F459499

General Info

Members Datasets Scaffolds Average Seq Length
527 238 1054 230

Family's Representative Sequence

Representative Sequence 3300003911|JGI25405J52794_10002410|JGI25405J52794_100024102
Length 273
Sequence VDRLALKDDAFQIAAGADVRRLDRNYRRDGGSPQRPFHVLRPSLMKRKVLVVDVGGTHVKLLMSSRNEREFPSGPRLTPQQLIAKLNETVRGWKFDRASIGFPAPIRKGRIARDPKHLGKGWIGFNFTRALGIPVRVVNDAAMQALGSYRGGRMLFLGLGTGLGSALVWNKTLMPLELGDLPYRRGHIIENYLGLPGLKLLGEKKWKREVAYAVTQLRKSFIADYVVLGGGLVHRFGRLPEGTERGQNXNAFLGGVRLWETREHSRELKWLVL

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
180 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
181 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
197 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
198 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
201 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
204 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
205 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
206 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
209 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
210 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.49
Rhizosphere 90.13
Stem 0
Stem Tuber 0
Unclassified 31.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10002410 3300003911 Bacteria 3215
2 JGI24737J22298_10008891 3300001990 Bacteria 3352
3 JGI24035J26624_1004331 3300002126 Unclassified 1346
4 rootH1_10109327 3300003323 Bacteria 10817
5 Ga0065714_10105603 3300005288 Unclassified 1563
6 Ga0065704_10082402 3300005289 Bacteria 3605
7 Ga0065712_10002339 3300005290 Bacteria 7754
8 Ga0065712_10078646 3300005290 Unclassified 3317
9 Ga0065712_10112131 3300005290 Bacteria 1781
10 Ga0065715_10003667 3300005293 Bacteria 6429
11 Ga0065715_10004685 3300005293 Bacteria 6077
12 Ga0065715_10136628 3300005293 Bacteria 1919
13 Ga0065715_10203182 3300005293 Unclassified 1351
14 Ga0065715_10230725 3300005293 Unclassified 1187
15 Ga0065715_10256508 3300005293 Unclassified 1146
16 Ga0065715_10311090 3300005293 Unclassified 1007
17 Ga0065707_10027968 3300005295 Unclassified 2885
18 Ga0065707_10332877 3300005295 Unclassified 946
19 Ga0070658_10069091 3300005327 Unclassified 2890
20 Ga0070676_10038285 3300005328 Bacteria 2769
21 Ga0070676_10038761 3300005328 Bacteria 2753
22 Ga0070676_10204516 3300005328 Bacteria 1296
23 Ga0070683_100006424 3300005329 Bacteria 9858
24 Ga0070683_100028419 3300005329 Bacteria 5053
25 Ga0070683_100174806 3300005329 Bacteria 2039
26 Ga0070690_100042988 3300005330 Bacteria 2863
27 Ga0070690_100124244 3300005330 Bacteria 1735
28 Ga0070690_100434231 3300005330 Unclassified 971
29 Ga0070670_100052062 3300005331 Bacteria 3516
30 Ga0070670_100324111 3300005331 Unclassified 1350
31 Ga0070670_100328098 3300005331 Unclassified 1342
32 Ga0070666_10256245 3300005335 Unclassified 1239
33 Ga0070680_100103967 3300005336 Bacteria 2360
34 Ga0070682_100364975 3300005337 Bacteria 1081
35 Ga0070682_100447961 3300005337 Unclassified 988
36 Ga0068868_100115337 3300005338 Unclassified 2187
37 Ga0068868_100195697 3300005338 Bacteria 1683
38 Ga0070660_100009628 3300005339 Bacteria 6805
39 Ga0070660_100121170 3300005339 Bacteria 2087
40 Ga0070689_100004395 3300005340 Bacteria 9518
41 Ga0070689_100027391 3300005340 Bacteria 4296
42 Ga0070689_100119721 3300005340 Unclassified 2102
43 Ga0070689_100144549 3300005340 Bacteria 1915
44 Ga0070689_100214719 3300005340 Unclassified 1576
45 Ga0070687_100027242 3300005343 Bacteria 2759
46 Ga0070661_100022206 3300005344 Bacteria 4541
47 Ga0070668_100023334 3300005347 Bacteria 4679
48 Ga0070668_100039990 3300005347 Unclassified 3587
49 Ga0070668_100332475 3300005347 Unclassified 1282
50 Ga0070668_100376429 3300005347 Unclassified 1207
51 Ga0070669_100004874 3300005353 Bacteria 9684
52 Ga0070669_100065915 3300005353 Unclassified 2668
53 Ga0070669_100118832 3300005353 Unclassified 2014
54 Ga0070669_100730320 3300005353 Unclassified 838
55 Ga0070675_100004347 3300005354 Bacteria 10808
56 Ga0070675_100038414 3300005354 Bacteria 3901
57 Ga0070675_100044076 3300005354 Bacteria 3648
58 Ga0070675_100297793 3300005354 Unclassified 1420
59 Ga0070671_100201050 3300005355 Unclassified 1689
60 Ga0070671_100371371 3300005355 Bacteria 1222
61 Ga0070674_100005813 3300005356 Bacteria 7163
62 Ga0070674_100140547 3300005356 Unclassified 1812
63 Ga0070674_100240134 3300005356 Unclassified 1418
64 Ga0070673_100082668 3300005364 Bacteria 2607
65 Ga0070673_100298490 3300005364 Bacteria 1418
66 Ga0070688_100012218 3300005365 Unclassified 4806
67 Ga0070688_100014669 3300005365 Unclassified 4443
68 Ga0070688_100070501 3300005365 Bacteria 2235
69 Ga0070688_100330144 3300005365 Bacteria 1111
70 Ga0070659_100001243 3300005366 Bacteria 18491
71 Ga0070667_100145343 3300005367 Bacteria 2079
72 Ga0070667_100169160 3300005367 Bacteria 1929
73 Ga0070667_100747204 3300005367 Unclassified 907
74 Ga0070703_10114282 3300005406 Unclassified 970
75 Ga0070709_10020690 3300005434 Bacteria 3823
76 Ga0070709_10040059 3300005434 Unclassified 2878
77 Ga0070709_10190401 3300005434 Bacteria 1446
78 Ga0070709_10270308 3300005434 Bacteria 1232
79 Ga0070709_10369538 3300005434 Unclassified 1064
80 Ga0070714_100073859 3300005435 Bacteria 2955
81 Ga0070714_100117562 3300005435 Bacteria 2361
82 Ga0070714_100396569 3300005435 Unclassified 1303
83 Ga0070713_100020857 3300005436 Bacteria 5030
84 Ga0070713_100035359 3300005436 Unclassified 4021
85 Ga0070713_100206866 3300005436 Unclassified 1775
86 Ga0070713_100352526 3300005436 Bacteria 1366
87 Ga0070713_100611951 3300005436 Bacteria 1035
88 Ga0070710_10263698 3300005437 Bacteria 1112
89 Ga0070711_100012914 3300005439 Bacteria 5233
90 Ga0070711_100094373 3300005439 Bacteria 2162
91 Ga0070711_100098162 3300005439 Unclassified 2126
92 Ga0070711_100106065 3300005439 Bacteria 2053
93 Ga0070705_100013033 3300005440 Bacteria 4242
94 Ga0070705_100015251 3300005440 Bacteria 3968
95 Ga0070705_100096773 3300005440 Bacteria 1854
96 Ga0070700_100012411 3300005441 Unclassified 4754
97 Ga0070694_100226277 3300005444 Bacteria 1405
98 Ga0070708_100076772 3300005445 Bacteria 3018
99 Ga0070708_100206563 3300005445 Bacteria 1840
100 Ga0070708_100411990 3300005445 Bacteria 1274
101 Ga0070708_100552043 3300005445 Bacteria 1087
102 Ga0070708_100596172 3300005445 Bacteria 1042
103 Ga0070663_100013239 3300005455 Bacteria 5251
104 Ga0070663_100333713 3300005455 Unclassified 1223
105 Ga0070678_100039234 3300005456 Bacteria 3339
106 Ga0070662_100020088 3300005457 Bacteria 4546
107 Ga0070662_100087776 3300005457 Bacteria 2329
108 Ga0070681_10015782 3300005458 Bacteria 7529
109 Ga0068867_100720909 3300005459 Unclassified 882
110 Ga0070685_10097512 3300005466 Bacteria 1790
111 Ga0070706_100002784 3300005467 Bacteria 17481
112 Ga0070706_100005741 3300005467 Bacteria 11799
113 Ga0070706_100006694 3300005467 Bacteria 10875
114 Ga0070706_100010362 3300005467 Bacteria 8660
115 Ga0070706_100011262 3300005467 Bacteria 8307
116 Ga0070706_100041054 3300005467 Bacteria 4271
117 Ga0070706_100048492 3300005467 Unclassified 3920
118 Ga0070706_100079355 3300005467 Bacteria 3038
119 Ga0070706_100113546 3300005467 Bacteria 2522
120 Ga0070706_100169047 3300005467 Bacteria 2041
121 Ga0070707_100000711 3300005468 Bacteria 33208
122 Ga0070707_100005281 3300005468 Bacteria 12092
123 Ga0070707_100016033 3300005468 Bacteria 7029
124 Ga0070707_100029038 3300005468 Bacteria 5264
125 Ga0070707_100228934 3300005468 Bacteria 1810
126 Ga0070707_100302409 3300005468 Bacteria 1554
127 Ga0070707_100413543 3300005468 Bacteria 1309
128 Ga0070707_100419043 3300005468 Bacteria 1299
129 Ga0070707_100491439 3300005468 Unclassified 1189
130 Ga0070707_100697336 3300005468 Bacteria 978
131 Ga0070698_100018927 3300005471 Bacteria 7243
132 Ga0070698_100024372 3300005471 Bacteria 6315
133 Ga0070698_100138302 3300005471 Bacteria 2388
134 Ga0070698_100149394 3300005471 Bacteria 2285
135 Ga0070699_100055227 3300005518 Bacteria 3439
136 Ga0070699_100152582 3300005518 Unclassified 2044
137 Ga0070679_100243253 3300005530 Bacteria 1756
138 Ga0070684_100000223 3300005535 Bacteria 39444
139 Ga0070684_100019581 3300005535 Bacteria 5600
140 Ga0070684_100023677 3300005535 Bacteria 5140
141 Ga0070684_100211264 3300005535 Unclassified 1769
142 Ga0070697_100058453 3300005536 Bacteria 3138
143 Ga0070697_100063092 3300005536 Bacteria 3025
144 Ga0070697_100064942 3300005536 Bacteria 2981
145 Ga0070697_100149265 3300005536 Bacteria 1970
146 Ga0070697_100153916 3300005536 Bacteria 1940
147 Ga0070697_100156528 3300005536 Bacteria 1924
148 Ga0070697_100243682 3300005536 Bacteria 1535
149 Ga0070697_100263339 3300005536 Bacteria 1476
150 Ga0070672_100010024 3300005543 Bacteria 6556
151 Ga0070686_100173804 3300005544 Unclassified 1526
152 Ga0070686_100187870 3300005544 Bacteria 1473
153 Ga0070686_100238351 3300005544 Bacteria 1323
154 Ga0070665_100045086 3300005548 Bacteria 4427
155 Ga0070665_100085567 3300005548 Bacteria 3158
156 Ga0070665_100100490 3300005548 Bacteria 2896
157 Ga0070665_100131914 3300005548 Bacteria 2500
158 Ga0070665_100236951 3300005548 Bacteria 1825
159 Ga0070665_100578805 3300005548 Unclassified 1136
160 Ga0070704_100003211 3300005549 Bacteria 9349
161 Ga0070704_100515195 3300005549 Bacteria 1040
162 Ga0070664_100024005 3300005564 Bacteria 5039
163 Ga0070664_100052862 3300005564 Bacteria 3442
164 Ga0068856_100000428 3300005614 Bacteria 46195
165 Ga0068856_100014395 3300005614 Bacteria 7645
166 Ga0068859_100020882 3300005617 Bacteria 6573
167 Ga0068866_10134592 3300005718 Bacteria 1410
168 Ga0068866_10205506 3300005718 Bacteria 1179
169 Ga0068863_100012823 3300005841 Bacteria 8084
170 Ga0068863_100214712 3300005841 Unclassified 1853
171 Ga0068863_100240874 3300005841 Unclassified 1746
172 Ga0068858_100016898 3300005842 Bacteria 6851
173 Ga0068860_100004814 3300005843 Bacteria 13743
174 Ga0068860_100025112 3300005843 Bacteria 5750
175 Ga0081455_10001020 3300005937 Bacteria 35311
176 Ga0081455_10001318 3300005937 Bacteria 30770
177 Ga0081455_10006255 3300005937 Bacteria 12818
178 Ga0081455_10006792 3300005937 Bacteria 12200
179 Ga0081455_10012135 3300005937 Bacteria 8609
180 Ga0081455_10120097 3300005937 Bacteria 2072
181 Ga0081455_10175160 3300005937 Unclassified 1630
182 Ga0081540_1000031 3300005983 Bacteria 147094
183 Ga0081540_1051594 3300005983 Bacteria 2032
184 Ga0081540_1072738 3300005983 Unclassified 1582
185 Ga0081539_10000383 3300005985 Bacteria 95995
186 Ga0081539_10012397 3300005985 Bacteria 6576
187 Ga0081539_10056959 3300005985 Unclassified 2166
188 Ga0070717_10000233 3300006028 Bacteria 38420
189 Ga0070717_10000854 3300006028 Bacteria 20194
190 Ga0070717_10020213 3300006028 Bacteria 5233
191 Ga0070717_10049241 3300006028 Bacteria 3458
192 Ga0070717_10746776 3300006028 Unclassified 889
193 Ga0070717_10850996 3300006028 Bacteria 830
194 Ga0070715_10005204 3300006163 Bacteria 4322
195 Ga0070715_10152750 3300006163 Unclassified 1133
196 Ga0070716_100006007 3300006173 Bacteria 5913
197 Ga0070716_100130890 3300006173 Unclassified 1586
198 Ga0070712_100022382 3300006175 Bacteria 4164
199 Ga0070712_100103095 3300006175 Bacteria 2115
200 Ga0070712_100192834 3300006175 Bacteria 1595
201 Ga0097621_100215865 3300006237 Bacteria 1670
202 Ga0097621_100506822 3300006237 Bacteria 1094
203 Ga0068871_100073307 3300006358 Unclassified 2822
204 Ga0068871_100120581 3300006358 Unclassified 2215
205 Ga0075434_100354653 3300006871 Bacteria 1488
206 Ga0075436_100323471 3300006914 Bacteria 1108
207 Ga0097620_100020882 3300006931 Bacteria 6573
208 Ga0099795_10102995 3300007788 Bacteria 1122
209 Ga0111539_10396855 3300009094 Bacteria 1606
210 Ga0111539_10413827 3300009094 Bacteria 1570
211 Ga0105245_10055745 3300009098 Bacteria 3551
212 Ga0105245_10334308 3300009098 Bacteria 1496
213 Ga0105245_10814695 3300009098 Bacteria 972
214 Ga0105247_10425392 3300009101 Unclassified 952
215 Ga0114129_10018230 3300009147 Bacteria 9996
216 Ga0105243_10279262 3300009148 Bacteria 1504
217 Ga0105242_10338025 3300009176 Unclassified 1387
218 Ga0105248_10554501 3300009177 Bacteria 1297
219 Ga0105237_10085470 3300009545 Unclassified 3145
220 Ga0105249_10052005 3300009553 Bacteria 3740
221 Ga0105249_10090184 3300009553 Bacteria 2866
222 Ga0105249_10110191 3300009553 Unclassified 2601
223 Ga0105249_10174406 3300009553 Bacteria 2087
224 Ga0099796_10028117 3300010159 Bacteria 1802
225 Ga0105239_10091912 3300010375 Bacteria 3350
226 Ga0105239_10332627 3300010375 Bacteria 1714
227 Ga0105239_10713470 3300010375 Unclassified 1147
228 Ga0105239_10759909 3300010375 Bacteria 1110
229 Ga0105246_10223376 3300011119 Unclassified 1478
230 Ga0105246_10380181 3300011119 Bacteria 1167
231 Ga0157371_10046262 3300013102 Bacteria 3095
232 Ga0157371_10196254 3300013102 Unclassified 1446
233 Ga0157370_10191630 3300013104 Unclassified 1898
234 Ga0157369_10199161 3300013105 Bacteria 2102
235 Ga0157374_10058431 3300013296 Bacteria 3604
236 Ga0157374_10106200 3300013296 Unclassified 2697
237 Ga0157374_10150101 3300013296 Unclassified 2265
238 Ga0157374_10154891 3300013296 Bacteria 2230
239 Ga0157374_10204486 3300013296 Unclassified 1935
240 Ga0157374_10284502 3300013296 Unclassified 1633
241 Ga0157374_10355837 3300013296 Unclassified 1455
242 Ga0157374_10623957 3300013296 Unclassified 1089
243 Ga0157378_10149403 3300013297 Unclassified 2176
244 Ga0157378_10157235 3300013297 Unclassified 2123
245 Ga0157378_10280061 3300013297 Unclassified 1607
246 Ga0157378_10759304 3300013297 Bacteria 993
247 Ga0157378_11010661 3300013297 Unclassified 866
248 Ga0163162_10040867 3300013306 Bacteria 4639
249 Ga0163162_10063394 3300013306 Bacteria 3739
250 Ga0163162_10074572 3300013306 Bacteria 3452
251 Ga0163162_10243579 3300013306 Unclassified 1929
252 Ga0163162_10608945 3300013306 Unclassified 1218
253 Ga0157372_10019497 3300013307 Bacteria 7313
254 Ga0157372_10034421 3300013307 Bacteria 5568
255 Ga0157375_10003948 3300013308 Bacteria 12859
256 Ga0157375_10043363 3300013308 Bacteria 4362
257 Ga0157375_10064623 3300013308 Bacteria 3644
258 Ga0157375_10193803 3300013308 Bacteria 2187
259 Ga0157375_10271843 3300013308 Unclassified 1857
260 Ga0157375_10884015 3300013308 Bacteria 1038
261 Ga0157375_11102548 3300013308 Bacteria 929
262 Ga0163163_10163839 3300014325 Bacteria 2269
263 Ga0163163_10269684 3300014325 Bacteria 1753
264 Ga0157379_10010187 3300014968 Bacteria 8191
265 Ga0157379_10101030 3300014968 Bacteria 2588
266 Ga0157376_10022801 3300014969 Bacteria 4888
267 Ga0157376_10085495 3300014969 Bacteria 2718
268 Ga0157376_10186193 3300014969 Unclassified 1901
269 Ga0182006_1027996 3300015261 Bacteria 2296
270 Ga0163161_10052841 3300017792 Bacteria 2945
271 Ga0207666_1000306 3300025271 Bacteria 6816
272 Ga0207666_1002205 3300025271 Unclassified 2336
273 Ga0207673_1000895 3300025290 Bacteria 3202
274 Ga0207697_10000663 3300025315 Bacteria 19554
275 Ga0207697_10000729 3300025315 Bacteria 18691
276 Ga0207697_10001748 3300025315 Bacteria 11675
277 Ga0207697_10002124 3300025315 Bacteria 10399
278 Ga0207697_10004391 3300025315 Bacteria 6743
279 Ga0207697_10007625 3300025315 Bacteria 4805
280 Ga0207697_10019882 3300025315 Unclassified 2751
281 Ga0207697_10024011 3300025315 Unclassified 2497
282 Ga0207697_10027529 3300025315 Bacteria 2323
283 Ga0207697_10105035 3300025315 Unclassified 1206
284 Ga0207697_10112935 3300025315 Unclassified 1164
285 Ga0207653_10023253 3300025885 Bacteria 1973
286 Ga0207692_10298855 3300025898 Unclassified 979
287 Ga0207692_10527937 3300025898 Bacteria 752
288 Ga0207642_10003854 3300025899 Bacteria 4781
289 Ga0207688_10003473 3300025901 Bacteria 8596
290 Ga0207688_10079095 3300025901 Bacteria 1875
291 Ga0207688_10142472 3300025901 Unclassified 1411
292 Ga0207680_10058032 3300025903 Bacteria 2345
293 Ga0207680_10136217 3300025903 Bacteria 1623
294 Ga0207647_10028908 3300025904 Bacteria 3595
295 Ga0207685_10127948 3300025905 Unclassified 1124
296 Ga0207699_10108173 3300025906 Bacteria 1777
297 Ga0207699_10229679 3300025906 Unclassified 1270
298 Ga0207645_10000666 3300025907 Bacteria 28512
299 Ga0207645_10002525 3300025907 Bacteria 14325
300 Ga0207705_10550028 3300025909 Unclassified 897
301 Ga0207684_10000617 3300025910 Bacteria 42287
302 Ga0207684_10001353 3300025910 Bacteria 26848
303 Ga0207684_10003408 3300025910 Bacteria 15544
304 Ga0207684_10016647 3300025910 Bacteria 6313
305 Ga0207684_10048285 3300025910 Bacteria 3610
306 Ga0207684_10056408 3300025910 Unclassified 3332
307 Ga0207684_10193943 3300025910 Bacteria 1752
308 Ga0207693_10002580 3300025915 Bacteria 15743
309 Ga0207693_10015283 3300025915 Bacteria 6160
310 Ga0207693_10015619 3300025915 Bacteria 6088
311 Ga0207693_10037615 3300025915 Bacteria 3814
312 Ga0207693_10059571 3300025915 Unclassified 2991
313 Ga0207693_10549608 3300025915 Unclassified 900
314 Ga0207663_10005195 3300025916 Bacteria 6550
315 Ga0207663_10023651 3300025916 Bacteria 3529
316 Ga0207663_10030586 3300025916 Bacteria 3177
317 Ga0207663_10084085 3300025916 Bacteria 2092
318 Ga0207663_10249956 3300025916 Unclassified 1304
319 Ga0207662_10006734 3300025918 Bacteria 6215
320 Ga0207662_10112917 3300025918 Bacteria 1696
321 Ga0207657_10019676 3300025919 Bacteria 6401
322 Ga0207657_10204425 3300025919 Bacteria 1587
323 Ga0207657_10234428 3300025919 Bacteria 1467
324 Ga0207649_10072671 3300025920 Bacteria 2201
325 Ga0207646_10000413 3300025922 Bacteria 57255
326 Ga0207646_10008068 3300025922 Bacteria 10613
327 Ga0207646_10050467 3300025922 Bacteria 3723
328 Ga0207646_10118080 3300025922 Bacteria 2382
329 Ga0207646_10257453 3300025922 Bacteria 1577
330 Ga0207646_10266514 3300025922 Bacteria 1548
331 Ga0207646_10533938 3300025922 Bacteria 1055
332 Ga0207646_10552201 3300025922 Unclassified 1035
333 Ga0207646_10567169 3300025922 Bacteria 1020
334 Ga0207646_10599794 3300025922 Bacteria 989
335 Ga0207646_10604527 3300025922 Bacteria 984
336 Ga0207681_10001007 3300025923 Bacteria 18378
337 Ga0207681_10017735 3300025923 Bacteria 4474
338 Ga0207650_10065276 3300025925 Unclassified 2727
339 Ga0207650_10331674 3300025925 Bacteria 1248
340 Ga0207650_10529540 3300025925 Bacteria 986
341 Ga0207659_10049433 3300025926 Unclassified 2983
342 Ga0207659_10079036 3300025926 Bacteria 2426
343 Ga0207659_10268284 3300025926 Bacteria 1391
344 Ga0207700_10128997 3300025928 Bacteria 2062
345 Ga0207700_10449618 3300025928 Bacteria 1135
346 Ga0207664_10045600 3300025929 Bacteria 3439
347 Ga0207644_10309997 3300025931 Bacteria 1274
348 Ga0207690_10005910 3300025932 Bacteria 7246
349 Ga0207706_10006566 3300025933 Bacteria 10770
350 Ga0207706_10007277 3300025933 Bacteria 10233
351 Ga0207706_10013350 3300025933 Bacteria 7472
352 Ga0207706_10094358 3300025933 Bacteria 2632
353 Ga0207686_10247229 3300025934 Bacteria 1301
354 Ga0207670_10001997 3300025936 Bacteria 10702
355 Ga0207670_10293784 3300025936 Unclassified 1270
356 Ga0207670_10370704 3300025936 Unclassified 1138
357 Ga0207669_10079384 3300025937 Unclassified 2095
358 Ga0207704_10157509 3300025938 Bacteria 1611
359 Ga0207704_10779093 3300025938 Unclassified 797
360 Ga0207665_10005860 3300025939 Bacteria 8175
361 Ga0207665_10012762 3300025939 Bacteria 5524
362 Ga0207665_10098441 3300025939 Unclassified 2038
363 Ga0207665_10104899 3300025939 Bacteria 1979
364 Ga0207665_10322849 3300025939 Bacteria 1159
365 Ga0207691_10003575 3300025940 Bacteria 15126
366 Ga0207711_10506918 3300025941 Unclassified 1125
367 Ga0207689_10043421 3300025942 Bacteria 3716
368 Ga0207661_10009171 3300025944 Bacteria 7095
369 Ga0207661_10255787 3300025944 Bacteria 1558
370 Ga0207679_10247225 3300025945 Bacteria 1514
371 Ga0207679_10364384 3300025945 Unclassified 1263
372 Ga0207651_10085378 3300025960 Bacteria 2290
373 Ga0207651_10175019 3300025960 Unclassified 1696
374 Ga0207712_10437684 3300025961 Unclassified 1106
375 Ga0207668_10028007 3300025972 Bacteria 3678
376 Ga0207658_10182619 3300025986 Bacteria 1737
377 Ga0207658_10268942 3300025986 Bacteria 1456
378 Ga0207677_10205063 3300026023 Unclassified 1570
379 Ga0207677_10305103 3300026023 Unclassified 1316
380 Ga0207677_10395259 3300026023 Bacteria 1171
381 Ga0207639_10868770 3300026041 Unclassified 842
382 Ga0207678_10005675 3300026067 Bacteria 11151
383 Ga0207678_10350478 3300026067 Unclassified 1273
384 Ga0207708_10014985 3300026075 Bacteria 5809
385 Ga0207702_10002165 3300026078 Bacteria 18852
386 Ga0207702_10557733 3300026078 Unclassified 1121
387 Ga0207641_10136583 3300026088 Bacteria 2208
388 Ga0207641_10299955 3300026088 Unclassified 1517
389 Ga0207648_10589353 3300026089 Unclassified 1024
390 Ga0207675_100336530 3300026118 Bacteria 1477
391 Ga0207683_10003940 3300026121 Bacteria 12880
392 Ga0209179_1017260 3300027512 Unclassified 1366
393 Ga0207428_10096359 3300027907 Unclassified 2291
394 Ga0268266_10317364 3300028379 Bacteria 1457
395 Ga0268265_10099260 3300028380 Unclassified 2347
396 Ga0268264_10014613 3300028381 Bacteria 6451
397 Ga0373934_0054636 3300035086 Unclassified 1586
398 Ga0373944_0075714 3300035089 Unclassified 1104
399 Ga0373945_0018943 3300035116 Unclassified 2346
400 Ga0373953_0183623 3300035117 Bacteria 903
401 Ga0373954_0062020 3300035118 Unclassified 1766
402 Ga0373943_0056115 3300035170 Unclassified 1954
403 Ga0373946_0015242 3300035171 Bacteria 2911
404 Ga0373955_0030174 3300035172 Bacteria 2827
405 Ga0373931_0082135 3300035691 Unclassified 1781
406 Ga0373935_0339498 3300035692 Unclassified 1069
407 Ga0373933_0273589 3300035724 Unclassified 1090
408 Ga0373947_0004849 3300035725 Bacteria 7863
409 Ga0373947_0108661 3300035725 Unclassified 1750
410 Ga0373947_0154057 3300035725 Bacteria 1482
411 Ga0373947_0603255 3300035725 Unclassified 748
412 Ga0373937_0018202 3300036401 Bacteria 6269
413 Ga0373937_0203111 3300036401 Unclassified 1863
414 Ga0373925_0073992 3300037068 Bacteria 2580
415 Ga0373925_0190174 3300037068 Unclassified 1628
416 Ga0395899_0000045 3300037312 Bacteria 247620
417 Ga0395900_0167763 3300037418 Unclassified 2236
418 Ga0395900_0301913 3300037418 Unclassified 1587
419 Ga0395900_0475426 3300037418 Bacteria 1203
420 Ga0395898_0000541 3300037466 Bacteria 71691
421 Ga0395898_0221797 3300037466 Bacteria 1803
422 Ga0395905_0013858 3300037471 Bacteria 7713
423 Ga0395905_0830425 3300037471 Bacteria 827
424 Ga0395901_0000676 3300038443 Bacteria 39205
425 Ga0395901_0047449 3300038443 Bacteria 4460
426 Ga0451807_2498897 3300041486 Bacteria 1904
427 Ga0451853_1675534 3300041512 Bacteria 2170
428 Ga0439464_0052211 3300042439 Unclassified 1184
429 Ga0466957_0007326 3300044842 Bacteria 6235
430 Ga0451576_0093242 3300045051 Bacteria 3131
431 Ga0495592_0053767 3300046454 Unclassified 2985
432 Ga0495629_0038735 3300046459 Bacteria 3357
433 Ga0495641_0111767 3300046461 Unclassified 1219
434 Ga0495580_0397772 3300046472 Unclassified 929
435 Ga0495639_0104781 3300046475 Unclassified 1338
436 Ga0495662_0157203 3300046476 Unclassified 1120
437 Ga0495584_0181967 3300046491 Unclassified 1068
438 Ga0495608_0369623 3300046511 Unclassified 880
439 Ga0495628_0017112 3300046516 Bacteria 6039
440 Ga0495666_0076569 3300046526 Unclassified 1586
441 Ga0495666_0310171 3300046526 Unclassified 713
442 Ga0495652_0010639 3300046529 Bacteria 8335
443 Ga0495640_0368743 3300046533 Unclassified 884
444 Ga0495586_0349204 3300046535 Unclassified 849
445 Ga0495587_0007319 3300046536 Bacteria 7154
446 Ga0495598_0035351 3300046537 Unclassified 1430
447 Ga0495645_0002319 3300046543 Bacteria 12915
448 Ga0495645_0252109 3300046543 Bacteria 1173
449 Ga0495633_0138873 3300046558 Unclassified 1124
450 Ga0495634_0170705 3300046642 Unclassified 1367
451 Ga0495634_0298968 3300046642 Unclassified 973
452 Ga0495635_0139293 3300046663 Unclassified 1653
453 Ga0495657_0131257 3300046675 Bacteria 1569
454 Ga0495599_0006610 3300046678 Bacteria 6994
455 Ga0495623_0002872 3300046679 Bacteria 11360
456 Ga0495646_0003663 3300046680 Bacteria 9594
457 Ga0495658_0211694 3300046683 Unclassified 1211
458 Ga0495669_0028913 3300046684 Unclassified 2429
459 Ga0495624_0052062 3300046690 Bacteria 2589
460 Ga0495649_0348467 3300046694 Unclassified 749
461 Ga0495604_0008020 3300047317 Bacteria 8367
462 Ga0495674_0039609 3300047319 Bacteria 4222
463 Ga0495674_0619924 3300047319 Unclassified 855
464 Ga0495680_0107145 3300047322 Bacteria 2076
465 Ga0495680_0232213 3300047322 Bacteria 1313
466 Ga0495675_0006025 3300047444 Bacteria 7417
467 Ga0495684_0004138 3300047471 Bacteria 11332
468 Ga0495602_0015247 3300048088 Bacteria 7763
469 Ga0495602_0179950 3300048088 Bacteria 1632
470 Ga0496100_0009777 3300048903 Bacteria 5400
471 Ga0496100_0071857 3300048903 Unclassified 2312
472 Ga0496101_0059625 3300048904 Bacteria 2766
473 Ga0496101_0122486 3300048904 Bacteria 1967
474 Ga0496101_0398997 3300048904 Unclassified 1083
475 Ga0496102_0003599 3300048905 Bacteria 13123
476 Ga0496102_0726486 3300048905 Bacteria 916
477 Ga0496103_0015786 3300048906 Bacteria 4502
478 Ga0496104_0086200 3300048907 Bacteria 2998
479 Ga0496104_0187928 3300048907 Bacteria 1977
480 Ga0496104_0276672 3300048907 Bacteria 1592
481 Ga0496104_0405081 3300048907 Bacteria 1276
482 Ga0496105_0080987 3300048908 Bacteria 2682
483 Ga0496105_0127039 3300048908 Bacteria 2102
484 Ga0496106_0001475 3300048909 Bacteria 17683
485 Ga0496106_0030851 3300048909 Bacteria 3996
486 Ga0496106_0049760 3300048909 Unclassified 3158
487 Ga0496107_0002749 3300048910 Bacteria 11572
488 Ga0496107_0078341 3300048910 Bacteria 2408
489 Ga0496107_0149441 3300048910 Unclassified 1728
490 Ga0496108_0045140 3300048911 Bacteria 3680
491 Ga0496108_0128303 3300048911 Bacteria 2179
492 Ga0496108_0467318 3300048911 Bacteria 1102
493 Ga0496109_0044293 3300048912 Bacteria 4037
494 Ga0496109_0150639 3300048912 Bacteria 2178
495 Ga0496109_0204651 3300048912 Bacteria 1856
496 Ga0496109_0246954 3300048912 Unclassified 1680
497 Ga0496109_0285334 3300048912 Bacteria 1556
498 Ga0496109_0295610 3300048912 Bacteria 1527
499 Ga0496109_0369369 3300048912 Unclassified 1355
500 Ga0496109_0522831 3300048912 Bacteria 1120
501 Ga0496109_0669961 3300048912 Unclassified 975
502 Ga0496110_0091663 3300048913 Bacteria 2719
503 Ga0496110_0434817 3300048913 Bacteria 1196
504 Ga0496110_0562097 3300048913 Unclassified 1036
505 Ga0496112_0030701 3300048915 Bacteria 5204
506 Ga0496112_0034647 3300048915 Bacteria 4913
507 Ga0496112_0040038 3300048915 Bacteria 4581
508 Ga0496112_0139472 3300048915 Unclassified 2394
509 Ga0496112_0172685 3300048915 Unclassified 2127
510 Ga0496113_0354086 3300048916 Unclassified 1178
511 Ga0496113_0549527 3300048916 Bacteria 926
512 Ga0496114_0013493 3300048917 Bacteria 6552
513 Ga0496114_0045562 3300048917 Bacteria 3644
514 Ga0496114_0146646 3300048917 Unclassified 2046
515 Ga0496115_0015882 3300048918 Bacteria 5721
516 Ga0496115_0028531 3300048918 Bacteria 4375
517 Ga0496115_0033778 3300048918 Bacteria 4040
518 Ga0496115_0091658 3300048918 Bacteria 2484
519 nmdc:mga05p37_50135_c1 3300050507 Bacteria 5133
520 nmdc:mga05p37_50749_c1 3300050507 Bacteria 5102
521 nmdc:mga08y16_181812_c1 3300050511 Unclassified 2183
522 nmdc:mga08x19_271856_c1 3300050514 Bacteria 1173
523 nmdc:mga0a205_241171_c1 3300050515 Bacteria 1688
524 Ga0495601_0024707 3300053077 Bacteria 3700
525 Ga0495612_0009336 3300053078 Bacteria 3981
526 Ga0495619_0154719 3300053085 Unclassified 1582
527 Ga0495619_0440256 3300053085 Bacteria 899
528 JGI25405J52794_10002410
529 JGI24737J22298_10008891
530 JGI24035J26624_1004331
531 rootH1_10109327
532 Ga0065714_10105603
533 Ga0065704_10082402
534 Ga0065712_10002339
535 Ga0065712_10078646
536 Ga0065712_10112131
537 Ga0065715_10003667
538 Ga0065715_10004685
539 Ga0065715_10136628
540 Ga0065715_10203182
541 Ga0065715_10230725
542 Ga0065715_10256508
543 Ga0065715_10311090
544 Ga0065707_10027968
545 Ga0065707_10332877
546 Ga0070658_10069091
547 Ga0070676_10038285
548 Ga0070676_10038761
549 Ga0070676_10204516
550 Ga0070683_100006424
551 Ga0070683_100028419
552 Ga0070683_100174806
553 Ga0070690_100042988
554 Ga0070690_100124244
555 Ga0070690_100434231
556 Ga0070670_100052062
557 Ga0070670_100324111
558 Ga0070670_100328098
559 Ga0070666_10256245
560 Ga0070680_100103967
561 Ga0070682_100364975
562 Ga0070682_100447961
563 Ga0068868_100115337
564 Ga0068868_100195697
565 Ga0070660_100009628
566 Ga0070660_100121170
567 Ga0070689_100004395
568 Ga0070689_100027391
569 Ga0070689_100119721
570 Ga0070689_100144549
571 Ga0070689_100214719
572 Ga0070687_100027242
573 Ga0070661_100022206
574 Ga0070668_100023334
575 Ga0070668_100039990
576 Ga0070668_100332475
577 Ga0070668_100376429
578 Ga0070669_100004874
579 Ga0070669_100065915
580 Ga0070669_100118832
581 Ga0070669_100730320
582 Ga0070675_100004347
583 Ga0070675_100038414
584 Ga0070675_100044076
585 Ga0070675_100297793
586 Ga0070671_100201050
587 Ga0070671_100371371
588 Ga0070674_100005813
589 Ga0070674_100140547
590 Ga0070674_100240134
591 Ga0070673_100082668
592 Ga0070673_100298490
593 Ga0070688_100012218
594 Ga0070688_100014669
595 Ga0070688_100070501
596 Ga0070688_100330144
597 Ga0070659_100001243
598 Ga0070667_100145343
599 Ga0070667_100169160
600 Ga0070667_100747204
601 Ga0070703_10114282
602 Ga0070709_10020690
603 Ga0070709_10040059
604 Ga0070709_10190401
605 Ga0070709_10270308
606 Ga0070709_10369538
607 Ga0070714_100073859
608 Ga0070714_100117562
609 Ga0070714_100396569
610 Ga0070713_100020857
611 Ga0070713_100035359
612 Ga0070713_100206866
613 Ga0070713_100352526
614 Ga0070713_100611951
615 Ga0070710_10263698
616 Ga0070711_100012914
617 Ga0070711_100094373
618 Ga0070711_100098162
619 Ga0070711_100106065
620 Ga0070705_100013033
621 Ga0070705_100015251
622 Ga0070705_100096773
623 Ga0070700_100012411
624 Ga0070694_100226277
625 Ga0070708_100076772
626 Ga0070708_100206563
627 Ga0070708_100411990
628 Ga0070708_100552043
629 Ga0070708_100596172
630 Ga0070663_100013239
631 Ga0070663_100333713
632 Ga0070678_100039234
633 Ga0070662_100020088
634 Ga0070662_100087776
635 Ga0070681_10015782
636 Ga0068867_100720909
637 Ga0070685_10097512
638 Ga0070706_100002784
639 Ga0070706_100005741
640 Ga0070706_100006694
641 Ga0070706_100010362
642 Ga0070706_100011262
643 Ga0070706_100041054
644 Ga0070706_100048492
645 Ga0070706_100079355
646 Ga0070706_100113546
647 Ga0070706_100169047
648 Ga0070707_100000711
649 Ga0070707_100005281
650 Ga0070707_100016033
651 Ga0070707_100029038
652 Ga0070707_100228934
653 Ga0070707_100302409
654 Ga0070707_100413543
655 Ga0070707_100419043
656 Ga0070707_100491439
657 Ga0070707_100697336
658 Ga0070698_100018927
659 Ga0070698_100024372
660 Ga0070698_100138302
661 Ga0070698_100149394
662 Ga0070699_100055227
663 Ga0070699_100152582
664 Ga0070679_100243253
665 Ga0070684_100000223
666 Ga0070684_100019581
667 Ga0070684_100023677
668 Ga0070684_100211264
669 Ga0070697_100058453
670 Ga0070697_100063092
671 Ga0070697_100064942
672 Ga0070697_100149265
673 Ga0070697_100153916
674 Ga0070697_100156528
675 Ga0070697_100243682
676 Ga0070697_100263339
677 Ga0070672_100010024
678 Ga0070686_100173804
679 Ga0070686_100187870
680 Ga0070686_100238351
681 Ga0070665_100045086
682 Ga0070665_100085567
683 Ga0070665_100100490
684 Ga0070665_100131914
685 Ga0070665_100236951
686 Ga0070665_100578805
687 Ga0070704_100003211
688 Ga0070704_100515195
689 Ga0070664_100024005
690 Ga0070664_100052862
691 Ga0068856_100000428
692 Ga0068856_100014395
693 Ga0068859_100020882
694 Ga0068866_10134592
695 Ga0068866_10205506
696 Ga0068863_100012823
697 Ga0068863_100214712
698 Ga0068863_100240874
699 Ga0068858_100016898
700 Ga0068860_100004814
701 Ga0068860_100025112
702 Ga0081455_10001020
703 Ga0081455_10001318
704 Ga0081455_10006255
705 Ga0081455_10006792
706 Ga0081455_10012135
707 Ga0081455_10120097
708 Ga0081455_10175160
709 Ga0081540_1000031
710 Ga0081540_1051594
711 Ga0081540_1072738
712 Ga0081539_10000383
713 Ga0081539_10012397
714 Ga0081539_10056959
715 Ga0070717_10000233
716 Ga0070717_10000854
717 Ga0070717_10020213
718 Ga0070717_10049241
719 Ga0070717_10746776
720 Ga0070717_10850996
721 Ga0070715_10005204
722 Ga0070715_10152750
723 Ga0070716_100006007
724 Ga0070716_100130890
725 Ga0070712_100022382
726 Ga0070712_100103095
727 Ga0070712_100192834
728 Ga0097621_100215865
729 Ga0097621_100506822
730 Ga0068871_100073307
731 Ga0068871_100120581
732 Ga0075434_100354653
733 Ga0075436_100323471
734 Ga0097620_100020882
735 Ga0099795_10102995
736 Ga0111539_10396855
737 Ga0111539_10413827
738 Ga0105245_10055745
739 Ga0105245_10334308
740 Ga0105245_10814695
741 Ga0105247_10425392
742 Ga0114129_10018230
743 Ga0105243_10279262
744 Ga0105242_10338025
745 Ga0105248_10554501
746 Ga0105237_10085470
747 Ga0105249_10052005
748 Ga0105249_10090184
749 Ga0105249_10110191
750 Ga0105249_10174406
751 Ga0099796_10028117
752 Ga0105239_10091912
753 Ga0105239_10332627
754 Ga0105239_10713470
755 Ga0105239_10759909
756 Ga0105246_10223376
757 Ga0105246_10380181
758 Ga0157371_10046262
759 Ga0157371_10196254
760 Ga0157370_10191630
761 Ga0157369_10199161
762 Ga0157374_10058431
763 Ga0157374_10106200
764 Ga0157374_10150101
765 Ga0157374_10154891
766 Ga0157374_10204486
767 Ga0157374_10284502
768 Ga0157374_10355837
769 Ga0157374_10623957
770 Ga0157378_10149403
771 Ga0157378_10157235
772 Ga0157378_10280061
773 Ga0157378_10759304
774 Ga0157378_11010661
775 Ga0163162_10040867
776 Ga0163162_10063394
777 Ga0163162_10074572
778 Ga0163162_10243579
779 Ga0163162_10608945
780 Ga0157372_10019497
781 Ga0157372_10034421
782 Ga0157375_10003948
783 Ga0157375_10043363
784 Ga0157375_10064623
785 Ga0157375_10193803
786 Ga0157375_10271843
787 Ga0157375_10884015
788 Ga0157375_11102548
789 Ga0163163_10163839
790 Ga0163163_10269684
791 Ga0157379_10010187
792 Ga0157379_10101030
793 Ga0157376_10022801
794 Ga0157376_10085495
795 Ga0157376_10186193
796 Ga0182006_1027996
797 Ga0163161_10052841
798 Ga0207666_1000306
799 Ga0207666_1002205
800 Ga0207673_1000895
801 Ga0207697_10000663
802 Ga0207697_10000729
803 Ga0207697_10001748
804 Ga0207697_10002124
805 Ga0207697_10004391
806 Ga0207697_10007625
807 Ga0207697_10019882
808 Ga0207697_10024011
809 Ga0207697_10027529
810 Ga0207697_10105035
811 Ga0207697_10112935
812 Ga0207653_10023253
813 Ga0207692_10298855
814 Ga0207692_10527937
815 Ga0207642_10003854
816 Ga0207688_10003473
817 Ga0207688_10079095
818 Ga0207688_10142472
819 Ga0207680_10058032
820 Ga0207680_10136217
821 Ga0207647_10028908
822 Ga0207685_10127948
823 Ga0207699_10108173
824 Ga0207699_10229679
825 Ga0207645_10000666
826 Ga0207645_10002525
827 Ga0207705_10550028
828 Ga0207684_10000617
829 Ga0207684_10001353
830 Ga0207684_10003408
831 Ga0207684_10016647
832 Ga0207684_10048285
833 Ga0207684_10056408
834 Ga0207684_10193943
835 Ga0207693_10002580
836 Ga0207693_10015283
837 Ga0207693_10015619
838 Ga0207693_10037615
839 Ga0207693_10059571
840 Ga0207693_10549608
841 Ga0207663_10005195
842 Ga0207663_10023651
843 Ga0207663_10030586
844 Ga0207663_10084085
845 Ga0207663_10249956
846 Ga0207662_10006734
847 Ga0207662_10112917
848 Ga0207657_10019676
849 Ga0207657_10204425
850 Ga0207657_10234428
851 Ga0207649_10072671
852 Ga0207646_10000413
853 Ga0207646_10008068
854 Ga0207646_10050467
855 Ga0207646_10118080
856 Ga0207646_10257453
857 Ga0207646_10266514
858 Ga0207646_10533938
859 Ga0207646_10552201
860 Ga0207646_10567169
861 Ga0207646_10599794
862 Ga0207646_10604527
863 Ga0207681_10001007
864 Ga0207681_10017735
865 Ga0207650_10065276
866 Ga0207650_10331674
867 Ga0207650_10529540
868 Ga0207659_10049433
869 Ga0207659_10079036
870 Ga0207659_10268284
871 Ga0207700_10128997
872 Ga0207700_10449618
873 Ga0207664_10045600
874 Ga0207644_10309997
875 Ga0207690_10005910
876 Ga0207706_10006566
877 Ga0207706_10007277
878 Ga0207706_10013350
879 Ga0207706_10094358
880 Ga0207686_10247229
881 Ga0207670_10001997
882 Ga0207670_10293784
883 Ga0207670_10370704
884 Ga0207669_10079384
885 Ga0207704_10157509
886 Ga0207704_10779093
887 Ga0207665_10005860
888 Ga0207665_10012762
889 Ga0207665_10098441
890 Ga0207665_10104899
891 Ga0207665_10322849
892 Ga0207691_10003575
893 Ga0207711_10506918
894 Ga0207689_10043421
895 Ga0207661_10009171
896 Ga0207661_10255787
897 Ga0207679_10247225
898 Ga0207679_10364384
899 Ga0207651_10085378
900 Ga0207651_10175019
901 Ga0207712_10437684
902 Ga0207668_10028007
903 Ga0207658_10182619
904 Ga0207658_10268942
905 Ga0207677_10205063
906 Ga0207677_10305103
907 Ga0207677_10395259
908 Ga0207639_10868770
909 Ga0207678_10005675
910 Ga0207678_10350478
911 Ga0207708_10014985
912 Ga0207702_10002165
913 Ga0207702_10557733
914 Ga0207641_10136583
915 Ga0207641_10299955
916 Ga0207648_10589353
917 Ga0207675_100336530
918 Ga0207683_10003940
919 Ga0209179_1017260
920 Ga0207428_10096359
921 Ga0268266_10317364
922 Ga0268265_10099260
923 Ga0268264_10014613
924 Ga0373934_0054636
925 Ga0373944_0075714
926 Ga0373945_0018943
927 Ga0373953_0183623
928 Ga0373954_0062020
929 Ga0373943_0056115
930 Ga0373946_0015242
931 Ga0373955_0030174
932 Ga0373931_0082135
933 Ga0373935_0339498
934 Ga0373933_0273589
935 Ga0373947_0004849
936 Ga0373947_0108661
937 Ga0373947_0154057
938 Ga0373947_0603255
939 Ga0373937_0018202
940 Ga0373937_0203111
941 Ga0373925_0073992
942 Ga0373925_0190174
943 Ga0395899_0000045
944 Ga0395900_0167763
945 Ga0395900_0301913
946 Ga0395900_0475426
947 Ga0395898_0000541
948 Ga0395898_0221797
949 Ga0395905_0013858
950 Ga0395905_0830425
951 Ga0395901_0000676
952 Ga0395901_0047449
953 Ga0451807_2498897
954 Ga0451853_1675534
955 Ga0439464_0052211
956 Ga0466957_0007326
957 Ga0451576_0093242
958 Ga0495592_0053767
959 Ga0495629_0038735
960 Ga0495641_0111767
961 Ga0495580_0397772
962 Ga0495639_0104781
963 Ga0495662_0157203
964 Ga0495584_0181967
965 Ga0495608_0369623
966 Ga0495628_0017112
967 Ga0495666_0076569
968 Ga0495666_0310171
969 Ga0495652_0010639
970 Ga0495640_0368743
971 Ga0495586_0349204
972 Ga0495587_0007319
973 Ga0495598_0035351
974 Ga0495645_0002319
975 Ga0495645_0252109
976 Ga0495633_0138873
977 Ga0495634_0170705
978 Ga0495634_0298968
979 Ga0495635_0139293
980 Ga0495657_0131257
981 Ga0495599_0006610
982 Ga0495623_0002872
983 Ga0495646_0003663
984 Ga0495658_0211694
985 Ga0495669_0028913
986 Ga0495624_0052062
987 Ga0495649_0348467
988 Ga0495604_0008020
989 Ga0495674_0039609
990 Ga0495674_0619924
991 Ga0495680_0107145
992 Ga0495680_0232213
993 Ga0495675_0006025
994 Ga0495684_0004138
995 Ga0495602_0015247
996 Ga0495602_0179950
997 Ga0496100_0009777
998 Ga0496100_0071857
999 Ga0496101_0059625
1000 Ga0496101_0122486
1001 Ga0496101_0398997
1002 Ga0496102_0003599
1003 Ga0496102_0726486
1004 Ga0496103_0015786
1005 Ga0496104_0086200
1006 Ga0496104_0187928
1007 Ga0496104_0276672
1008 Ga0496104_0405081
1009 Ga0496105_0080987
1010 Ga0496105_0127039
1011 Ga0496106_0001475
1012 Ga0496106_0030851
1013 Ga0496106_0049760
1014 Ga0496107_0002749
1015 Ga0496107_0078341
1016 Ga0496107_0149441
1017 Ga0496108_0045140
1018 Ga0496108_0128303
1019 Ga0496108_0467318
1020 Ga0496109_0044293
1021 Ga0496109_0150639
1022 Ga0496109_0204651
1023 Ga0496109_0246954
1024 Ga0496109_0285334
1025 Ga0496109_0295610
1026 Ga0496109_0369369
1027 Ga0496109_0522831
1028 Ga0496109_0669961
1029 Ga0496110_0091663
1030 Ga0496110_0434817
1031 Ga0496110_0562097
1032 Ga0496112_0030701
1033 Ga0496112_0034647
1034 Ga0496112_0040038
1035 Ga0496112_0139472
1036 Ga0496112_0172685
1037 Ga0496113_0354086
1038 Ga0496113_0549527
1039 Ga0496114_0013493
1040 Ga0496114_0045562
1041 Ga0496114_0146646
1042 Ga0496115_0015882
1043 Ga0496115_0028531
1044 Ga0496115_0033778
1045 Ga0496115_0091658
1046 nmdc:mga05p37_50135_c1
1047 nmdc:mga05p37_50749_c1
1048 nmdc:mga08y16_181812_c1
1049 nmdc:mga08x19_271856_c1
1050 nmdc:mga0a205_241171_c1
1051 Ga0495601_0024707
1052 Ga0495612_0009336
1053 Ga0495619_0154719
1054 Ga0495619_0440256

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lm2-assembly1.cif.gz_B crystal structure of putative kinase. (17743352) from agrobacterium tumefaciens str. c58 (dupont) at 1.70 a resolution 0.9476 2 218
3lm2-assembly1.cif.gz_B crystal structure of putative kinase. (17743352) from agrobacterium tumefaciens str. c58 (dupont) at 1.70 a resolution 0.9229 2 218
4gw3-assembly1.cif.gz_A crystal structure of the lipase from proteus mirabilis 0.8427 160 187
3vgk-assembly2.cif.gz_B crystal structure of a rok family glucokinase from streptomyces griseus 0.8282 5 211
1woq-assembly2.cif.gz_B crystal structure of inorganic polyphosphate/atp-glucomannokinase from arthrobacter sp. strain km at 1.8 a resolution 0.8207 2 211
ID Description Score Start End Superfamily
3lm2B01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.923 2 95 3.30.420.40
3lm2B01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9133 2 95 3.30.420.40
3lm2B02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9106 98 218 3.30.420.40
3lm2B02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8618 98 218 3.30.420.40
1woqA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7843 96 211 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A2V5SC40-F1-model_v4 Glucose-6-phosphate isomerase 0.9909 1 130 GO:0016853
AF-A0A2V5NK37-F1-model_v4 ROK family protein 0.9905 1 229
AF-A0A2V6BL09-F1-model_v4 ROK family protein 0.9893 1 229
AF-A0A3C0R2Z3-F1-model_v4 ROK family protein 0.9852 1 188 GO:0003824
AF-A0A2V6BL09-F1-model_v4 ROK family protein 0.985 1 229

Map