F459496

General Info

Members Datasets Scaffolds Average Seq Length
527 280 476 260

Family's Representative Sequence

Representative Sequence 3300001915|JGI24741J21665_1000650|JGI24741J21665_10006503
Length 269
Sequence MRVATWNVNSLKVRLPHVLQWLGEREADATPIDLLCLQELKLPDDRYPLAELDAAGYASLFTGQKTYNGVAILARKASVPEGRDVVKNIPGFADEQQRIVAATYDVDGGPVRVISAYIPNGQALDSDKFVYKLRWLEALQAWLTSEMAANPRLMLLGDFNIAPEDRDVHDPKKWEGQNLVSPEERAAFRAMQGAGLVDAFRMFEQEDKLFSWWDYRMFGFKRNAGLRIDHIMLSPELAKLCESCHIDRVPRTWEQPSDHTPVVAALRRA

Samples

Sample ID Description Type Environment
1 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
2 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
3 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
4 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
5 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
6 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
7 2547132512 Azospira oryzae 6a3 Isolate Unclassified
8 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
9 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
10 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
11 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
12 2643221683 Variovorax sp. Root473 Isolate Unclassified
13 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
14 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
15 2738541277 Variovorax sp. GV051 Isolate Unclassified
16 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
17 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
18 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
19 2738541307 Variovorax sp. GV008 Isolate Unclassified
20 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
21 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
22 2738543012 Acidovorax sp. CF301 Isolate Unclassified
23 2738543019 Variovorax sp. GV040 Isolate Unclassified
24 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
25 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
26 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
27 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
28 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
29 2816332133 Acidovorax radicis 2721A Isolate Unclassified
30 2818991450 Burkholderia sp. 604 Isolate Unclassified
31 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
32 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
33 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
34 2885266251 Ralstonia sp. SET104 Isolate Nodule
35 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
36 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
37 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
38 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
39 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
40 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
41 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
42 2928058823 Ralstonia sp. 1138 Isolate Unclassified
43 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
44 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
45 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
46 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
47 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
48 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
49 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
50 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
51 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
52 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
53 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
54 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
55 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
56 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
57 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
58 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
59 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
60 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
61 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
62 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
63 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
64 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
65 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
66 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
67 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
68 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
69 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
70 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
71 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
72 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
73 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
74 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
77 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
108 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
118 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
119 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
122 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
123 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
153 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
167 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
168 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
169 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
172 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
173 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
186 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
196 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
200 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
201 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
208 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
209 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
210 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
224 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
225 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
226 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
227 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
228 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
231 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
232 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
233 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
234 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
235 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
236 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
237 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
240 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
241 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
242 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
243 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
244 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
245 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
246 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
249 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
250 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
251 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
263 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
264 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
265 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
266 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
267 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
270 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
271 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
272 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
273 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
276 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
277 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
278 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
279 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
280 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.94
Metatranscriptomes 0.38
Isolates 9.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.82
Nodule 2.66
Rhizoplane 3.61
Rhizosphere 70.97
Stem 0
Stem Tuber 0
Unclassified 11.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000650 3300001915 Bacteria 10493
2 JGI24740J21852_10000469 3300001979 Bacteria 17361
3 JGI24740J21852_10002835 3300001979 Bacteria 7747
4 JGI24739J22299_10003178 3300001989 Bacteria 6270
5 JGI24739J22299_10006762 3300001989 Bacteria 4318
6 JGI24735J21928_10000615 3300002067 Bacteria 12551
7 JGI24735J21928_10001919 3300002067 Bacteria 7294
8 JGI24735J21928_10024451 3300002067 Bacteria 1827
9 JGI24738J21930_10003908 3300002075 Bacteria 3718
10 JGI25156J39149_1000894 3300002705 Bacteria 14680
11 JGI25156J39149_1000919 3300002705 Bacteria 14355
12 JGI25156J39149_1007996 3300002705 Bacteria 2709
13 JGI25154J39366_1001286 3300002738 Bacteria 9344
14 JGI25165J46597_1002044 3300003214 Bacteria 7627
15 rootH1_10106529 3300003323 Bacteria 2971
16 JGI25160J50197_1000250 3300003354 Bacteria 41522
17 Ga0055538_1004763 3300003751 Bacteria 1482
18 Ga0055538_1006167 3300003751 Bacteria 1181
19 Ga0055539_1000062 3300003752 Bacteria 141171
20 Ga0055539_1007246 3300003752 Bacteria 1406
21 Ga0055533_1000462 3300003756 Bacteria 15413
22 Ga0055533_1005466 3300003756 Bacteria 2032
23 Ga0055533_1005773 3300003756 Bacteria 1931
24 Ga0055532_1000001 3300003758 Bacteria 1119836
25 Ga0055532_1000019 3300003758 Bacteria 286358
26 Ga0055525_1000558 3300003759 Bacteria 17026
27 Ga0055527_1000002 3300003760 Bacteria 830488
28 Ga0055527_1002617 3300003760 Bacteria 2953
29 Ga0055535_1000001 3300003761 Bacteria 1119836
30 Ga0055535_1000014 3300003761 Bacteria 286358
31 Ga0055542_1000001 3300003762 Bacteria 1119836
32 Ga0055542_1000412 3300003762 Bacteria 41756
33 Ga0055529_1000001 3300003763 Bacteria 826680
34 Ga0055529_1000086 3300003763 Bacteria 140681
35 Ga0055529_1000368 3300003763 Bacteria 48910
36 Ga0055541_1007038 3300003841 Bacteria 1872
37 Ga0065165_1000822 3300005262 Bacteria 41049
38 Ga0068869_100105067 3300005334 Bacteria 2141
39 Ga0070680_100024271 3300005336 Bacteria 4840
40 Ga0070660_100001673 3300005339 Bacteria 15224
41 Ga0070660_100147007 3300005339 Bacteria 1894
42 Ga0070689_100058242 3300005340 Bacteria 3000
43 Ga0070661_100000088 3300005344 Bacteria 73636
44 Ga0070659_100000423 3300005366 Bacteria 32124
45 Ga0070663_100000010 3300005455 Bacteria 158193
46 Ga0070681_10009373 3300005458 Bacteria 9632
47 Ga0070681_10074534 3300005458 Bacteria 3355
48 Ga0070679_100014192 3300005530 Bacteria 7644
49 Ga0068855_100016740 3300005563 Bacteria 8817
50 Ga0068855_100063667 3300005563 Bacteria 4303
51 Ga0070664_100000005 3300005564 Bacteria 222746
52 Ga0068854_100000104 3300005578 Bacteria 58909
53 Ga0068856_100000054 3300005614 Bacteria 104246
54 Ga0068856_100429553 3300005614 Bacteria 1341
55 Ga0070702_100139019 3300005615 Bacteria 1545
56 Ga0068852_100480857 3300005616 Bacteria 1234
57 Ga0068864_100239946 3300005618 Bacteria 1679
58 Ga0068863_100015913 3300005841 Bacteria 7215
59 Ga0075365_10162544 3300006038 Bacteria 1556
60 Ga0105240_10038630 3300009093 Bacteria 6121
61 Ga0105240_10078506 3300009093 Bacteria 4065
62 Ga0111539_10091536 3300009094 Bacteria 3573
63 Ga0105243_10468330 3300009148 Bacteria 1186
64 Ga0105241_10107242 3300009174 Bacteria 2231
65 Ga0105242_10001274 3300009176 Bacteria 19915
66 Ga0105248_10082002 3300009177 Bacteria 3626
67 Ga0105237_10004592 3300009545 Bacteria 15941
68 Ga0105239_10008889 3300010375 Bacteria 11371
69 Ga0105239_10015751 3300010375 Bacteria 8368
70 Ga0105239_10370714 3300010375 Bacteria 1618
71 Ga0105239_10671649 3300010375 Bacteria 1184
72 Ga0157373_10013913 3300013100 Bacteria 5901
73 Ga0157373_10075869 3300013100 Bacteria 2372
74 Ga0157371_10000103 3300013102 Bacteria 128611
75 Ga0157371_10042380 3300013102 Bacteria 3244
76 Ga0157370_10000513 3300013104 Bacteria 48371
77 Ga0157370_10001169 3300013104 Bacteria 32704
78 Ga0157370_10003999 3300013104 Bacteria 17130
79 Ga0157370_10024480 3300013104 Bacteria 5980
80 Ga0157369_10000192 3300013105 Bacteria 84935
81 Ga0157369_10002526 3300013105 Bacteria 21873
82 Ga0157369_10005824 3300013105 Bacteria 14331
83 Ga0157369_10023154 3300013105 Bacteria 6920
84 Ga0157374_10000032 3300013296 Bacteria 202485
85 Ga0157378_10329647 3300013297 Bacteria 1485
86 Ga0157378_10463535 3300013297 Bacteria 1259
87 Ga0157372_10000461 3300013307 Bacteria 44748
88 Ga0157372_10004003 3300013307 Bacteria 15806
89 Ga0163163_10013823 3300014325 Bacteria 7404
90 Ga0157379_10282390 3300014968 Bacteria 1511
91 Ga0157376_10038191 3300014969 Bacteria 3905
92 Ga0182006_1001742 3300015261 Bacteria 12625
93 Ga0182007_10003207 3300015262 Bacteria 7801
94 Ga0182007_10008356 3300015262 Bacteria 4258
95 Ga0183361_10006 3300016635 Bacteria 368532
96 Ga0206351_10215564 3300020077 Bacteria 22084
97 Ga0154015_1028955 3300020610 Bacteria 23352
98 Ga0209784_100003 3300025224 Bacteria 1379451
99 Ga0209784_100390 3300025224 Bacteria 20048
100 Ga0209784_102471 3300025224 Bacteria 1847
101 Ga0209566_100002 3300025225 Bacteria 2614868
102 Ga0209566_100705 3300025225 Bacteria 19240
103 Ga0209674_100005 3300025226 Bacteria 1708125
104 Ga0209674_100094 3300025226 Bacteria 169506
105 Ga0209674_100363 3300025226 Bacteria 25583
106 Ga0209674_100466 3300025226 Bacteria 17863
107 Ga0209674_102637 3300025226 Bacteria 3726
108 Ga0209672_100001 3300025228 Bacteria 2828210
109 Ga0209672_100408 3300025228 Bacteria 25493
110 Ga0209672_100712 3300025228 Bacteria 16491
111 Ga0209147_100001 3300025229 Bacteria 2384371
112 Ga0209147_100002 3300025229 Bacteria 2158988
113 Ga0209563_100004 3300025230 Bacteria 1814108
114 Ga0209563_100287 3300025230 Bacteria 21091
115 Ga0209258_100001 3300025242 Bacteria 2384269
116 Ga0209258_100002 3300025242 Bacteria 2158988
117 Ga0209646_1000019 3300025246 Bacteria 475248
118 Ga0209026_1003559 3300025250 Bacteria 5037
119 Ga0209677_100009 3300025253 Bacteria 749530
120 Ga0209677_104090 3300025253 Bacteria 4377
121 Ga0209148_1000003 3300025254 Bacteria 2384288
122 Ga0209148_1000471 3300025254 Bacteria 42915
123 Ga0209148_1007995 3300025254 Bacteria 2155
124 Ga0209759_1000070 3300025256 Bacteria 182299
125 Ga0209759_1000152 3300025256 Bacteria 119866
126 Ga0209759_1000405 3300025256 Bacteria 53243
127 Ga0209759_1003435 3300025256 Bacteria 6316
128 Ga0209759_1020490 3300025256 Bacteria 1532
129 Ga0209233_1000016 3300025261 Bacteria 907830
130 Ga0209233_1033798 3300025261 Bacteria 1171
131 Ga0209455_1000001 3300025272 Bacteria 2384278
132 Ga0209455_1000076 3300025272 Bacteria 284092
133 Ga0209025_1000363 3300025294 Bacteria 96763
134 Ga0207426_1000245 3300025302 Bacteria 120041
135 Ga0209051_1015587 3300025303 Bacteria 3487
136 Ga0207713_1000456 3300025735 Bacteria 42841
137 Ga0207647_10000305 3300025904 Bacteria 40501
138 Ga0207647_10010542 3300025904 Bacteria 6523
139 Ga0207647_10016476 3300025904 Bacteria 5045
140 Ga0207705_10000972 3300025909 Bacteria 23447
141 Ga0207654_10353612 3300025911 Bacteria 1012
142 Ga0207707_10053191 3300025912 Bacteria 3525
143 Ga0207707_10211655 3300025912 Bacteria 1688
144 Ga0207695_10002145 3300025913 Bacteria 29897
145 Ga0207695_10008698 3300025913 Bacteria 12664
146 Ga0207695_10122450 3300025913 Bacteria 2567
147 Ga0207695_10122834 3300025913 Bacteria 2562
148 Ga0207671_10010185 3300025914 Bacteria 7784
149 Ga0207657_10007200 3300025919 Bacteria 11421
150 Ga0207649_10000098 3300025920 Bacteria 71539
151 Ga0207652_10008086 3300025921 Bacteria 8443
152 Ga0207690_10036478 3300025932 Bacteria 3184
153 Ga0207670_10024627 3300025936 Bacteria 3764
154 Ga0207711_10017665 3300025941 Bacteria 5925
155 Ga0207679_10000020 3300025945 Bacteria 225727
156 Ga0207667_10000448 3300025949 Bacteria 55202
157 Ga0207667_10021598 3300025949 Bacteria 7131
158 Ga0207667_10084360 3300025949 Bacteria 3289
159 Ga0207640_10000092 3300025981 Bacteria 71354
160 Ga0207678_10000181 3300026067 Bacteria 53999
161 Ga0207708_10209419 3300026075 Bacteria 1558
162 Ga0207702_10000017 3300026078 Bacteria 222964
163 Ga0207641_10027465 3300026088 Bacteria 4700
164 Ga0207676_10269211 3300026095 Bacteria 1542
165 Ga0207674_10008405 3300026116 Bacteria 11931
166 Ga0207674_10085591 3300026116 Bacteria 3147
167 Ga0207698_10429571 3300026142 Bacteria 1270
168 Ga0209371_1009439 3300027312 Bacteria 3103
169 Ga0207428_10006964 3300027907 Bacteria 10363
170 Ga0268256_1009997 3300030500 Bacteria 3103
171 Ga0265332_10000004 3300031238 Bacteria 426592
172 Ga0265327_10003283 3300031251 Bacteria 15666
173 Ga0307408_100013099 3300031548 Bacteria 5505
174 Ga0316575_10000325 3300031665 Bacteria 13470
175 Ga0316575_10020733 3300031665 Bacteria 2524
176 Ga0307412_10000008 3300031911 Bacteria 461034
177 Ga0307412_10098208 3300031911 Bacteria 2065
178 Ga0307416_100222073 3300032002 Bacteria 1813
179 Ga0316574_0080128 3300035398 Bacteria 2072
180 Ga0373933_0066420 3300035724 Bacteria 2186
181 Ga0395899_0000007 3300037312 Bacteria 629129
182 Ga0395899_0046728 3300037312 Bacteria 3224
183 Ga0395899_0064961 3300037312 Bacteria 2682
184 Ga0395899_0298860 3300037312 Bacteria 1090
185 Ga0395900_0000066 3300037418 Bacteria 194825
186 Ga0395900_0000184 3300037418 Bacteria 100526
187 Ga0395900_0012088 3300037418 Bacteria 8823
188 Ga0395900_0174135 3300037418 Bacteria 2189
189 Ga0395900_0566207 3300037418 Bacteria 1079
190 Ga0395898_0000225 3300037466 Bacteria 144962
191 Ga0395898_0000379 3300037466 Bacteria 97300
192 Ga0395898_0004860 3300037466 Bacteria 14589
193 Ga0395898_0021917 3300037466 Bacteria 6471
194 Ga0395898_0107669 3300037466 Bacteria 2673
195 Ga0395905_0000050 3300037471 Bacteria 223801
196 Ga0395901_0000067 3300038443 Bacteria 144966
197 Ga0395901_0000080 3300038443 Bacteria 134397
198 Ga0395901_0033584 3300038443 Bacteria 5297
199 Ga0395901_0126012 3300038443 Bacteria 2691
200 Ga0395901_0181626 3300038443 Bacteria 2207
201 Ga0439443_015624 3300042003 Bacteria 1153
202 Ga0439448_0000214 3300042005 Bacteria 12157
203 Ga0439455_0026744 3300042012 Bacteria 1410
204 Ga0439460_0002714 3300042461 Bacteria 4267
205 Ga0451577_0581250 3300042876 Bacteria 1017
206 Ga0466972_0000231 3300044658 Bacteria 38797
207 Ga0466972_0026718 3300044658 Bacteria 2860
208 Ga0466972_0033367 3300044658 Bacteria 2524
209 Ga0453683_0209021 3300044673 Bacteria 1240
210 Ga0466965_0116040 3300044683 Bacteria 1379
211 Ga0466966_0000067 3300044684 Bacteria 69077
212 Ga0466966_0019267 3300044684 Bacteria 4491
213 Ga0466966_0102627 3300044684 Bacteria 1768
214 Ga0466961_0000898 3300044693 Bacteria 18482
215 Ga0466961_0006434 3300044693 Bacteria 7458
216 Ga0466963_0012458 3300044694 Bacteria 5205
217 Ga0466963_0022134 3300044694 Bacteria 4022
218 Ga0466971_0005498 3300044719 Bacteria 5502
219 Ga0466970_0001921 3300044765 Bacteria 10043
220 Ga0466957_0017841 3300044842 Bacteria 4163
221 Ga0466957_0063013 3300044842 Bacteria 2278
222 Ga0466957_0098057 3300044842 Bacteria 1844
223 Ga0451576_0011396 3300045051 Bacteria 10105
224 Ga0466958_0025478 3300045836 Bacteria 3488
225 Ga0466967_0048324 3300045976 Bacteria 3714
226 Ga0495592_0024468 3300046454 Bacteria 4589
227 Ga0495592_0225857 3300046454 Bacteria 1249
228 Ga0495603_0016783 3300046455 Bacteria 4429
229 Ga0495590_0021567 3300046457 Bacteria 2282
230 Ga0495591_007495 3300046458 Bacteria 4630
231 Ga0495629_0001195 3300046459 Bacteria 20454
232 Ga0495629_0001984 3300046459 Bacteria 15950
233 Ga0495629_0004009 3300046459 Bacteria 11066
234 Ga0495629_0009728 3300046459 Bacteria 7021
235 Ga0495629_0060950 3300046459 Bacteria 2636
236 Ga0495629_0176534 3300046459 Bacteria 1481
237 Ga0495638_0004759 3300046460 Bacteria 10241
238 Ga0495641_0017308 3300046461 Bacteria 3759
239 Ga0495651_0004068 3300046462 Bacteria 11177
240 Ga0495651_0120114 3300046462 Bacteria 1932
241 Ga0495653_0008004 3300046463 Bacteria 8656
242 Ga0495653_0036721 3300046463 Bacteria 3856
243 Ga0495653_0062987 3300046463 Bacteria 2800
244 Ga0495653_0146129 3300046463 Bacteria 1656
245 Ga0495650_0007174 3300046471 Bacteria 6758
246 Ga0495650_0011690 3300046471 Bacteria 4781
247 Ga0495650_0019609 3300046471 Bacteria 3320
248 Ga0495580_0003076 3300046472 Bacteria 14291
249 Ga0495580_0005530 3300046472 Bacteria 10427
250 Ga0495580_0006238 3300046472 Bacteria 9745
251 Ga0495580_0006566 3300046472 Bacteria 9457
252 Ga0495580_0011471 3300046472 Bacteria 6856
253 Ga0495580_0020606 3300046472 Bacteria 4878
254 Ga0495580_0029625 3300046472 Bacteria 3971
255 Ga0495582_0009978 3300046473 Bacteria 5227
256 Ga0495582_0081044 3300046473 Bacteria 1802
257 Ga0495582_0133406 3300046473 Bacteria 1404
258 Ga0495605_0007351 3300046474 Bacteria 6254
259 Ga0495605_0009933 3300046474 Bacteria 5333
260 Ga0495605_0110333 3300046474 Bacteria 1256
261 Ga0495662_0024276 3300046476 Bacteria 2925
262 Ga0495664_0001020 3300046477 Bacteria 14490
263 Ga0495664_0046626 3300046477 Bacteria 2571
264 Ga0495664_0094496 3300046477 Bacteria 1799
265 Ga0495664_0228452 3300046477 Bacteria 1126
266 Ga0495594_0113910 3300046499 Bacteria 1526
267 Ga0495596_0003921 3300046500 Bacteria 7375
268 Ga0495596_0012590 3300046500 Bacteria 3616
269 Ga0495596_0048852 3300046500 Bacteria 1659
270 Ga0495583_0096710 3300046506 Bacteria 1264
271 Ga0495606_0011943 3300046507 Bacteria 7020
272 Ga0495606_0017569 3300046507 Bacteria 5400
273 Ga0495606_0159306 3300046507 Bacteria 1318
274 Ga0495608_0001577 3300046511 Bacteria 16304
275 Ga0495608_0008216 3300046511 Bacteria 7328
276 Ga0495608_0102830 3300046511 Bacteria 1841
277 Ga0495610_0007545 3300046512 Bacteria 7208
278 Ga0495618_0008344 3300046514 Bacteria 6270
279 Ga0495618_0013935 3300046514 Bacteria 4893
280 Ga0495618_0015105 3300046514 Bacteria 4710
281 Ga0495618_0020277 3300046514 Bacteria 4092
282 Ga0495628_0004664 3300046516 Bacteria 12092
283 Ga0495628_0011712 3300046516 Bacteria 7406
284 Ga0495628_0035850 3300046516 Bacteria 3984
285 Ga0495628_0226036 3300046516 Bacteria 1404
286 Ga0495630_0023614 3300046517 Bacteria 4545
287 Ga0495630_0033242 3300046517 Bacteria 3845
288 Ga0495630_0153979 3300046517 Bacteria 1749
289 Ga0495630_0174647 3300046517 Bacteria 1638
290 Ga0495630_0458051 3300046517 Bacteria 977
291 Ga0495631_0096595 3300046518 Bacteria 1272
292 Ga0495648_0013350 3300046524 Bacteria 6080
293 Ga0495648_0021806 3300046524 Bacteria 4427
294 Ga0495648_0022305 3300046524 Bacteria 4362
295 Ga0495666_0001310 3300046526 Bacteria 12027
296 Ga0495666_0006198 3300046526 Bacteria 6019
297 Ga0495666_0028413 3300046526 Bacteria 2751
298 Ga0495666_0089274 3300046526 Bacteria 1455
299 Ga0495642_0022592 3300046528 Bacteria 2479
300 Ga0495642_0044179 3300046528 Bacteria 1818
301 Ga0495652_0026861 3300046529 Bacteria 5078
302 Ga0495652_0047759 3300046529 Bacteria 3670
303 Ga0495652_0103776 3300046529 Bacteria 2301
304 Ga0495652_0476373 3300046529 Bacteria 869
305 Ga0495654_0018434 3300046530 Bacteria 3658
306 Ga0495665_0005411 3300046531 Bacteria 6883
307 Ga0495665_0016383 3300046531 Bacteria 3994
308 Ga0495665_0052901 3300046531 Bacteria 2148
309 Ga0495640_0001001 3300046533 Bacteria 21868
310 Ga0495640_0001884 3300046533 Bacteria 16688
311 Ga0495640_0038598 3300046533 Bacteria 3358
312 Ga0495640_0047151 3300046533 Bacteria 2982
313 Ga0495640_0222850 3300046533 Bacteria 1189
314 Ga0495586_0005896 3300046535 Bacteria 6551
315 Ga0495586_0009465 3300046535 Bacteria 5186
316 Ga0495586_0048548 3300046535 Bacteria 2294
317 Ga0495587_0003036 3300046536 Bacteria 11212
318 Ga0495587_0010493 3300046536 Bacteria 5891
319 Ga0495587_0132172 3300046536 Bacteria 1426
320 Ga0495645_0005495 3300046543 Bacteria 8708
321 Ga0495645_0024351 3300046543 Bacteria 4391
322 Ga0495645_0219889 3300046543 Bacteria 1278
323 Ga0495645_0248947 3300046543 Bacteria 1182
324 Ga0495622_0000331 3300046557 Bacteria 34610
325 Ga0495622_0012713 3300046557 Bacteria 3902
326 Ga0495667_0110790 3300046559 Bacteria 1773
327 Ga0495634_0007037 3300046642 Bacteria 8484
328 Ga0495634_0014354 3300046642 Bacteria 5715
329 Ga0495634_0015707 3300046642 Bacteria 5429
330 Ga0495634_0016998 3300046642 Bacteria 5196
331 Ga0495625_0080599 3300046660 Bacteria 2267
332 Ga0495635_0001806 3300046663 Bacteria 14463
333 Ga0495635_0008783 3300046663 Bacteria 7055
334 Ga0495661_0015795 3300046665 Bacteria 5027
335 Ga0495661_0024967 3300046665 Bacteria 3867
336 Ga0495661_0190879 3300046665 Bacteria 1079
337 Ga0495588_0049225 3300046674 Bacteria 2167
338 Ga0495588_0317868 3300046674 Bacteria 819
339 Ga0495599_0010717 3300046678 Bacteria 5614
340 Ga0495599_0014815 3300046678 Bacteria 4828
341 Ga0495599_0023523 3300046678 Bacteria 3852
342 Ga0495599_0329728 3300046678 Bacteria 917
343 Ga0495623_0012095 3300046679 Bacteria 5589
344 Ga0495623_0037621 3300046679 Bacteria 3095
345 Ga0495623_0157392 3300046679 Bacteria 1338
346 Ga0495646_0000409 3300046680 Bacteria 22603
347 Ga0495646_0004116 3300046680 Bacteria 9127
348 Ga0495646_0005397 3300046680 Bacteria 8071
349 Ga0495646_0015879 3300046680 Bacteria 4781
350 Ga0495646_0097638 3300046680 Bacteria 1688
351 Ga0495658_0028534 3300046683 Bacteria 3013
352 Ga0495613_0016660 3300046689 Bacteria 5471
353 Ga0495613_0025193 3300046689 Bacteria 4433
354 Ga0495613_0122427 3300046689 Bacteria 1867
355 Ga0495624_0014011 3300046690 Bacteria 5455
356 Ga0495624_0016475 3300046690 Bacteria 4974
357 Ga0495624_0046365 3300046690 Bacteria 2763
358 Ga0495624_0068141 3300046690 Bacteria 2218
359 Ga0495624_0384073 3300046690 Bacteria 843
360 Ga0495671_0055327 3300046692 Bacteria 1965
361 Ga0495649_0003555 3300046694 Bacteria 10467
362 Ga0495649_0151601 3300046694 Bacteria 1217
363 Ga0495589_0002122 3300046794 Bacteria 11184
364 Ga0495600_0004214 3300046809 Bacteria 8584
365 Ga0495600_0004385 3300046809 Bacteria 8442
366 Ga0495600_0040732 3300046809 Bacteria 3026
367 Ga0495581_0004802 3300047315 Bacteria 7816
368 Ga0495581_0007965 3300047315 Bacteria 6136
369 Ga0495581_0011192 3300047315 Bacteria 5186
370 Ga0495581_0016186 3300047315 Bacteria 4335
371 Ga0495581_0061884 3300047315 Bacteria 2163
372 Ga0495604_0007784 3300047317 Bacteria 8485
373 Ga0495604_0016598 3300047317 Bacteria 5887
374 Ga0495604_0022016 3300047317 Bacteria 5087
375 Ga0495604_0071964 3300047317 Bacteria 2614
376 Ga0495636_0001135 3300047318 Bacteria 10039
377 Ga0495636_0001546 3300047318 Bacteria 8759
378 Ga0495674_0010314 3300047319 Bacteria 8846
379 Ga0495674_0019384 3300047319 Bacteria 6313
380 Ga0495674_0043736 3300047319 Bacteria 3984
381 Ga0495674_0060069 3300047319 Bacteria 3317
382 Ga0495674_0063322 3300047319 Bacteria 3217
383 Ga0495674_0117883 3300047319 Bacteria 2245
384 Ga0495674_0176662 3300047319 Bacteria 1779
385 Ga0495672_0008769 3300047320 Bacteria 7409
386 Ga0495672_0120996 3300047320 Bacteria 1391
387 Ga0495676_0003894 3300047321 Bacteria 13569
388 Ga0495676_0019464 3300047321 Bacteria 5970
389 Ga0495676_0119282 3300047321 Bacteria 1922
390 Ga0495680_0002847 3300047322 Bacteria 17381
391 Ga0495680_0008290 3300047322 Bacteria 9462
392 Ga0495680_0010562 3300047322 Bacteria 8237
393 Ga0495683_0001788 3300047323 Bacteria 13558
394 Ga0495683_0005926 3300047323 Bacteria 6716
395 Ga0495683_0007658 3300047323 Bacteria 5813
396 Ga0495683_0020544 3300047323 Bacteria 3405
397 Ga0495687_007581 3300047443 Bacteria 6364
398 Ga0495687_014654 3300047443 Bacteria 4022
399 Ga0495687_070075 3300047443 Bacteria 1409
400 Ga0495675_0001684 3300047444 Bacteria 13253
401 Ga0495675_0019605 3300047444 Bacteria 4296
402 Ga0495675_0023758 3300047444 Bacteria 3906
403 Ga0495675_0062367 3300047444 Bacteria 2360
404 Ga0495679_000033 3300047446 Bacteria 166523
405 Ga0495679_000281 3300047446 Bacteria 42261
406 Ga0495679_004276 3300047446 Bacteria 6630
407 Ga0495673_0004258 3300047469 Bacteria 9031
408 Ga0495684_0102178 3300047471 Bacteria 2167
409 Ga0495593_0008892 3300047673 Bacteria 5828
410 Ga0495593_0009591 3300047673 Bacteria 5621
411 Ga0495593_0012096 3300047673 Bacteria 4941
412 Ga0495593_0030500 3300047673 Bacteria 2951
413 Ga0495593_0045564 3300047673 Bacteria 2340
414 Ga0495602_0034685 3300048088 Bacteria 4715
415 Ga0495602_0050032 3300048088 Bacteria 3737
416 Ga0495602_0067933 3300048088 Bacteria 3063
417 Ga0495602_0106198 3300048088 Bacteria 2292
418 Ga0495602_0138397 3300048088 Bacteria 1930
419 Ga0495614_0000942 3300048089 Bacteria 12346
420 Ga0495614_0001121 3300048089 Bacteria 11500
421 Ga0495614_0004716 3300048089 Bacteria 6149
422 Ga0495626_0011951 3300048091 Bacteria 4570
423 Ga0495626_0058125 3300048091 Bacteria 1768
424 Ga0495626_0088761 3300048091 Bacteria 1362
425 Ga0496100_0009715 3300048903 Bacteria 5413
426 Ga0496100_0090434 3300048903 Bacteria 2087
427 Ga0496101_0001859 3300048904 Bacteria 12744
428 Ga0496101_0067977 3300048904 Bacteria 2603
429 Ga0496102_0001559 3300048905 Bacteria 20226
430 Ga0496102_0017830 3300048905 Bacteria 6225
431 Ga0496102_0271139 3300048905 Bacteria 1600
432 Ga0496103_0000509 3300048906 Bacteria 32057
433 Ga0496103_0003011 3300048906 Bacteria 10393
434 Ga0496104_0053051 3300048907 Bacteria 3830
435 Ga0496105_0073501 3300048908 Bacteria 2824
436 Ga0496106_0000023 3300048909 Bacteria 165457
437 Ga0496112_0061174 3300048915 Bacteria 3712
438 Ga0496114_0011669 3300048917 Bacteria 7028
439 Ga0496114_0155006 3300048917 Bacteria 1989
440 Ga0496115_0006670 3300048918 Bacteria 8470
441 Ga0496115_0058461 3300048918 Bacteria 3103
442 Ga0496116_0026356 3300048919 Bacteria 4255
443 Ga0496116_0177297 3300048919 Bacteria 1146
444 Ga0496117_0001289 3300048920 Bacteria 36936
445 Ga0496117_0034793 3300048920 Bacteria 3790
446 Ga0496117_0081330 3300048920 Bacteria 2126
447 Ga0496117_0120553 3300048920 Bacteria 1612
448 Ga0496117_0167167 3300048920 Bacteria 1281
449 Ga0496118_0001941 3300048921 Bacteria 29286
450 Ga0496118_0002754 3300048921 Bacteria 23079
451 Ga0496118_0006727 3300048921 Bacteria 12527
452 Ga0496118_0019889 3300048921 Bacteria 5980
453 Ga0496118_0030367 3300048921 Bacteria 4512
454 Ga0496119_0244083 3300048922 Bacteria 908
455 Ga0496121_0005142 3300048924 Bacteria 17019
456 Ga0496121_0005516 3300048924 Bacteria 16163
457 Ga0496121_0025054 3300048924 Bacteria 5678
458 Ga0496121_0059667 3300048924 Bacteria 3144
459 Ga0496121_0223429 3300048924 Bacteria 1324
460 Ga0496124_0465463 3300048927 Bacteria 858
461 Ga0496126_0003800 3300048929 Bacteria 18749
462 Ga0496126_0021396 3300048929 Bacteria 6317
463 Ga0496126_0022772 3300048929 Bacteria 6085
464 Ga0496126_0183657 3300048929 Bacteria 1775
465 Ga0496126_0385573 3300048929 Bacteria 1140
466 Ga0496126_0481973 3300048929 Bacteria 994
467 Ga0466983_0265091 3300048986 Bacteria 1324
468 Ga0495678_102669 3300049459 Bacteria 988
469 Ga0495682_0040053 3300049460 Bacteria 1718
470 Ga0501080_0043488 3300049742 Bacteria 4183
471 nmdc:mga0yw44_137474_c1 3300050492 Bacteria 1586
472 nmdc:mga08y16_3916_c1 3300050511 Bacteria 15504
473 Ga0500608_082624 3300053122 Bacteria 1513
474 Ga0466962_0003888 3300061719 Bacteria 7139
475 Ga0466962_0031251 3300061719 Bacteria 2549
476 Ga0466962_0036563 3300061719 Bacteria 2350

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046473 Ga0495582_0133406 Ga0495582_0133406_649_1374 241
2 3300048919 Ga0496116_0177297 Ga0496116_0177297_392_1117 241
3 3300048927 Ga0496124_0465463 Ga0496124_0465463_13_738 241
4 3300046499 Ga0495594_0113910 Ga0495594_0113910_71_817 248
5 iso_pu_bacteria 2547132512 2548847573 251
6 3300005334 Ga0068869_100105067 Ga0068869_1001050672 253
7 3300005340 Ga0070689_100058242 Ga0070689_1000582422 253
8 3300005615 Ga0070702_100139019 Ga0070702_1001390192 253
9 3300025936 Ga0207670_10024627 Ga0207670_100246273 253
10 3300026075 Ga0207708_10209419 Ga0207708_102094192 253
11 3300035724 Ga0373933_0066420 Ga0373933_0066420_1056_1823 253
12 3300042003 Ga0439443_015624 Ga0439443_015624_257_1018 253
13 3300042461 Ga0439460_0002714 Ga0439460_0002714_3250_4011 253
14 3300046463 Ga0495653_0146129 Ga0495653_0146129_352_1119 253
15 3300046511 Ga0495608_0001577 Ga0495608_0001577_866_1633 253
16 3300046514 Ga0495618_0020277 Ga0495618_0020277_470_1237 253
17 3300046516 Ga0495628_0011712 Ga0495628_0011712_1509_2276 253
18 3300046517 Ga0495630_0033242 Ga0495630_0033242_2441_3208 253
19 3300046517 Ga0495630_0174647 Ga0495630_0174647_607_1374 253
20 3300046529 Ga0495652_0103776 Ga0495652_0103776_871_1638 253
21 3300046533 Ga0495640_0001001 Ga0495640_0001001_18959_19726 253
22 3300046535 Ga0495586_0005896 Ga0495586_0005896_893_1660 253
23 3300046536 Ga0495587_0132172 Ga0495587_0132172_242_1009 253
24 3300046543 Ga0495645_0248947 Ga0495645_0248947_389_1156 253
25 3300046642 Ga0495634_0007037 Ga0495634_0007037_3755_4522 253
26 3300046678 Ga0495599_0014815 Ga0495599_0014815_3122_3889 253
27 3300046683 Ga0495658_0028534 Ga0495658_0028534_1612_2379 253
28 3300046689 Ga0495613_0016660 Ga0495613_0016660_1057_1824 253
29 3300046809 Ga0495600_0040732 Ga0495600_0040732_914_1681 253
30 3300047315 Ga0495581_0061884 Ga0495581_0061884_251_1018 253
31 3300047317 Ga0495604_0007784 Ga0495604_0007784_4042_4809 253
32 3300047322 Ga0495680_0002847 Ga0495680_0002847_4028_4795 253
33 3300047673 Ga0495593_0045564 Ga0495593_0045564_822_1589 253
34 3300031665 Ga0316575_10000325 Ga0316575_1000032510 254
35 3300031665 Ga0316575_10020733 Ga0316575_100207332 254
36 3300045051 Ga0451576_0011396 Ga0451576_0011396_2853_3617 254
37 3300047318 Ga0495636_0001135 Ga0495636_0001135_636_1418 254
38 3300048918 Ga0496115_0006670 Ga0496115_0006670_4287_5051 254
39 3300048924 Ga0496121_0025054 Ga0496121_0025054_3924_4784 254
40 iso_pu_bacteria 2508501125 2509129750 254
41 iso_pu_bacteria 2510065045 2510251534 254
42 iso_pu_bacteria 2512047030 2512345488 254
43 iso_pu_bacteria 2513237151 2513960131 254
44 iso_pu_bacteria 2515154122 2515680794 254
45 iso_pu_bacteria 2562617112 2563058856 254
46 iso_pu_bacteria 2600255067 2600812134 254
47 iso_pu_bacteria 2711768613 2713480094 254
48 iso_pu_bacteria 2718217991 2719640648 254
49 iso_pu_bacteria 2738541296 2738818707 254
50 iso_pu_bacteria 2738541298 2738831137 254
51 iso_pu_bacteria 2738541306 2738872664 254
52 iso_pu_bacteria 2738543002 2739184294 254
53 iso_pu_bacteria 2738543008 2739219264 254
54 iso_pu_bacteria 2744054900 2746088669 254
55 iso_pu_bacteria 2751185846 2753569438 254
56 iso_pu_bacteria 2808606384 2808972690 254
57 iso_pu_bacteria 2808606390 2809007672 254
58 iso_pu_bacteria 2808606391 2809014788 254
59 iso_pu_bacteria 2818991450 2819619946 254
60 iso_pu_bacteria 2842324504 2842328597 254
61 iso_pu_bacteria 2842348783 2842352913 254
62 iso_pu_bacteria 2842454564 2842458742 254
63 iso_pu_bacteria 2885270888 2885272948 254
64 iso_pu_bacteria 2900634093 2900634212 254
65 iso_pu_bacteria 2902682994 2902683753 254
66 iso_pu_bacteria 2904483920 2904484537 254
67 iso_pu_bacteria 2919527303 2919531499 254
68 iso_pu_bacteria 2921643360 2921651676 254
69 iso_pu_bacteria 2928108538 2928110563 254
70 iso_pu_bacteria 2928135762 2928140079 254
71 iso_pu_bacteria 2928503688 2928505571 254
72 iso_pu_bacteria 2945934425 2945937407 254
73 iso_pu_bacteria 2990703756 2990705898 254
74 iso_pu_bacteria 641736151 642425554 254
75 iso_pu_bacteria 642555113 642622171 254
76 iso_pu_bacteria 8055266321 8055268990 254
77 iso_pu_bacteria 8055301274 8055302026 254
78 3300005336 Ga0070680_100024271 Ga0070680_1000242713 255
79 3300005458 Ga0070681_10009373 Ga0070681_100093737 255
80 3300005458 Ga0070681_10074534 Ga0070681_100745343 255
81 3300005530 Ga0070679_100014192 Ga0070679_1000141923 255
82 3300005618 Ga0068864_100239946 Ga0068864_1002399462 255
83 3300005841 Ga0068863_100015913 Ga0068863_1000159135 255
84 3300006038 Ga0075365_10162544 Ga0075365_101625442 255
85 3300009148 Ga0105243_10468330 Ga0105243_104683302 255
86 3300009174 Ga0105241_10107242 Ga0105241_101072422 255
87 3300010375 Ga0105239_10015751 Ga0105239_100157518 255
88 3300013297 Ga0157378_10329647 Ga0157378_103296472 255
89 3300014325 Ga0163163_10013823 Ga0163163_100138233 255
90 3300025911 Ga0207654_10353612 Ga0207654_103536122 255
91 3300025912 Ga0207707_10053191 Ga0207707_100531913 255
92 3300025912 Ga0207707_10211655 Ga0207707_102116552 255
93 3300025921 Ga0207652_10008086 Ga0207652_100080868 255
94 3300026088 Ga0207641_10027465 Ga0207641_100274652 255
95 3300026095 Ga0207676_10269211 Ga0207676_102692112 255
96 3300031238 Ga0265332_10000004 Ga0265332_10000004311 255
97 3300031251 Ga0265327_10003283 Ga0265327_100032839 255
98 3300031911 Ga0307412_10098208 Ga0307412_100982082 255
99 3300035398 Ga0316574_0080128 Ga0316574_0080128_1003_1785 255
100 3300044658 Ga0466972_0000231 Ga0466972_0000231_33694_34461 255
101 3300050492 nmdc:mga0yw44_137474_c1 nmdc:mga0yw44_137474_c1_722_1495 255
102 iso_pu_bacteria 2526164713 2527075514 255
103 3300005614 Ga0068856_100429553 Ga0068856_1004295531 256
104 3300009094 Ga0111539_10091536 Ga0111539_100915362 256
105 3300009176 Ga0105242_10001274 Ga0105242_1000127412 256
106 3300010375 Ga0105239_10370714 Ga0105239_103707142 256
107 3300014968 Ga0157379_10282390 Ga0157379_102823902 256
108 3300014969 Ga0157376_10038191 Ga0157376_100381912 256
109 3300025949 Ga0207667_10084360 Ga0207667_100843603 256
110 3300027907 Ga0207428_10006964 Ga0207428_100069647 256
111 3300042876 Ga0451577_0581250 Ga0451577_0581250_98_877 256
112 3300044673 Ga0453683_0209021 Ga0453683_0209021_419_1189 256
113 3300049742 Ga0501080_0043488 Ga0501080_0043488_2717_3490 256
114 3300050511 nmdc:mga08y16_3916_c1 nmdc:mga08y16_3916_c1_7278_8054 256
115 iso_pu_bacteria 2643221683 2644465230 256
116 iso_pu_bacteria 2738541277 2738719693 256
117 iso_pu_bacteria 2738541307 2738879869 256
118 iso_pu_bacteria 2738543012 2739247058 256
119 iso_pu_bacteria 2738543019 2739278892 256
120 iso_pu_bacteria 2816332133 2816474843 256
121 3300001989 JGI24739J22299_10003178 JGI24739J22299_100031784 258
122 3300001989 JGI24739J22299_10006762 JGI24739J22299_100067624 258
123 3300002067 JGI24735J21928_10000615 JGI24735J21928_100006158 258
124 3300002067 JGI24735J21928_10001919 JGI24735J21928_100019196 258
125 3300002067 JGI24735J21928_10024451 JGI24735J21928_100244512 258
126 3300002075 JGI24738J21930_10003908 JGI24738J21930_100039082 258
127 3300002705 JGI25156J39149_1000894 JGI25156J39149_10008949 258
128 3300002705 JGI25156J39149_1000919 JGI25156J39149_10009192 258
129 3300003214 JGI25165J46597_1002044 JGI25165J46597_10020444 258
130 3300003354 JGI25160J50197_1000250 JGI25160J50197_100025015 258
131 3300003756 Ga0055533_1000462 Ga0055533_10004625 258
132 3300003758 Ga0055532_1000001 Ga0055532_1000001384 258
133 3300003760 Ga0055527_1000002 Ga0055527_1000002375 258
134 3300003761 Ga0055535_1000001 Ga0055535_1000001621 258
135 3300003762 Ga0055542_1000001 Ga0055542_1000001383 258
136 3300003763 Ga0055529_1000001 Ga0055529_1000001621 258
137 3300005262 Ga0065165_1000822 Ga0065165_100082218 258
138 3300005339 Ga0070660_100001673 Ga0070660_1000016734 258
139 3300005563 Ga0068855_100016740 Ga0068855_1000167405 258
140 3300005616 Ga0068852_100480857 Ga0068852_1004808572 258
141 3300009177 Ga0105248_10082002 Ga0105248_100820022 258
142 3300009545 Ga0105237_10004592 Ga0105237_100045925 258
143 3300010375 Ga0105239_10008889 Ga0105239_100088893 258
144 3300010375 Ga0105239_10671649 Ga0105239_106716492 258
145 3300013100 Ga0157373_10075869 Ga0157373_100758693 258
146 3300013102 Ga0157371_10042380 Ga0157371_100423802 258
147 3300013104 Ga0157370_10001169 Ga0157370_100011692 258
148 3300013104 Ga0157370_10024480 Ga0157370_100244803 258
149 3300013105 Ga0157369_10000192 Ga0157369_1000019261 258
150 3300013105 Ga0157369_10005824 Ga0157369_1000582414 258
151 3300013105 Ga0157369_10023154 Ga0157369_100231546 258
152 3300013296 Ga0157374_10000032 Ga0157374_10000032121 258
153 3300013297 Ga0157378_10463535 Ga0157378_104635351 258
154 3300013307 Ga0157372_10004003 Ga0157372_100040037 258
155 3300015262 Ga0182007_10003207 Ga0182007_100032075 258
156 3300016635 Ga0183361_10006 Ga0183361_10006323 258
157 3300025226 Ga0209674_100005 Ga0209674_100005749 258
158 3300025228 Ga0209672_100001 Ga0209672_1000011213 258
159 3300025228 Ga0209672_100712 Ga0209672_1007129 258
160 3300025229 Ga0209147_100001 Ga0209147_1000011213 258
161 3300025230 Ga0209563_100287 Ga0209563_10028711 258
162 3300025242 Ga0209258_100001 Ga0209258_1000011213 258
163 3300025254 Ga0209148_1000003 Ga0209148_10000031213 258
164 3300025256 Ga0209759_1000070 Ga0209759_1000070124 258
165 3300025256 Ga0209759_1000405 Ga0209759_100040540 258
166 3300025256 Ga0209759_1020490 Ga0209759_10204903 258
167 3300025261 Ga0209233_1000016 Ga0209233_1000016170 258
168 3300025261 Ga0209233_1033798 Ga0209233_10337982 258
169 3300025272 Ga0209455_1000001 Ga0209455_10000011213 258
170 3300025302 Ga0207426_1000245 Ga0207426_100024530 258
171 3300025735 Ga0207713_1000456 Ga0207713_100045630 258
172 3300025904 Ga0207647_10000305 Ga0207647_1000030510 258
173 3300025904 Ga0207647_10010542 Ga0207647_100105423 258
174 3300025904 Ga0207647_10016476 Ga0207647_100164763 258
175 3300025913 Ga0207695_10008698 Ga0207695_100086984 258
176 3300025913 Ga0207695_10122450 Ga0207695_101224502 258
177 3300025914 Ga0207671_10010185 Ga0207671_100101852 258
178 3300025919 Ga0207657_10007200 Ga0207657_100072007 258
179 3300025941 Ga0207711_10017665 Ga0207711_100176657 258
180 3300025949 Ga0207667_10021598 Ga0207667_100215986 258
181 3300026116 Ga0207674_10085591 Ga0207674_100855913 258
182 3300026142 Ga0207698_10429571 Ga0207698_104295712 258
183 3300027312 Ga0209371_1009439 Ga0209371_10094392 258
184 3300030500 Ga0268256_1009997 Ga0268256_10099973 258
185 3300031548 Ga0307408_100013099 Ga0307408_1000130993 258
186 3300031911 Ga0307412_10000008 Ga0307412_1000000884 258
187 3300032002 Ga0307416_100222073 Ga0307416_1002220733 258
188 3300037312 Ga0395899_0000007 Ga0395899_0000007_94189_94965 258
189 3300037312 Ga0395899_0046728 Ga0395899_0046728_1843_2619 258
190 3300037312 Ga0395899_0064961 Ga0395899_0064961_423_1199 258
191 3300037312 Ga0395899_0298860 Ga0395899_0298860_206_982 258
192 3300037418 Ga0395900_0000066 Ga0395900_0000066_94746_95522 258
193 3300037418 Ga0395900_0000184 Ga0395900_0000184_67105_67881 258
194 3300037418 Ga0395900_0174135 Ga0395900_0174135_1347_2123 258
195 3300037418 Ga0395900_0566207 Ga0395900_0566207_251_1027 258
196 3300037466 Ga0395898_0000225 Ga0395898_0000225_44883_45659 258
197 3300037466 Ga0395898_0000379 Ga0395898_0000379_31434_32210 258
198 3300037466 Ga0395898_0004860 Ga0395898_0004860_9878_10654 258
199 3300037466 Ga0395898_0021917 Ga0395898_0021917_893_1669 258
200 3300037466 Ga0395898_0107669 Ga0395898_0107669_1129_1905 258
201 3300037471 Ga0395905_0000050 Ga0395905_0000050_107339_108115 258
202 3300038443 Ga0395901_0000067 Ga0395901_0000067_82280_83056 258
203 3300038443 Ga0395901_0000080 Ga0395901_0000080_124519_125304 258
204 3300038443 Ga0395901_0033584 Ga0395901_0033584_3753_4529 258
205 3300038443 Ga0395901_0126012 Ga0395901_0126012_1506_2282 258
206 3300038443 Ga0395901_0181626 Ga0395901_0181626_163_951 258
207 3300042005 Ga0439448_0000214 Ga0439448_0000214_3803_4591 258
208 3300042012 Ga0439455_0026744 Ga0439455_0026744_30_818 258
209 3300044658 Ga0466972_0026718 Ga0466972_0026718_628_1404 258
210 3300044684 Ga0466966_0000067 Ga0466966_0000067_38540_39316 258
211 3300044684 Ga0466966_0019267 Ga0466966_0019267_3621_4397 258
212 3300044693 Ga0466961_0006434 Ga0466961_0006434_2382_3158 258
213 3300044694 Ga0466963_0012458 Ga0466963_0012458_3299_4075 258
214 3300044719 Ga0466971_0005498 Ga0466971_0005498_1351_2127 258
215 3300044842 Ga0466957_0017841 Ga0466957_0017841_991_1767 258
216 3300044842 Ga0466957_0063013 Ga0466957_0063013_1056_1832 258
217 3300044842 Ga0466957_0098057 Ga0466957_0098057_652_1515 258
218 3300045836 Ga0466958_0025478 Ga0466958_0025478_1450_2226 258
219 3300046454 Ga0495592_0024468 Ga0495592_0024468_1957_2733 258
220 3300046454 Ga0495592_0225857 Ga0495592_0225857_250_1026 258
221 3300046455 Ga0495603_0016783 Ga0495603_0016783_1232_2008 258
222 3300046457 Ga0495590_0021567 Ga0495590_0021567_434_1210 258
223 3300046458 Ga0495591_007495 Ga0495591_007495_2231_3007 258
224 3300046459 Ga0495629_0001195 Ga0495629_0001195_14362_15138 258
225 3300046459 Ga0495629_0001984 Ga0495629_0001984_869_1711 258
226 3300046459 Ga0495629_0004009 Ga0495629_0004009_4984_5760 258
227 3300046459 Ga0495629_0009728 Ga0495629_0009728_3515_4291 258
228 3300046459 Ga0495629_0060950 Ga0495629_0060950_62_838 258
229 3300046459 Ga0495629_0176534 Ga0495629_0176534_338_1114 258
230 3300046460 Ga0495638_0004759 Ga0495638_0004759_2168_2944 258
231 3300046461 Ga0495641_0017308 Ga0495641_0017308_2348_3124 258
232 3300046462 Ga0495651_0004068 Ga0495651_0004068_3312_4088 258
233 3300046462 Ga0495651_0120114 Ga0495651_0120114_723_1499 258
234 3300046463 Ga0495653_0008004 Ga0495653_0008004_3241_4017 258
235 3300046463 Ga0495653_0036721 Ga0495653_0036721_2450_3226 258
236 3300046463 Ga0495653_0062987 Ga0495653_0062987_1187_1963 258
237 3300046471 Ga0495650_0007174 Ga0495650_0007174_5745_6521 258
238 3300046471 Ga0495650_0011690 Ga0495650_0011690_2200_3042 258
239 3300046471 Ga0495650_0019609 Ga0495650_0019609_1673_2449 258
240 3300046472 Ga0495580_0003076 Ga0495580_0003076_2405_3181 258
241 3300046472 Ga0495580_0005530 Ga0495580_0005530_2284_3060 258
242 3300046472 Ga0495580_0006238 Ga0495580_0006238_3296_4072 258
243 3300046472 Ga0495580_0006566 Ga0495580_0006566_7243_8019 258
244 3300046472 Ga0495580_0011471 Ga0495580_0011471_3129_3905 258
245 3300046472 Ga0495580_0020606 Ga0495580_0020606_2331_3107 258
246 3300046472 Ga0495580_0029625 Ga0495580_0029625_2010_2852 258
247 3300046473 Ga0495582_0009978 Ga0495582_0009978_2650_3426 258
248 3300046473 Ga0495582_0081044 Ga0495582_0081044_712_1488 258
249 3300046474 Ga0495605_0007351 Ga0495605_0007351_4667_5443 258
250 3300046474 Ga0495605_0009933 Ga0495605_0009933_3989_4765 258
251 3300046474 Ga0495605_0110333 Ga0495605_0110333_324_1100 258
252 3300046476 Ga0495662_0024276 Ga0495662_0024276_657_1433 258
253 3300046477 Ga0495664_0001020 Ga0495664_0001020_3378_4154 258
254 3300046477 Ga0495664_0046626 Ga0495664_0046626_295_1071 258
255 3300046477 Ga0495664_0094496 Ga0495664_0094496_696_1472 258
256 3300046477 Ga0495664_0228452 Ga0495664_0228452_56_832 258
257 3300046500 Ga0495596_0003921 Ga0495596_0003921_918_1694 258
258 3300046500 Ga0495596_0012590 Ga0495596_0012590_1447_2223 258
259 3300046500 Ga0495596_0048852 Ga0495596_0048852_654_1430 258
260 3300046506 Ga0495583_0096710 Ga0495583_0096710_53_829 258
261 3300046507 Ga0495606_0011943 Ga0495606_0011943_529_1305 258
262 3300046507 Ga0495606_0017569 Ga0495606_0017569_2337_3113 258
263 3300046507 Ga0495606_0159306 Ga0495606_0159306_478_1254 258
264 3300046511 Ga0495608_0008216 Ga0495608_0008216_1438_2214 258
265 3300046511 Ga0495608_0102830 Ga0495608_0102830_122_898 258
266 3300046512 Ga0495610_0007545 Ga0495610_0007545_524_1300 258
267 3300046514 Ga0495618_0008344 Ga0495618_0008344_511_1287 258
268 3300046514 Ga0495618_0013935 Ga0495618_0013935_3785_4561 258
269 3300046514 Ga0495618_0015105 Ga0495618_0015105_3899_4675 258
270 3300046516 Ga0495628_0004664 Ga0495628_0004664_3890_4666 258
271 3300046516 Ga0495628_0035850 Ga0495628_0035850_2331_3107 258
272 3300046516 Ga0495628_0226036 Ga0495628_0226036_269_1045 258
273 3300046517 Ga0495630_0023614 Ga0495630_0023614_974_1750 258
274 3300046517 Ga0495630_0153979 Ga0495630_0153979_666_1442 258
275 3300046517 Ga0495630_0458051 Ga0495630_0458051_19_795 258
276 3300046518 Ga0495631_0096595 Ga0495631_0096595_36_878 258
277 3300046524 Ga0495648_0013350 Ga0495648_0013350_4486_5262 258
278 3300046524 Ga0495648_0021806 Ga0495648_0021806_2810_3586 258
279 3300046524 Ga0495648_0022305 Ga0495648_0022305_1657_2433 258
280 3300046526 Ga0495666_0001310 Ga0495666_0001310_5599_6375 258
281 3300046526 Ga0495666_0006198 Ga0495666_0006198_829_1605 258
282 3300046526 Ga0495666_0028413 Ga0495666_0028413_1041_1817 258
283 3300046526 Ga0495666_0089274 Ga0495666_0089274_625_1401 258
284 3300046528 Ga0495642_0022592 Ga0495642_0022592_795_1571 258
285 3300046528 Ga0495642_0044179 Ga0495642_0044179_75_851 258
286 3300046529 Ga0495652_0026861 Ga0495652_0026861_1972_2748 258
287 3300046529 Ga0495652_0047759 Ga0495652_0047759_665_1441 258
288 3300046529 Ga0495652_0476373 Ga0495652_0476373_62_838 258
289 3300046530 Ga0495654_0018434 Ga0495654_0018434_725_1567 258
290 3300046531 Ga0495665_0005411 Ga0495665_0005411_326_1102 258
291 3300046531 Ga0495665_0016383 Ga0495665_0016383_1859_2635 258
292 3300046531 Ga0495665_0052901 Ga0495665_0052901_424_1200 258
293 3300046533 Ga0495640_0001884 Ga0495640_0001884_8868_9644 258
294 3300046533 Ga0495640_0038598 Ga0495640_0038598_665_1441 258
295 3300046533 Ga0495640_0047151 Ga0495640_0047151_734_1510 258
296 3300046533 Ga0495640_0222850 Ga0495640_0222850_237_1013 258
297 3300046535 Ga0495586_0009465 Ga0495586_0009465_2274_3050 258
298 3300046535 Ga0495586_0048548 Ga0495586_0048548_497_1339 258
299 3300046536 Ga0495587_0003036 Ga0495587_0003036_7027_7803 258
300 3300046536 Ga0495587_0010493 Ga0495587_0010493_762_1538 258
301 3300046543 Ga0495645_0005495 Ga0495645_0005495_2137_2913 258
302 3300046543 Ga0495645_0024351 Ga0495645_0024351_1622_2464 258
303 3300046543 Ga0495645_0219889 Ga0495645_0219889_120_896 258
304 3300046557 Ga0495622_0000331 Ga0495622_0000331_21606_22382 258
305 3300046557 Ga0495622_0012713 Ga0495622_0012713_1939_2715 258
306 3300046559 Ga0495667_0110790 Ga0495667_0110790_724_1500 258
307 3300046642 Ga0495634_0014354 Ga0495634_0014354_3283_4059 258
308 3300046642 Ga0495634_0015707 Ga0495634_0015707_815_1591 258
309 3300046642 Ga0495634_0016998 Ga0495634_0016998_3441_4217 258
310 3300046660 Ga0495625_0080599 Ga0495625_0080599_442_1218 258
311 3300046663 Ga0495635_0001806 Ga0495635_0001806_8861_9637 258
312 3300046663 Ga0495635_0008783 Ga0495635_0008783_915_1691 258
313 3300046665 Ga0495661_0015795 Ga0495661_0015795_1666_2442 258
314 3300046665 Ga0495661_0024967 Ga0495661_0024967_1226_2002 258
315 3300046665 Ga0495661_0190879 Ga0495661_0190879_49_891 258
316 3300046674 Ga0495588_0049225 Ga0495588_0049225_1041_1817 258
317 3300046674 Ga0495588_0317868 Ga0495588_0317868_14_790 258
318 3300046678 Ga0495599_0010717 Ga0495599_0010717_2413_3189 258
319 3300046678 Ga0495599_0023523 Ga0495599_0023523_2604_3380 258
320 3300046678 Ga0495599_0329728 Ga0495599_0329728_119_895 258
321 3300046679 Ga0495623_0012095 Ga0495623_0012095_3382_4158 258
322 3300046679 Ga0495623_0037621 Ga0495623_0037621_105_881 258
323 3300046679 Ga0495623_0157392 Ga0495623_0157392_475_1317 258
324 3300046680 Ga0495646_0000409 Ga0495646_0000409_10274_11050 258
325 3300046680 Ga0495646_0004116 Ga0495646_0004116_2837_3613 258
326 3300046680 Ga0495646_0005397 Ga0495646_0005397_6738_7514 258
327 3300046680 Ga0495646_0015879 Ga0495646_0015879_689_1465 258
328 3300046680 Ga0495646_0097638 Ga0495646_0097638_732_1574 258
329 3300046689 Ga0495613_0025193 Ga0495613_0025193_2426_3202 258
330 3300046689 Ga0495613_0122427 Ga0495613_0122427_290_1132 258
331 3300046690 Ga0495624_0014011 Ga0495624_0014011_2349_3125 258
332 3300046690 Ga0495624_0016475 Ga0495624_0016475_2321_3097 258
333 3300046690 Ga0495624_0046365 Ga0495624_0046365_654_1430 258
334 3300046690 Ga0495624_0068141 Ga0495624_0068141_1223_1999 258
335 3300046690 Ga0495624_0384073 Ga0495624_0384073_36_812 258
336 3300046692 Ga0495671_0055327 Ga0495671_0055327_245_1021 258
337 3300046694 Ga0495649_0003555 Ga0495649_0003555_2310_3086 258
338 3300046694 Ga0495649_0151601 Ga0495649_0151601_184_960 258
339 3300046794 Ga0495589_0002122 Ga0495589_0002122_5621_6397 258
340 3300046809 Ga0495600_0004214 Ga0495600_0004214_5774_6550 258
341 3300046809 Ga0495600_0004385 Ga0495600_0004385_3637_4413 258
342 3300047315 Ga0495581_0004802 Ga0495581_0004802_1098_1874 258
343 3300047315 Ga0495581_0007965 Ga0495581_0007965_2368_3144 258
344 3300047315 Ga0495581_0011192 Ga0495581_0011192_2371_3147 258
345 3300047315 Ga0495581_0016186 Ga0495581_0016186_190_1032 258
346 3300047317 Ga0495604_0016598 Ga0495604_0016598_1546_2322 258
347 3300047317 Ga0495604_0022016 Ga0495604_0022016_2214_2990 258
348 3300047319 Ga0495674_0010314 Ga0495674_0010314_4788_5564 258
349 3300047319 Ga0495674_0019384 Ga0495674_0019384_3688_4464 258
350 3300047319 Ga0495674_0043736 Ga0495674_0043736_2331_3107 258
351 3300047319 Ga0495674_0060069 Ga0495674_0060069_664_1440 258
352 3300047319 Ga0495674_0063322 Ga0495674_0063322_1869_2645 258
353 3300047319 Ga0495674_0117883 Ga0495674_0117883_384_1160 258
354 3300047319 Ga0495674_0176662 Ga0495674_0176662_645_1421 258
355 3300047320 Ga0495672_0008769 Ga0495672_0008769_2479_3255 258
356 3300047320 Ga0495672_0120996 Ga0495672_0120996_257_1033 258
357 3300047321 Ga0495676_0003894 Ga0495676_0003894_10345_11121 258
358 3300047321 Ga0495676_0019464 Ga0495676_0019464_1558_2334 258
359 3300047321 Ga0495676_0119282 Ga0495676_0119282_552_1328 258
360 3300047322 Ga0495680_0008290 Ga0495680_0008290_3899_4675 258
361 3300047322 Ga0495680_0010562 Ga0495680_0010562_2110_2886 258
362 3300047323 Ga0495683_0001788 Ga0495683_0001788_7189_7965 258
363 3300047323 Ga0495683_0005926 Ga0495683_0005926_2299_3075 258
364 3300047323 Ga0495683_0007658 Ga0495683_0007658_2379_3155 258
365 3300047323 Ga0495683_0020544 Ga0495683_0020544_487_1263 258
366 3300047443 Ga0495687_007581 Ga0495687_007581_3252_4028 258
367 3300047443 Ga0495687_014654 Ga0495687_014654_710_1486 258
368 3300047443 Ga0495687_070075 Ga0495687_070075_65_841 258
369 3300047444 Ga0495675_0001684 Ga0495675_0001684_7124_7900 258
370 3300047444 Ga0495675_0019605 Ga0495675_0019605_386_1162 258
371 3300047444 Ga0495675_0023758 Ga0495675_0023758_1659_2435 258
372 3300047444 Ga0495675_0062367 Ga0495675_0062367_385_1161 258
373 3300047446 Ga0495679_000033 Ga0495679_000033_146303_147079 258
374 3300047446 Ga0495679_000281 Ga0495679_000281_10940_11716 258
375 3300047446 Ga0495679_004276 Ga0495679_004276_2369_3145 258
376 3300047469 Ga0495673_0004258 Ga0495673_0004258_5097_5873 258
377 3300047471 Ga0495684_0102178 Ga0495684_0102178_766_1542 258
378 3300047673 Ga0495593_0008892 Ga0495593_0008892_4281_5057 258
379 3300047673 Ga0495593_0009591 Ga0495593_0009591_1955_2731 258
380 3300047673 Ga0495593_0012096 Ga0495593_0012096_351_1127 258
381 3300047673 Ga0495593_0030500 Ga0495593_0030500_1412_2254 258
382 3300048088 Ga0495602_0034685 Ga0495602_0034685_2629_3405 258
383 3300048088 Ga0495602_0050032 Ga0495602_0050032_2331_3107 258
384 3300048088 Ga0495602_0067933 Ga0495602_0067933_84_860 258
385 3300048088 Ga0495602_0106198 Ga0495602_0106198_296_1072 258
386 3300048088 Ga0495602_0138397 Ga0495602_0138397_220_996 258
387 3300048089 Ga0495614_0000942 Ga0495614_0000942_10940_11716 258
388 3300048089 Ga0495614_0001121 Ga0495614_0001121_1861_2637 258
389 3300048089 Ga0495614_0004716 Ga0495614_0004716_5056_5832 258
390 3300048091 Ga0495626_0011951 Ga0495626_0011951_3115_3891 258
391 3300048091 Ga0495626_0058125 Ga0495626_0058125_375_1151 258
392 3300048091 Ga0495626_0088761 Ga0495626_0088761_530_1306 258
393 3300048903 Ga0496100_0009715 Ga0496100_0009715_2967_3743 258
394 3300048903 Ga0496100_0090434 Ga0496100_0090434_760_1536 258
395 3300048904 Ga0496101_0001859 Ga0496101_0001859_8317_9093 258
396 3300048904 Ga0496101_0067977 Ga0496101_0067977_337_1113 258
397 3300048905 Ga0496102_0001559 Ga0496102_0001559_15430_16206 258
398 3300048905 Ga0496102_0017830 Ga0496102_0017830_3401_4177 258
399 3300048905 Ga0496102_0271139 Ga0496102_0271139_707_1510 258
400 3300048906 Ga0496103_0000509 Ga0496103_0000509_28599_29375 258
401 3300048906 Ga0496103_0003011 Ga0496103_0003011_3628_4404 258
402 3300048907 Ga0496104_0053051 Ga0496104_0053051_322_1098 258
403 3300048908 Ga0496105_0073501 Ga0496105_0073501_877_1653 258
404 3300048909 Ga0496106_0000023 Ga0496106_0000023_117414_118190 258
405 3300048915 Ga0496112_0061174 Ga0496112_0061174_549_1325 258
406 3300048917 Ga0496114_0011669 Ga0496114_0011669_4247_5089 258
407 3300048917 Ga0496114_0155006 Ga0496114_0155006_881_1657 258
408 3300048918 Ga0496115_0058461 Ga0496115_0058461_2042_2818 258
409 3300048919 Ga0496116_0026356 Ga0496116_0026356_1422_2225 258
410 3300048920 Ga0496117_0001289 Ga0496117_0001289_20726_21502 258
411 3300048920 Ga0496117_0034793 Ga0496117_0034793_3002_3778 258
412 3300048920 Ga0496117_0081330 Ga0496117_0081330_358_1134 258
413 3300048920 Ga0496117_0120553 Ga0496117_0120553_407_1210 258
414 3300048920 Ga0496117_0167167 Ga0496117_0167167_310_1086 258
415 3300048921 Ga0496118_0001941 Ga0496118_0001941_6541_7317 258
416 3300048921 Ga0496118_0002754 Ga0496118_0002754_6024_6800 258
417 3300048921 Ga0496118_0006727 Ga0496118_0006727_433_1236 258
418 3300048921 Ga0496118_0019889 Ga0496118_0019889_3520_4296 258
419 3300048921 Ga0496118_0030367 Ga0496118_0030367_1641_2417 258
420 3300048922 Ga0496119_0244083 Ga0496119_0244083_73_849 258
421 3300048924 Ga0496121_0005142 Ga0496121_0005142_6112_6888 258
422 3300048924 Ga0496121_0005516 Ga0496121_0005516_14668_15444 258
423 3300048924 Ga0496121_0059667 Ga0496121_0059667_1089_1865 258
424 3300048924 Ga0496121_0223429 Ga0496121_0223429_391_1167 258
425 3300048929 Ga0496126_0003800 Ga0496126_0003800_3685_4461 258
426 3300048929 Ga0496126_0022772 Ga0496126_0022772_2549_3325 258
427 3300048929 Ga0496126_0385573 Ga0496126_0385573_240_1016 258
428 3300048929 Ga0496126_0481973 Ga0496126_0481973_98_874 258
429 3300048986 Ga0466983_0265091 Ga0466983_0265091_10_828 258
430 3300049459 Ga0495678_102669 Ga0495678_102669_164_940 258
431 3300049460 Ga0495682_0040053 Ga0495682_0040053_795_1571 258
432 3300053122 Ga0500608_082624 Ga0500608_082624_28_810 258
433 3300061719 Ga0466962_0031251 Ga0466962_0031251_1441_2217 258
434 3300061719 Ga0466962_0036563 Ga0466962_0036563_464_1240 258
435 3300005339 Ga0070660_100147007 Ga0070660_1001470072 259
436 3300005563 Ga0068855_100063667 Ga0068855_1000636677 259
437 3300009093 Ga0105240_10078506 Ga0105240_100785062 259
438 3300013104 Ga0157370_10003999 Ga0157370_100039992 259
439 3300025226 Ga0209674_100466 Ga0209674_1004665 259
440 3300025256 Ga0209759_1000152 Ga0209759_100015261 259
441 3300025909 Ga0207705_10000972 Ga0207705_100009722 259
442 3300025913 Ga0207695_10122834 Ga0207695_101228342 259
443 3300025949 Ga0207667_10000448 Ga0207667_100004486 259
444 3300044684 Ga0466966_0102627 Ga0466966_0102627_457_1236 259
445 3300044694 Ga0466963_0022134 Ga0466963_0022134_2193_2975 260
446 3300048929 Ga0496126_0021396 Ga0496126_0021396_782_1564 260
447 3300048929 Ga0496126_0183657 Ga0496126_0183657_569_1351 260
448 3300025294 Ga0209025_1000363 Ga0209025_100036353 265
449 3300025303 Ga0209051_1015587 Ga0209051_10155873 265
450 3300047317 Ga0495604_0071964 Ga0495604_0071964_1440_2246 265
451 3300047318 Ga0495636_0001546 Ga0495636_0001546_307_1137 265
452 iso_pu_bacteria 2596583598 2597032178 265
453 iso_pu_bacteria 2599185178 2599444248 265
454 iso_pu_bacteria 2885266251 2885268457 265
455 iso_pu_bacteria 2900577576 2900579448 265
456 iso_pu_bacteria 2928058823 2928063270 265
457 3300001915 JGI24741J21665_1000650 JGI24741J21665_10006503 269
458 3300001979 JGI24740J21852_10000469 JGI24740J21852_1000046910 269
459 3300001979 JGI24740J21852_10002835 JGI24740J21852_100028354 269
460 3300002705 JGI25156J39149_1007996 JGI25156J39149_10079962 269
461 3300002738 JGI25154J39366_1001286 JGI25154J39366_10012866 269
462 3300003323 rootH1_10106529 rootH1_101065295 269
463 3300003751 Ga0055538_1004763 Ga0055538_10047631 269
464 3300003751 Ga0055538_1006167 Ga0055538_10061671 269
465 3300003752 Ga0055539_1000062 Ga0055539_100006219 269
466 3300003752 Ga0055539_1007246 Ga0055539_10072462 269
467 3300003756 Ga0055533_1005466 Ga0055533_10054662 269
468 3300003756 Ga0055533_1005773 Ga0055533_10057732 269
469 3300003758 Ga0055532_1000019 Ga0055532_1000019240 269
470 3300003759 Ga0055525_1000558 Ga0055525_10005585 269
471 3300003760 Ga0055527_1002617 Ga0055527_10026172 269
472 3300003761 Ga0055535_1000014 Ga0055535_100001441 269
473 3300003762 Ga0055542_1000412 Ga0055542_100041238 269
474 3300003763 Ga0055529_1000086 Ga0055529_100008621 269
475 3300003763 Ga0055529_1000368 Ga0055529_100036819 269
476 3300003841 Ga0055541_1007038 Ga0055541_10070383 269
477 3300005344 Ga0070661_100000088 Ga0070661_10000008837 269
478 3300005366 Ga0070659_100000423 Ga0070659_10000042336 269
479 3300005455 Ga0070663_100000010 Ga0070663_10000001024 269
480 3300005564 Ga0070664_100000005 Ga0070664_100000005177 269
481 3300005578 Ga0068854_100000104 Ga0068854_10000010441 269
482 3300005614 Ga0068856_100000054 Ga0068856_10000005424 269
483 3300009093 Ga0105240_10038630 Ga0105240_100386302 269
484 3300013100 Ga0157373_10013913 Ga0157373_100139134 269
485 3300013102 Ga0157371_10000103 Ga0157371_1000010390 269
486 3300013104 Ga0157370_10000513 Ga0157370_1000051340 269
487 3300013105 Ga0157369_10002526 Ga0157369_100025269 269
488 3300013307 Ga0157372_10000461 Ga0157372_1000046126 269
489 3300015261 Ga0182006_1001742 Ga0182006_10017427 269
490 3300015262 Ga0182007_10008356 Ga0182007_100083564 269
491 3300020077 Ga0206351_10215564 Ga0206351_102155647 269
492 3300020610 Ga0154015_1028955 Ga0154015_10289556 269
493 3300025224 Ga0209784_100003 Ga0209784_1000031236 269
494 3300025224 Ga0209784_100390 Ga0209784_1003907 269
495 3300025224 Ga0209784_102471 Ga0209784_1024713 269
496 3300025225 Ga0209566_100002 Ga0209566_1000022190 269
497 3300025225 Ga0209566_100705 Ga0209566_1007057 269
498 3300025226 Ga0209674_100094 Ga0209674_1000947 269
499 3300025226 Ga0209674_100363 Ga0209674_1003638 269
500 3300025226 Ga0209674_102637 Ga0209674_1026372 269
501 3300025228 Ga0209672_100408 Ga0209672_1004086 269
502 3300025229 Ga0209147_100002 Ga0209147_1000021179 269
503 3300025230 Ga0209563_100004 Ga0209563_1000041607 269
504 3300025242 Ga0209258_100002 Ga0209258_1000021179 269
505 3300025246 Ga0209646_1000019 Ga0209646_1000019112 269
506 3300025250 Ga0209026_1003559 Ga0209026_10035595 269
507 3300025253 Ga0209677_100009 Ga0209677_10000925 269
508 3300025253 Ga0209677_104090 Ga0209677_1040903 269
509 3300025254 Ga0209148_1000471 Ga0209148_100047117 269
510 3300025254 Ga0209148_1007995 Ga0209148_10079952 269
511 3300025256 Ga0209759_1003435 Ga0209759_10034352 269
512 3300025272 Ga0209455_1000076 Ga0209455_1000076238 269
513 3300025913 Ga0207695_10002145 Ga0207695_1000214534 269
514 3300025920 Ga0207649_10000098 Ga0207649_1000009842 269
515 3300025932 Ga0207690_10036478 Ga0207690_100364783 269
516 3300025945 Ga0207679_10000020 Ga0207679_10000020172 269
517 3300025981 Ga0207640_10000092 Ga0207640_1000009251 269
518 3300026067 Ga0207678_10000181 Ga0207678_1000018126 269
519 3300026078 Ga0207702_10000017 Ga0207702_10000017172 269
520 3300026116 Ga0207674_10008405 Ga0207674_1000840511 269
521 3300037418 Ga0395900_0012088 Ga0395900_0012088_4544_5353 269
522 3300044658 Ga0466972_0033367 Ga0466972_0033367_1478_2287 269
523 3300044683 Ga0466965_0116040 Ga0466965_0116040_500_1309 269
524 3300044693 Ga0466961_0000898 Ga0466961_0000898_2803_3612 269
525 3300044765 Ga0466970_0001921 Ga0466970_0001921_559_1368 269
526 3300045976 Ga0466967_0048324 Ga0466967_0048324_1011_1820 269
527 3300061719 Ga0466962_0003888 Ga0466962_0003888_3570_4379 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

4

259

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fke-assembly1.cif.gz_A structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin 0.9675 1 267
2jc4-assembly1.cif.gz_A 3'-5' exonuclease (nexo) from neisseria meningitidis 0.9672 1 266
6fke-assembly1.cif.gz_A structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin 0.9565 1 267
2jc4-assembly1.cif.gz_A 3'-5' exonuclease (nexo) from neisseria meningitidis 0.9561 1 266
2voa-assembly1.cif.gz_B structure of an ap endonuclease from archaeoglobus fulgidus 0.9461 1 266
ID Description Score Start End Superfamily
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9675 1 267 3.60.10.10
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9564 1 267 3.60.10.10
2voaB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.944 1 266 3.60.10.10
2voaB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9298 1 266 3.60.10.10
af_P09030_1_268_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9204 1 268 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A522A026-F1-model_v4 Exodeoxyribonuclease III 0.9956 116 267 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872
AF-A3RPF3-F1-model_v4 deleted 0.9955 1 269
AF-A0A2M6XX45-F1-model_v4 Exodeoxyribonuclease III 0.9938 111 267 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872
AF-A0A562B3E3-F1-model_v4 Exodeoxyribonuclease-3 0.9937 1 267 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872
AF-A0A0M4KSC1-F1-model_v4 deleted 0.9934 1 267

Feature Viewer

pLDDT pTM Quality
94.42 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map