Ga0070681_10194572 3300005458 Bacteria 1947
43 Ga0070706_100001261 3300005467 Bacteria 27056
44 Ga0070698_100000408 3300005471 Bacteria 45628
45 Ga0070698_100086394 3300005471 Bacteria 3123
46 Ga0070679_100129313 3300005530 Bacteria 2507
47 Ga0070679_100174373 3300005530 Bacteria 2123
48 Ga0070684_100004776 3300005535 Bacteria 10352
49 Ga0070684_100064125 3300005535 Bacteria 3222
50 Ga0070684_100098422 3300005535 Bacteria 2609
51 Ga0070684_100264469 3300005535 Bacteria 1574
52 Ga0068853_100016715 3300005539 Bacteria 6042
53 Ga0068853_100113954 3300005539 Bacteria 2404
54 Ga0070672_100003670 3300005543 Bacteria 9972
55 Ga0070672_100055011 3300005543 Bacteria 3117
56 Ga0070696_100000187 3300005546 Bacteria 36190
57 Ga0070693_100082559 3300005547 Bacteria 1919
58 Ga0070665_100000516 3300005548 Bacteria 55112
59 Ga0070665_100128440 3300005548 Bacteria 2537
60 Ga0068855_100208450 3300005563 Bacteria 2198
61 Ga0068854_100138037 3300005578 Bacteria 1868
62 Ga0068854_100236477 3300005578 Bacteria 1453
63 Ga0068856_100029744 3300005614 Bacteria 5336
64 Ga0068856_100063781 3300005614 Bacteria 3640
65 Ga0070702_100036173 3300005615 Bacteria 2733
66 Ga0068852_100024052 3300005616 Bacteria 4916
67 Ga0068852_100066673 3300005616 Bacteria 3144
68 Ga0068852_100126853 3300005616 Bacteria 2345
69 Ga0068859_100069551 3300005617 Bacteria 3555
70 Ga0068864_100040133 3300005618 Bacteria 4004
71 Ga0068864_100088392 3300005618 Bacteria 2729
72 Ga0068866_10012229 3300005718 Bacteria 3738
73 Ga0068861_100025987 3300005719 Bacteria 4252
74 Ga0068861_100140340 3300005719 Bacteria 1971
75 Ga0068851_10036346 3300005834 Bacteria 2466
76 Ga0068870_10000498 3300005840 Bacteria 14856
77 Ga0068870_10029456 3300005840 Bacteria 2766
78 Ga0068863_100013023 3300005841 Bacteria 8019
79 Ga0068860_100000935 3300005843 Bacteria 32328
80 Ga0068860_100015625 3300005843 Bacteria 7412
81 Ga0081540_1002210 3300005983 Bacteria 16066
82 Ga0081540_1064004 3300005983 Bacteria 1737
83 Ga0070717_10020355 3300006028 Bacteria 5217
84 Ga0070717_10021159 3300006028 Bacteria 5124
85 Ga0070717_10022511 3300006028 Bacteria 4981
86 Ga0075365_10001291 3300006038 Bacteria 11158
87 Ga0075365_10063284 3300006038 Bacteria 2476
88 Ga0075368_10005875 3300006042 Bacteria 4249
89 Ga0075368_10012620 3300006042 Bacteria 3093
90 Ga0075368_10034343 3300006042 Bacteria 1976
91 Ga0075363_100006847 3300006048 Bacteria 5209
92 Ga0075363_100098702 3300006048 Bacteria 1614
93 Ga0075364_10006892 3300006051 Bacteria 6708
94 Ga0075364_10012496 3300006051 Bacteria 5196
95 Ga0075364_10027427 3300006051 Bacteria 3638
96 Ga0075364_10069706 3300006051 Bacteria 2314
97 Ga0075364_10142430 3300006051 Bacteria 1613
98 Ga0075432_10003084 3300006058 Bacteria 5620
99 Ga0070712_100098020 3300006175 Bacteria 2162
100 Ga0075362_10025470 3300006177 Bacteria 2519
101 Ga0075367_10019671 3300006178 Bacteria 3748
102 Ga0075367_10062861 3300006178 Bacteria 2218
103 Ga0075367_10084204 3300006178 Bacteria 1928
104 Ga0075367_10107430 3300006178 Bacteria 1710
105 Ga0075370_10001186 3300006353 Bacteria 10976
106 Ga0075370_10073099 3300006353 Bacteria 1963
107 Ga0068871_100113365 3300006358 Bacteria 2283
108 Ga0075428_100389096 3300006844 Bacteria 1495
109 Ga0075431_100059950 3300006847 Bacteria 3927
110 Ga0075431_100132207 3300006847 Bacteria 2574
111 Ga0075433_10248168 3300006852 Bacteria 1579
112 Ga0075434_100052464 3300006871 Bacteria 4052
113 Ga0068865_100023489 3300006881 Bacteria 4037
114 Ga0075436_100002394 3300006914 Bacteria 12926
115 Ga0097620_100069547 3300006931 Bacteria 3555
116 Ga0075435_100001452 3300007076 Bacteria 15217
117 Ga0111539_10013377 3300009094 Bacteria 10257
118 Ga0105245_10001045 3300009098 Bacteria 25060
119 Ga0105245_10048078 3300009098 Bacteria 3816
120 Ga0105245_10128987 3300009098 Bacteria 2370
121 Ga0105245_10139885 3300009098 Bacteria 2279
122 Ga0105247_10077447 3300009101 Bacteria 2090
123 Ga0105247_10108827 3300009101 Bacteria 1781
124 Ga0114129_10005133 3300009147 Bacteria 18430
125 Ga0114129_10064363 3300009147 Bacteria 5117
126 Ga0105243_10023409 3300009148 Bacteria 4703
127 Ga0105243_10065522 3300009148 Bacteria 2918
128 Ga0105243_10083065 3300009148 Bacteria 2620
129 Ga0105241_10033003 3300009174 Bacteria 3884
130 Ga0105242_10210940 3300009176 Bacteria 1731
131 Ga0105248_10011321 3300009177 Bacteria 9832
132 Ga0105248_10034299 3300009177 Bacteria 5673
133 Ga0105248_10314517 3300009177 Bacteria 1764
134 Ga0105239_10001253 3300010375 Bacteria 34499
135 Ga0105239_10195661 3300010375 Bacteria 2264
136 Ga0105246_10002828 3300011119 Bacteria 10519
137 Ga0105246_10035193 3300011119 Bacteria 3345
138 Ga0105246_10060042 3300011119 Bacteria 2641
139 Ga0157371_10206858 3300013102 Bacteria 1408
140 Ga0157370_10057427 3300013104 Bacteria 3700
141 Ga0157369_10045086 3300013105 Bacteria 4797
142 Ga0157374_10051523 3300013296 Bacteria 3831
143 Ga0163162_10029675 3300013306 Bacteria 5414
144 Ga0157372_10085297 3300013307 Bacteria 3581
145 Ga0157375_10013311 3300013308 Bacteria 7317
146 Ga0157375_10027407 3300013308 Bacteria 5325
147 Ga0157375_10067602 3300013308 Bacteria 3571
148 Ga0157375_10143980 3300013308 Bacteria 2513
149 Ga0157375_10191074 3300013308 Bacteria 2202
150 Ga0163163_10037132 3300014325 Bacteria 4738
151 Ga0157380_10006556 3300014326 Bacteria 8211
152 Ga0157377_10062626 3300014745 Bacteria 2128
153 Ga0157379_10081465 3300014968 Bacteria 2899
154 Ga0157376_10206080 3300014969 Bacteria 1812
155 Ga0163161_10038762 3300017792 Bacteria 3419
156 Ga0163161_10065327 3300017792 Bacteria 2655
157 Ga0206353_10753967 3300020082 Bacteria 3993
158 Ga0213875_10001577 3300021388 Bacteria 14567
159 Ga0207656_10009921 3300025321 Bacteria 3547
160 Ga0207688_10001785 3300025901 Bacteria 11428
161 Ga0207688_10004278 3300025901 Bacteria 7784
162 Ga0207688_10080902 3300025901 Bacteria 1855
163 Ga0207647_10003470 3300025904 Bacteria 11824
164 Ga0207647_10028804 3300025904 Bacteria 3603
165 Ga0207647_10044909 3300025904 Bacteria 2759
166 Ga0207699_10117629 3300025906 Bacteria 1714
167 Ga0207645_10012919 3300025907 Bacteria 5651
168 Ga0207643_10001291 3300025908 Bacteria 14603
169 Ga0207643_10006874 3300025908 Bacteria 6106
170 Ga0207643_10014438 3300025908 Bacteria 4290
171 Ga0207684_10016281 3300025910 Bacteria 6384
172 Ga0207707_10250039 3300025912 Bacteria 1540
173 Ga0207662_10027752 3300025918 Bacteria 3269
174 Ga0207657_10022169 3300025919 Bacteria 5957
175 Ga0207657_10036870 3300025919 Bacteria 4374
176 Ga0207657_10124261 3300025919 Bacteria 2120
177 Ga0207652_10008433 3300025921 Bacteria 8294
178 Ga0207652_10049969 3300025921 Bacteria 3582
179 Ga0207652_10052211 3300025921 Bacteria 3507
180 Ga0207652_10144418 3300025921 Bacteria 2129
181 Ga0207652_10237238 3300025921 Bacteria 1644
182 Ga0207694_10040494 3300025924 Bacteria 3587
183 Ga0207687_10004073 3300025927 Bacteria 9797
184 Ga0207687_10145519 3300025927 Bacteria 1803
185 Ga0207664_10003864 3300025929 Bacteria 10068
186 Ga0207644_10043180 3300025931 Bacteria 3198
187 Ga0207706_10199947 3300025933 Bacteria 1753
188 Ga0207709_10036673 3300025935 Bacteria 2907
189 Ga0207669_10108246 3300025937 Bacteria 1856
190 Ga0207691_10000365 3300025940 Bacteria 45542
191 Ga0207691_10077153 3300025940 Bacteria 3002
192 Ga0207691_10165817 3300025940 Bacteria 1936
193 Ga0207689_10005718 3300025942 Bacteria 11053
194 Ga0207661_10000322 3300025944 Bacteria 30526
195 Ga0207661_10058082 3300025944 Bacteria 3113
196 Ga0207661_10082289 3300025944 Bacteria 2661
197 Ga0207661_10116984 3300025944 Bacteria 2264
198 Ga0207679_10008244 3300025945 Bacteria 6635
199 Ga0207658_10067846 3300025986 Bacteria 2689
200 Ga0207658_10199049 3300025986 Bacteria 1671
201 Ga0207703_10040698 3300026035 Bacteria 3720
202 Ga0207639_10047826 3300026041 Bacteria 3235
203 Ga0207639_10166003 3300026041 Bacteria 1865
204 Ga0207678_10000416 3300026067 Bacteria 38515
205 Ga0207708_10000208 3300026075 Bacteria 46487
206 Ga0207708_10013574 3300026075 Bacteria 6090
207 Ga0207708_10053697 3300026075 Bacteria 3071
208 Ga0207708_10117429 3300026075 Bacteria 2070
209 Ga0207702_10004296 3300026078 Bacteria 12706
210 Ga0207702_10128491 3300026078 Bacteria 2278
211 Ga0207641_10012736 3300026088 Bacteria 6895
212 Ga0207648_10055126 3300026089 Bacteria 3471
213 Ga0207676_10001620 3300026095 Bacteria 16590
214 Ga0207676_10054944 3300026095 Bacteria 3123
215 Ga0207674_10012444 3300026116 Bacteria 9508
216 Ga0207674_10139371 3300026116 Bacteria 2386
217 Ga0207675_100010541 3300026118 Bacteria 8659
218 Ga0207675_100036539 3300026118 Bacteria 4582
219 Ga0207675_100260127 3300026118 Bacteria 1682
220 Ga0207683_10002172 3300026121 Bacteria 17224
221 Ga0207683_10058565 3300026121 Bacteria 3383
222 Ga0207698_10014796 3300026142 Bacteria 5200
223 Ga0207698_10021543 3300026142 Bacteria 4461
224 Ga0207698_10048793 3300026142 Bacteria 3217
225 Ga0209813_10001675 3300027866 Bacteria 4989
226 Ga0209813_10008505 3300027866 Bacteria 2596
227 Ga0268266_10000509 3300028379 Bacteria 54900
228 Ga0268266_10063913 3300028379 Bacteria 3178
229 Ga0268264_10000374 3300028381 Bacteria 65781
230 Ga0268264_10019656 3300028381 Bacteria 5518
231 Ga0268264_10168624 3300028381 Bacteria 1978
232 Ga0307511_10000590 3300030521 Bacteria 38846
233 Ga0316177_1137362 3300030731 Bacteria 1463
234 Ga0316176_1211199 3300030732 Bacteria 1876
235 Ga0314311_1246063 3300030733 Bacteria 2057
236 Ga0307408_100071989 3300031548 Bacteria 2558
237 Ga0316576_10004023 3300031727 Bacteria 8750
238 Ga0316576_10011817 3300031727 Bacteria 5741
239 Ga0307413_10029598 3300031824 Bacteria 3066
240 Ga0307413_10036457 3300031824 Bacteria 2831
241 Ga0307410_10016443 3300031852 Bacteria 4413
242 Ga0307410_10017503 3300031852 Bacteria 4306
243 Ga0307406_10055646 3300031901 Bacteria 2530
244 Ga0307407_10014503 3300031903 Bacteria 3862
245 Ga0307407_10026504 3300031903 Bacteria 3071
246 Ga0307412_10039779 3300031911 Bacteria 3039
247 Ga0307412_10130128 3300031911 Bacteria 1827
248 Ga0307409_100004301 3300031995 Bacteria 7968
249 Ga0307409_100041608 3300031995 Bacteria 3433
250 Ga0307409_100089528 3300031995 Bacteria 2516
251 Ga0307409_100139228 3300031995 Bacteria 2088
252 Ga0307409_100169559 3300031995 Bacteria 1920
253 Ga0307409_100291451 3300031995 Bacteria 1514
254 Ga0307416_100029013 3300032002 Bacteria 4126
255 Ga0307416_100135865 3300032002 Bacteria 2224
256 Ga0307416_100202444 3300032002 Bacteria 1885
257 Ga0307414_10029640 3300032004 Bacteria 3564
258 Ga0307414_10051038 3300032004 Bacteria 2869
259 Ga0307411_10001892 3300032005 Bacteria 8924
260 Ga0307411_10063295 3300032005 Bacteria 2471
261 Ga0307411_10167552 3300032005 Bacteria 1653
262 Ga0307415_100000246 3300032126 Bacteria 23474
263 Ga0307415_100054745 3300032126 Bacteria 2725
264 Ga0307415_100115291 3300032126 Bacteria 2002
265 Ga0307415_100122492 3300032126 Bacteria 1953
266 Ga0373934_0003349 3300035086 Bacteria 5870
267 Ga0373944_0003752 3300035089 Bacteria 3927
268 Ga0373923_0004308 3300035111 Bacteria 4710
269 Ga0373936_0026411 3300035113 Bacteria 2273
270 Ga0373953_0000559 3300035117 Bacteria 10324
271 Ga0373953_0018303 3300035117 Bacteria 2590
272 Ga0373953_0050752 3300035117 Bacteria 1676
273 Ga0373956_0000259 3300035119 Bacteria 21148
274 Ga0373957_0004792 3300035120 Bacteria 4144
275 Ga0373943_0044732 3300035170 Bacteria 2155
276 Ga0373946_0058375 3300035171 Bacteria 1634
277 Ga0373955_0000042 3300035172 Bacteria 50503
278 Ga0316574_0003441 3300035398 Bacteria 8157
279 Ga0316574_0094083 3300035398 Bacteria 1914
280 Ga0373924_0002625 3300035410 Bacteria 6065
281 Ga0373924_0008331 3300035410 Bacteria 3763
282 Ga0373931_0070600 3300035691 Bacteria 1906
283 Ga0373935_0092157 3300035692 Bacteria 1985
284 Ga0373933_0000024 3300035724 Bacteria 93753
285 Ga0373933_0002131 3300035724 Bacteria 11374
286 Ga0373937_0000029 3300036401 Bacteria 123547
287 Ga0373937_0016258 3300036401 Bacteria 6603
288 Ga0373937_0018412 3300036401 Bacteria 6237
289 Ga0316584_0030443 3300036712 Bacteria 3987
290 Ga0373925_0046247 3300037068 Bacteria 3236
291 Ga0395900_0003901 3300037418 Bacteria 15934
292 Ga0395900_0025721 3300037418 Bacteria 6026
293 Ga0395900_0038298 3300037418 Bacteria 4942
294 Ga0395900_0048454 3300037418 Bacteria 4377
295 Ga0395898_0048906 3300037466 Bacteria 4145
296 Ga0395898_0114063 3300037466 Bacteria 2590
297 Ga0395905_0334654 3300037471 Bacteria 1405
298 Ga0436364_0512751 3300037853 Bacteria 53348
299 Ga0395901_0032608 3300038443 Bacteria 5373
300 Ga0395901_0061850 3300038443 Bacteria 3896
301 Ga0395901_0125625 3300038443 Bacteria 2696
302 Ga0436365_1259398 3300039437 Bacteria 7823
303 Ga0451833_0309082 3300041491 Bacteria 3515
304 Ga0451837_1325092 3300041494 Bacteria 4353
305 Ga0451839_0248974 3300041496 Bacteria 4840
306 Ga0439448_0008448 3300042005 Bacteria 3017
307 Ga0439449_0038536 3300042007 Bacteria 1777
308 Ga0439446_0025261 3300042156 Bacteria 1698
309 Ga0466965_0004742 3300044683 Bacteria 6059
310 Ga0466965_0005892 3300044683 Bacteria 5535
311 Ga0466965_0012182 3300044683 Bacteria 4041
312 Ga0466966_0002361 3300044684 Bacteria 12330
313 Ga0466966_0002490 3300044684 Bacteria 12063
314 Ga0466966_0153128 3300044684 Bacteria 1405
315 Ga0466961_0005360 3300044693 Bacteria 8070
316 Ga0466961_0009837 3300044693 Bacteria 6089
317 Ga0466961_0016615 3300044693 Bacteria 4733
318 Ga0466961_0038957 3300044693 Bacteria 3048
319 Ga0466961_0117107 3300044693 Bacteria 1674
320 Ga0466963_0001501 3300044694 Bacteria 12624
321 Ga0466963_0017547 3300044694 Bacteria 4463
322 Ga0466964_0105313 3300044706 Bacteria 1250
323 Ga0466971_0037363 3300044719 Bacteria 2176
324 Ga0466970_0043074 3300044765 Bacteria 2401
325 Ga0466970_0050959 3300044765 Bacteria 2209
326 Ga0466957_0005140 3300044842 Bacteria 7314
327 Ga0466957_0039715 3300044842 Bacteria 2840
328 Ga0466960_0001139 3300044901 Bacteria 9536
329 Ga0466960_0002593 3300044901 Bacteria 6798
330 Ga0466959_0068399 3300045049 Bacteria 2573
331 Ga0466959_0075826 3300045049 Bacteria 2429
332 Ga0466958_0105068 3300045836 Bacteria 1759
333 Ga0466967_0004458 3300045976 Bacteria 9448
334 Ga0466967_0010889 3300045976 Bacteria 6851
335 Ga0466967_0028090 3300045976 Bacteria 4692
336 Ga0466967_0061984 3300045976 Bacteria 3319
337 Ga0466967_0109278 3300045976 Bacteria 2539
338 Ga0466967_0261850 3300045976 Bacteria 1655
339 Ga0466967_0311032 3300045976 Bacteria 1517
340 Ga0466967_0371607 3300045976 Bacteria 1387
341 Ga0495592_0000040 3300046454 Bacteria 123599
342 Ga0495592_0033946 3300046454 Bacteria 3847
343 Ga0495603_0062306 3300046455 Bacteria 2202
344 Ga0495629_0034825 3300046459 Bacteria 3559
345 Ga0495629_0084039 3300046459 Bacteria 2221
346 Ga0495641_0007867 3300046461 Bacteria 6589
347 Ga0495651_0000017 3300046462 Bacteria 124010
348 Ga0495651_0003331 3300046462 Bacteria 12340
349 Ga0495653_0023228 3300046463 Bacteria 5014
350 Ga0495653_0102539 3300046463 Bacteria 2070
351 Ga0495650_0012030 3300046471 Bacteria 4683
352 Ga0495662_0039873 3300046476 Bacteria 2268
353 Ga0495608_0000053 3300046511 Bacteria 93787
354 Ga0495608_0001385 3300046511 Bacteria 17232
355 Ga0495628_0003346 3300046516 Bacteria 14336
356 Ga0495652_0004370 3300046529 Bacteria 13521
357 Ga0495652_0071474 3300046529 Bacteria 2896
358 Ga0495665_0011540 3300046531 Bacteria 4783
359 Ga0495640_0065345 3300046533 Bacteria 2456
360 Ga0495587_0000079 3300046536 Bacteria 76330
361 Ga0495587_0051987 3300046536 Bacteria 2419
362 Ga0495587_0136602 3300046536 Bacteria 1400
363 Ga0495645_0060085 3300046543 Bacteria 2755
364 Ga0495667_0000063 3300046559 Bacteria 93832
365 Ga0495667_0011569 3300046559 Bacteria 5974
366 Ga0495667_0038552 3300046559 Bacteria 3181
367 Ga0495657_0000032 3300046675 Bacteria 123599
368 Ga0495657_0012453 3300046675 Bacteria 6321
369 Ga0495657_0027196 3300046675 Bacteria 4040
370 Ga0495599_0000047 3300046678 Bacteria 85391
371 Ga0495599_0007807 3300046678 Bacteria 6495
372 Ga0495599_0021137 3300046678 Bacteria 4058
373 Ga0495623_0006030 3300046679 Bacteria 7883
374 Ga0495623_0028564 3300046679 Bacteria 3588
375 Ga0495646_0026817 3300046680 Bacteria 3616
376 Ga0495669_0024146 3300046684 Bacteria 2649
377 Ga0495600_0134467 3300046809 Bacteria 1606
378 Ga0495581_0050360 3300047315 Bacteria 2405
379 Ga0495604_0000688 3300047317 Bacteria 28660
380 Ga0495604_0015385 3300047317 Bacteria 6105
381 Ga0495604_0079347 3300047317 Bacteria 2461
382 Ga0495674_0239552 3300047319 Bacteria 1495
383 Ga0495680_0000085 3300047322 Bacteria 83333
384 Ga0495680_0006211 3300047322 Bacteria 11134
385 Ga0495680_0056399 3300047322 Bacteria 3041
386 Ga0495675_0000946 3300047444 Bacteria 17615
387 Ga0495675_0061195 3300047444 Bacteria 2385
388 Ga0495684_0015842 3300047471 Bacteria 5803
389 Ga0495593_0038705 3300047673 Bacteria 2574
390 Ga0495602_0001525 3300048088 Bacteria 23037
391 Ga0496101_0004132 3300048904 Bacteria 9088
392 Ga0496101_0019589 3300048904 Bacteria 4622
393 Ga0496101_0094372 3300048904 Bacteria 2230
394 Ga0496101_0108538 3300048904 Bacteria 2087
395 Ga0496101_0266433 3300048904 Bacteria 1337
396 Ga0496102_0007714 3300048905 Bacteria 9194
397 Ga0496102_0060970 3300048905 Bacteria 3451
398 Ga0496103_0023740 3300048906 Bacteria 3698
399 Ga0496103_0097373 3300048906 Bacteria 1860
400 Ga0496105_0081900 3300048908 Bacteria 2666
401 Ga0496105_0139123 3300048908 Bacteria 1999
402 Ga0496106_0025755 3300048909 Bacteria 4377
403 Ga0496106_0078145 3300048909 Bacteria 2539
404 Ga0496107_0033516 3300048910 Bacteria 3675
405 Ga0496107_0194044 3300048910 Bacteria 1509
406 Ga0496108_0002092 3300048911 Bacteria 15967
407 Ga0496108_0113151 3300048911 Bacteria 2323
408 Ga0496108_0114965 3300048911 Bacteria 2304
409 Ga0496108_0203550 3300048911 Bacteria 1718
410 Ga0496109_0012848 3300048912 Bacteria 7238
411 Ga0496109_0067301 3300048912 Bacteria 3281
412 Ga0496109_0316269 3300048912 Bacteria 1473
413 Ga0496110_0001710 3300048913 Bacteria 16153
414 Ga0496110_0050461 3300048913 Bacteria 3653
415 Ga0496110_0134840 3300048913 Bacteria 2231
416 Ga0496111_0021572 3300048914 Bacteria 4500
417 Ga0496111_0026115 3300048914 Bacteria 4123
418 Ga0496111_0027854 3300048914 Bacteria 4001
419 Ga0496113_0074448 3300048916 Bacteria 2589
420 Ga0496114_0035008 3300048917 Bacteria 4146
421 Ga0496114_0045839 3300048917 Bacteria 3633
422 Ga0496114_0093559 3300048917 Bacteria 2556
423 Ga0496114_0094920 3300048917 Bacteria 2537
424 Ga0496115_0003477 3300048918 Bacteria 11329
425 Ga0496115_0024439 3300048918 Bacteria 4697
426 Ga0496124_0021648 3300048927 Bacteria 5922
427 Ga0496124_0035554 3300048927 Bacteria 4357
428 Ga0501031_0022032 3300049568 Bacteria 4152
429 Ga0501031_0045439 3300049568 Bacteria 2865
430 Ga0501031_0149218 3300049568 Bacteria 1527
431 Ga0501034_0087886 3300049571 Bacteria 3107
432 Ga0501036_0027020 3300049572 Bacteria 4850
433 Ga0501037_0136603 3300049573 Bacteria 1756
434 Ga0501038_0024352 3300049574 Bacteria 5402
435 Ga0501039_0007274 3300049575 Bacteria 8432
436 Ga0501039_0045507 3300049575 Bacteria 3391
437 Ga0501041_0004277 3300049577 Bacteria 8264
438 Ga0501042_0013394 3300049578 Bacteria 5579
439 Ga0501047_0000112 3300049581 Bacteria 98939
440 Ga0501067_0006602 3300049583 Bacteria 6433
441 Ga0501067_0009826 3300049583 Bacteria 5297
442 Ga0501067_0043572 3300049583 Bacteria 2492
443 Ga0501067_0051515 3300049583 Bacteria 2282
444 Ga0501068_0002525 3300049584 Bacteria 9709
445 Ga0501068_0039698 3300049584 Bacteria 2823
446 Ga0501069_0042190 3300049585 Bacteria 2523
447 Ga0501069_0044902 3300049585 Bacteria 2447
448 Ga0501069_0059762 3300049585 Bacteria 2127
449 Ga0501070_0001860 3300049586 Bacteria 18632
450 Ga0501070_0009674 3300049586 Bacteria 8151
451 Ga0501070_0016837 3300049586 Bacteria 6136
452 Ga0501070_0051248 3300049586 Bacteria 3426
453 Ga0501070_0062211 3300049586 Bacteria 3092
454 Ga0501070_0283948 3300049586 Bacteria 1350
455 Ga0501071_0006405 3300049587 Bacteria 7641
456 Ga0501071_0044699 3300049587 Bacteria 3177
457 Ga0501071_0257470 3300049587 Bacteria 1318
458 Ga0501072_0031001 3300049588 Bacteria 4183
459 Ga0501072_0152020 3300049588 Bacteria 1845
460 Ga0501073_0003012 3300049589 Bacteria 12622
461 Ga0501073_0042469 3300049589 Bacteria 3209
462 Ga0501073_0095558 3300049589 Bacteria 2064
463 Ga0501074_0038928 3300049590 Bacteria 3444
464 Ga0501074_0039683 3300049590 Bacteria 3409
465 Ga0501079_0059168 3300049741 Bacteria 2956
466 Ga0501079_0086073 3300049741 Bacteria 2433
467 Ga0501079_0147505 3300049741 Bacteria 1834
468 Ga0501080_0007094 3300049742 Bacteria 10117
469 Ga0501080_0041321 3300049742 Bacteria 4298
470 Ga0501083_0008007 3300049744 Bacteria 7485
471 Ga0501083_0030364 3300049744 Bacteria 3714
472 Ga0501083_0050420 3300049744 Bacteria 2801
473 Ga0501045_0142621 3300049824 Bacteria 1782
474 Ga0501045_0208047 3300049824 Bacteria 1457
475 nmdc:mga03683_1096_c1 3300050489 Bacteria 7916
476 nmdc:mga03n38_3361_c1 3300050490 Bacteria 5125
477 nmdc:mga03n38_54106_c1 3300050490 Bacteria 1803
478 nmdc:mga03n38_60099_c1 3300050490 Bacteria 1727
479 nmdc:mga00v17_112387_c1 3300050491 Bacteria 1729
480 nmdc:mga00v17_15668_c1 3300050491 Bacteria 4258
481 nmdc:mga0yw44_21088_c1 3300050492 Bacteria 3629
482 nmdc:mga0yw44_38494_c1 3300050492 Bacteria 2830
483 nmdc:mga0yw44_4285_c1 3300050492 Bacteria 6509
484 nmdc:mga0yw44_84788_c1 3300050492 Bacteria 1992
485 nmdc:mga06z11_147909_c1 3300050494 Bacteria 1333
486 nmdc:mga06z11_20507_c1 3300050494 Bacteria 3056
487 nmdc:mga06z11_28307_c1 3300050494 Bacteria 2688
488 nmdc:mga06z11_49126_c1 3300050494 Bacteria 2150
489 nmdc:mga04h51_3704_c1 3300050495 Bacteria 3739
490 nmdc:mga07m45_102913_c1 3300050496 Bacteria 1641
491 nmdc:mga07m45_6243_c1 3300050496 Bacteria 6018
492 nmdc:mga05p37_28018_c1 3300050507 Bacteria 6864
493 nmdc:mga06r32_692_c3 3300050510 Bacteria 10179
494 nmdc:mga0n895_1510_c1 3300050512 Bacteria 17461
495 nmdc:mga0n895_28306_c1 3300050512 Bacteria 5330
496 nmdc:mga0n895_463001_c1 3300050512 Bacteria 1280
497 nmdc:mga0rr50_8140_c1 3300050513 Bacteria 6507
498 nmdc:mga08x19_1123_c1 3300050514 Bacteria 16676
499 nmdc:mga0a205_139077_c1 3300050515 Bacteria 2329
500 nmdc:mga0a205_143076_c1 3300050515 Bacteria 2292
501 Ga0495601_0046823 3300053077 Bacteria 2722
502 Ga0495595_0001409 3300053084 Bacteria 9342
503 Ga0495619_0085234 3300053085 Bacteria 2133
504 Ga0495619_0086939 3300053085 Bacteria 2114
505 Ga0500644_0000148 3300053088 Bacteria 43939
506 Ga0500593_000774 3300053117 Bacteria 11961
507 Ga0500559_0007294 3300053136 Bacteria 4909
508 Ga0500568_0000706 3300053139 Bacteria 23977
509 Ga0500573_0055242 3300053140 Bacteria 2278
510 Ga0501084_0005525 3300054114 Bacteria 10378
511 Ga0501082_0008583 3300060353 Bacteria 8814
512 Ga0501082_0015723 3300060353 Bacteria 6510
513 2623497721 2622736605 Bacteria 4992138
514 2643827303 2643221561 Bacteria 4984412
515 2644322716 2643221657 Bacteria 5490246
516 2644455806 2643221681 Bacteria 3707866
517 2644533870 2643221696 Bacteria 5431823
518 2753069826 2751185734 Bacteria 8863695
519 2816505706 2816332139 Bacteria 9138787
520 2839989613 2839986021 Bacteria 3685650
521 2855388115 2855386786 Bacteria 4752232
522 2857485688 2857481737 Bacteria 4761446
523 2870727663 2870721527 Bacteria 9689237
524 2932432107 2932431166 Bacteria 4215299
525 2984577694 2984576629 Bacteria 4248407
526 2990260607 2990256926 Bacteria 4252839
527 8047719869 8047710418 Bacteria 11023148
528 Ga0207659_10126699
529 JGI24740J21852_10014343
530 JGI24739J22299_10013514
531 JGI24737J22298_10000883
532 JGI24738J21930_10007663
533 JGI24744J21845_10006150
534 Ga0070658_10093621
535 Ga0070683_100014369
536 Ga0070683_100035140
537 Ga0070670_100008648
538 Ga0068869_100152091
539 Ga0070680_100050778
540 Ga0070682_100011681
541 Ga0070682_100053194
542 Ga0068868_100017979
543 Ga0068868_100049680
544 Ga0070660_100062623
545 Ga0070660_100129374
546 Ga0070689_100075178
547 Ga0070691_10009498
548 Ga0070661_100187709
549 Ga0070669_100058715
550 Ga0070675_100088812
551 Ga0070675_100195878
552 Ga0070671_100018779
553 Ga0070673_100018065
554 Ga0070659_100078345
555 Ga0070667_100042907
556 Ga0070667_100064728
557 Ga0070709_10067834
558 Ga0070714_100122941
559 Ga0070713_100011013
560 Ga0070710_10000505
561 Ga0070701_10015954
562 Ga0070701_10019669
563 Ga0070711_100125867
564 Ga0070700_100018285
565 Ga0070678_100026245
566 Ga0070662_100051334
567 Ga0070662_100189495
568 Ga0070681_10058330
569 Ga0070681_10194572
570 Ga0070706_100001261
571 Ga0070698_100000408
572 Ga0070698_100086394
573 Ga0070679_100129313
574 Ga0070679_100174373
575 Ga0070684_100004776
576 Ga0070684_100064125
577 Ga0070684_100098422
578 Ga0070684_100264469
579 Ga0068853_100016715
580 Ga0068853_100113954
581 Ga0070672_100003670
582 Ga0070672_100055011
583 Ga0070696_100000187
584 Ga0070693_100082559
585 Ga0070665_100000516
586 Ga0070665_100128440
587 Ga0068855_100208450
588 Ga0068854_100138037
589 Ga0068854_100236477
590 Ga0068856_100029744
591 Ga0068856_100063781
592 Ga0070702_100036173
593 Ga0068852_100024052
594 Ga0068852_100066673
595 Ga0068852_100126853
596 Ga0068859_100069551
597 Ga0068864_100040133
598 Ga0068864_100088392
599 Ga0068866_10012229
600 Ga0068861_100025987
601 Ga0068861_100140340
602 Ga0068851_10036346
603 Ga0068870_10000498
604 Ga0068870_10029456
605 Ga0068863_100013023
606 Ga0068860_100000935
607 Ga0068860_100015625
608 Ga0081540_1002210
609 Ga0081540_1064004
610 Ga0070717_10020355
611 Ga0070717_10021159
612 Ga0070717_10022511
613 Ga0075365_10001291
614 Ga0075365_10063284
615 Ga0075368_10005875
616 Ga0075368_10012620
617 Ga0075368_10034343
618 Ga0075363_100006847
619 Ga0075363_100098702
620 Ga0075364_10006892
621 Ga0075364_10012496
622 Ga0075364_10027427
623 Ga0075364_10069706
624 Ga0075364_10142430
625 Ga0075432_10003084
626 Ga0070712_100098020
627 Ga0075362_10025470
628 Ga0075367_10019671
629 Ga0075367_10062861
630 Ga0075367_10084204
631 Ga0075367_10107430
632 Ga0075370_10001186
633 Ga0075370_10073099
634 Ga0068871_100113365
635 Ga0075428_100389096
636 Ga0075431_100059950
637 Ga0075431_100132207
638 Ga0075433_10248168
639 Ga0075434_100052464
640 Ga0068865_100023489
641 Ga0075436_100002394
642 Ga0097620_100069547
643 Ga0075435_100001452
644 Ga0111539_10013377
645 Ga0105245_10001045
646 Ga0105245_10048078
647 Ga0105245_10128987
648 Ga0105245_10139885
649 Ga0105247_10077447
650 Ga0105247_10108827
651 Ga0114129_10005133
652 Ga0114129_10064363
653 Ga0105243_10023409
654 Ga0105243_10065522
655 Ga0105243_10083065
656 Ga0105241_10033003
657 Ga0105242_10210940
658 Ga0105248_10011321
659 Ga0105248_10034299
660 Ga0105248_10314517
661 Ga0105239_10001253
662 Ga0105239_10195661
663 Ga0105246_10002828
664 Ga0105246_10035193
665 Ga0105246_10060042
666 Ga0157371_10206858
667 Ga0157370_10057427
668 Ga0157369_10045086
669 Ga0157374_10051523
670 Ga0163162_10029675
671 Ga0157372_10085297
672 Ga0157375_10013311
673 Ga0157375_10027407
674 Ga0157375_10067602
675 Ga0157375_10143980
676 Ga0157375_10191074
677 Ga0163163_10037132
678 Ga0157380_10006556
679 Ga0157377_10062626
680 Ga0157379_10081465
681 Ga0157376_10206080
682 Ga0163161_10038762
683 Ga0163161_10065327
684 Ga0206353_10753967
685 Ga0213875_10001577
686 Ga0207656_10009921
687 Ga0207688_10001785
688 Ga0207688_10004278
689 Ga0207688_10080902
690 Ga0207647_10003470
691 Ga0207647_10028804
692 Ga0207647_10044909
693 Ga0207699_10117629
694 Ga0207645_10012919
695 Ga0207643_10001291
696 Ga0207643_10006874
697 Ga0207643_10014438
698 Ga0207684_10016281
699 Ga0207707_10250039
700 Ga0207662_10027752
701 Ga0207657_10022169
702 Ga0207657_10036870
703 Ga0207657_10124261
704 Ga0207652_10008433
705 Ga0207652_10049969
706 Ga0207652_10052211
707 Ga0207652_10144418
708 Ga0207652_10237238
709 Ga0207694_10040494
710 Ga0207687_10004073
711 Ga0207687_10145519
712 Ga0207664_10003864
713 Ga0207644_10043180
714 Ga0207706_10199947
715 Ga0207709_10036673
716 Ga0207669_10108246
717 Ga0207691_10000365
718 Ga0207691_10077153
719 Ga0207691_10165817
720 Ga0207689_10005718
721 Ga0207661_10000322
722 Ga0207661_10058082
723 Ga0207661_10082289
724 Ga0207661_10116984
725 Ga0207679_10008244
726 Ga0207658_10067846
727 Ga0207658_10199049
728 Ga0207703_10040698
729 Ga0207639_10047826
730 Ga0207639_10166003
731 Ga0207678_10000416
732 Ga0207708_10000208
733 Ga0207708_10013574
734 Ga0207708_10053697
735 Ga0207708_10117429
736 Ga0207702_10004296
737 Ga0207702_10128491
738 Ga0207641_10012736
739 Ga0207648_10055126
740 Ga0207676_10001620
741 Ga0207676_10054944
742 Ga0207674_10012444
743 Ga0207674_10139371
744 Ga0207675_100010541
745 Ga0207675_100036539
746 Ga0207675_100260127
747 Ga0207683_10002172
748 Ga0207683_10058565
749 Ga0207698_10014796
750 Ga0207698_10021543
751 Ga0207698_10048793
752 Ga0209813_10001675
753 Ga0209813_10008505
754 Ga0268266_10000509
755 Ga0268266_10063913
756 Ga0268264_10000374
757 Ga0268264_10019656
758 Ga0268264_10168624
759 Ga0307511_10000590
760 Ga0316177_1137362
761 Ga0316176_1211199
762 Ga0314311_1246063
763 Ga0307408_100071989
764 Ga0316576_10004023
765 Ga0316576_10011817
766 Ga0307413_10029598
767 Ga0307413_10036457
768 Ga0307410_10016443
769 Ga0307410_10017503
770 Ga0307406_10055646
771 Ga0307407_10014503
772 Ga0307407_10026504
773 Ga0307412_10039779
774 Ga0307412_10130128
775 Ga0307409_100004301
776 Ga0307409_100041608
777 Ga0307409_100089528
778 Ga0307409_100139228
779 Ga0307409_100169559
780 Ga0307409_100291451
781 Ga0307416_100029013
782 Ga0307416_100135865
783 Ga0307416_100202444
784 Ga0307414_10029640
785 Ga0307414_10051038
786 Ga0307411_10001892
787 Ga0307411_10063295
788 Ga0307411_10167552
789 Ga0307415_100000246
790 Ga0307415_100054745
791 Ga0307415_100115291
792 Ga0307415_100122492
793 Ga0373934_0003349
794 Ga0373944_0003752
795 Ga0373923_0004308
796 Ga0373936_0026411
797 Ga0373953_0000559
798 Ga0373953_0018303
799 Ga0373953_0050752
800 Ga0373956_0000259
801 Ga0373957_0004792
802 Ga0373943_0044732
803 Ga0373946_0058375
804 Ga0373955_0000042
805 Ga0316574_0003441
806 Ga0316574_0094083
807 Ga0373924_0002625
808 Ga0373924_0008331
809 Ga0373931_0070600
810 Ga0373935_0092157
811 Ga0373933_0000024
812 Ga0373933_0002131
813 Ga0373937_0000029
814 Ga0373937_0016258
815 Ga0373937_0018412
816 Ga0316584_0030443
817 Ga0373925_0046247
818 Ga0395900_0003901
819 Ga0395900_0025721
820 Ga0395900_0038298
821 Ga0395900_0048454
822 Ga0395898_0048906
823 Ga0395898_0114063
824 Ga0395905_0334654
825 Ga0436364_0512751
826 Ga0395901_0032608
827 Ga0395901_0061850
828 Ga0395901_0125625
829 Ga0436365_1259398
830 Ga0451833_0309082
831 Ga0451837_1325092
832 Ga0451839_0248974
833 Ga0439448_0008448
834 Ga0439449_0038536
835 Ga0439446_0025261
836 Ga0466965_0004742
837 Ga0466965_0005892
838 Ga0466965_0012182
839 Ga0466966_0002361
840 Ga0466966_0002490
841 Ga0466966_0153128
842 Ga0466961_0005360
843 Ga0466961_0009837
844 Ga0466961_0016615
845 Ga0466961_0038957
846 Ga0466961_0117107
847 Ga0466963_0001501
848 Ga0466963_0017547
849 Ga0466964_0105313
850 Ga0466971_0037363
851 Ga0466970_0043074
852 Ga0466970_0050959
853 Ga0466957_0005140
854 Ga0466957_0039715
855 Ga0466960_0001139
856 Ga0466960_0002593
857 Ga0466959_0068399
858 Ga0466959_0075826
859 Ga0466958_0105068
860 Ga0466967_0004458
861 Ga0466967_0010889
862 Ga0466967_0028090
863 Ga0466967_0061984
864 Ga0466967_0109278
865 Ga0466967_0261850
866 Ga0466967_0311032
867 Ga0466967_0371607
868 Ga0495592_0000040
869 Ga0495592_0033946
870 Ga0495603_0062306
871 Ga0495629_0034825
872 Ga0495629_0084039
873 Ga0495641_0007867
874 Ga0495651_0000017
875 Ga0495651_0003331
876 Ga0495653_0023228
877 Ga0495653_0102539
878 Ga0495650_0012030
879 Ga0495662_0039873
880 Ga0495608_0000053
881 Ga0495608_0001385
882 Ga0495628_0003346
883 Ga0495652_0004370
884 Ga0495652_0071474
885 Ga0495665_0011540
886 Ga0495640_0065345
887 Ga0495587_0000079
888 Ga0495587_0051987
889 Ga0495587_0136602
890 Ga0495645_0060085
891 Ga0495667_0000063
892 Ga0495667_0011569
893 Ga0495667_0038552
894 Ga0495657_0000032
895 Ga0495657_0012453
896 Ga0495657_0027196
897 Ga0495599_0000047
898 Ga0495599_0007807
899 Ga0495599_0021137
900 Ga0495623_0006030
901 Ga0495623_0028564
902 Ga0495646_0026817
903 Ga0495669_0024146
904 Ga0495600_0134467
905 Ga0495581_0050360
906 Ga0495604_0000688
907 Ga0495604_0015385
908 Ga0495604_0079347
909 Ga0495674_0239552
910 Ga0495680_0000085
911 Ga0495680_0006211
912 Ga0495680_0056399
913 Ga0495675_0000946
914 Ga0495675_0061195
915 Ga0495684_0015842
916 Ga0495593_0038705
917 Ga0495602_0001525
918 Ga0496101_0004132
919 Ga0496101_0019589
920 Ga0496101_0094372
921 Ga0496101_0108538
922 Ga0496101_0266433
923 Ga0496102_0007714
924 Ga0496102_0060970
925 Ga0496103_0023740
926 Ga0496103_0097373
927 Ga0496105_0081900
928 Ga0496105_0139123
929 Ga0496106_0025755
930 Ga0496106_0078145
931 Ga0496107_0033516
932 Ga0496107_0194044
933 Ga0496108_0002092
934 Ga0496108_0113151
935 Ga0496108_0114965
936 Ga0496108_0203550
937 Ga0496109_0012848
938 Ga0496109_0067301
939 Ga0496109_0316269
940 Ga0496110_0001710
941 Ga0496110_0050461
942 Ga0496110_0134840
943 Ga0496111_0021572
944 Ga0496111_0026115
945 Ga0496111_0027854
946 Ga0496113_0074448
947 Ga0496114_0035008
948 Ga0496114_0045839
949 Ga0496114_0093559
950 Ga0496114_0094920
951 Ga0496115_0003477
952 Ga0496115_0024439
953 Ga0496124_0021648
954 Ga0496124_0035554
955 Ga0501031_0022032
956 Ga0501031_0045439
957 Ga0501031_0149218
958 Ga0501034_0087886
959 Ga0501036_0027020
960 Ga0501037_0136603
961 Ga0501038_0024352
962 Ga0501039_0007274
963 Ga0501039_0045507
964 Ga0501041_0004277
965 Ga0501042_0013394
966 Ga0501047_0000112
967 Ga0501067_0006602
968 Ga0501067_0009826
969 Ga0501067_0043572
970 Ga0501067_0051515
971 Ga0501068_0002525
972 Ga0501068_0039698
973 Ga0501069_0042190
974 Ga0501069_0044902
975 Ga0501069_0059762
976 Ga0501070_0001860
977 Ga0501070_0009674
978 Ga0501070_0016837
979 Ga0501070_0051248
980 Ga0501070_0062211
981 Ga0501070_0283948
982 Ga0501071_0006405
983 Ga0501071_0044699
984 Ga0501071_0257470
985 Ga0501072_0031001
986 Ga0501072_0152020
987 Ga0501073_0003012
988 Ga0501073_0042469
989 Ga0501073_0095558
990 Ga0501074_0038928
991 Ga0501074_0039683
992 Ga0501079_0059168
993 Ga0501079_0086073
994 Ga0501079_0147505
995 Ga0501080_0007094
996 Ga0501080_0041321
997 Ga0501083_0008007
998 Ga0501083_0030364
999 Ga0501083_0050420
1000 Ga0501045_0142621
1001 Ga0501045_0208047
1002 nmdc:mga03683_1096_c1
1003 nmdc:mga03n38_3361_c1
1004 nmdc:mga03n38_54106_c1
1005 nmdc:mga03n38_60099_c1
1006 nmdc:mga00v17_112387_c1
1007 nmdc:mga00v17_15668_c1
1008 nmdc:mga0yw44_21088_c1
1009 nmdc:mga0yw44_38494_c1
1010 nmdc:mga0yw44_4285_c1
1011 nmdc:mga0yw44_84788_c1
1012 nmdc:mga06z11_147909_c1
1013 nmdc:mga06z11_20507_c1
1014 nmdc:mga06z11_28307_c1
1015 nmdc:mga06z11_49126_c1
1016 nmdc:mga04h51_3704_c1
1017 nmdc:mga07m45_102913_c1
1018 nmdc:mga07m45_6243_c1
1019 nmdc:mga05p37_28018_c1
1020 nmdc:mga06r32_692_c3
1021 nmdc:mga0n895_1510_c1
1022 nmdc:mga0n895_28306_c1
1023 nmdc:mga0n895_463001_c1
1024 nmdc:mga0rr50_8140_c1
1025 nmdc:mga08x19_1123_c1
1026 nmdc:mga0a205_139077_c1
1027 nmdc:mga0a205_143076_c1
1028 Ga0495601_0046823
1029 Ga0495595_0001409
1030 Ga0495619_0085234
1031 Ga0495619_0086939
1032 Ga0500644_0000148
1033 Ga0500593_000774
1034 Ga0500559_0007294
1035 Ga0500568_0000706
1036 Ga0500573_0055242
1037 Ga0501084_0005525
1038 Ga0501082_0008583
1039 Ga0501082_0015723
1040 2623497721
1041 2643827303
1042 2644322716
1043 2644455806
1044 2644533870
1045 2753069826
1046 2816505706
1047 2839989613
1048 2855388115
1049 2857485688
1050 2870727663
1051 2932432107
1052 2984577694
1053 2990260607
1054 8047719869

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00425

Chorismate_bind

chorismate binding enzyme

222

474

0.98

PF01882

DUF58

Protein of unknown function DUF58

5

64

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3os6-assembly1.cif.gz_B crystal structure of putative 2,3-dihydroxybenzoate-specific isochorismate synthase, dhbc from bacillus anthracis. 0.8817 5 395
3os6-assembly2.cif.gz_C crystal structure of putative 2,3-dihydroxybenzoate-specific isochorismate synthase, dhbc from bacillus anthracis. 0.8794 5 395
3os6-assembly2.cif.gz_D crystal structure of putative 2,3-dihydroxybenzoate-specific isochorismate synthase, dhbc from bacillus anthracis. 0.8783 5 395
5jy8-assembly2.cif.gz_B an iron-bound structure of the isochorismate synthase entc 0.8738 9 394
5jy4-assembly2.cif.gz_B a high magnesium structure of the isochorismate synthase, entc 0.8698 13 394
ID Description Score Start End Superfamily
af_P9WFW9_3_372_3.60.120.10 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.8942 12 395 3.60.120.10
3os6D00 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.8735 5 395 3.60.120.10
5jy8A00 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.8656 14 395 3.60.120.10
af_P9WFW9_3_372_3.60.120.10 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.8637 12 395 3.60.120.10
3os6D00 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.8528 5 395 3.60.120.10
ID Description Score Start End GO Terms
AF-A0A7H4N506-F1-model_v4 Isochorismate synthase (EC 5.4.4.2) 0.9849 197 328 GO:0008909
GO:0009058
AF-A0A6N6XHZ1-F1-model_v4 deleted 0.9762 213 343
AF-A0A6J6I096-F1-model_v4 isochorismate synthase (EC 5.4.4.2) (Isochorismate mutase) 0.9738 196 395 GO:0008909
GO:0009697
AF-A0A645HDC1-F1-model_v4 isochorismate synthase (EC 5.4.4.2) (Isochorismate mutase) 0.9731 197 395 GO:0008909
GO:0009058
AF-A0A1G7MP23-F1-model_v4 isochorismate synthase (EC 5.4.4.2) (Isochorismate mutase) 0.973 18 395 GO:0008909
GO:0009058

Map